BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig6274
         (683 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T00440|T00440 hypothetical protein At2g47440 [imported] - Ar...   201   1e-50   Arabidopsis thaliana [mouse-ear cress]
gb:BT004635_1637669 Arabidopsis thaliana At4g02100 gene, complet...   199   4e-50   
gb:BT002307_1635910 Arabidopsis thaliana At3g62570/T12C14_270 mR...   186   4e-46   
pir|T01511|T01511 hypothetical protein T10M13.11 - Arabidopsis t...   179   4e-44   Arabidopsis thaliana [mouse-ear cress]
pir|E86156|E86156 T14P4.7 protein - Arabidopsis thaliana>gb:AE00...   153   2e-36   Arabidopsis thaliana [mouse-ear cress]
gb:AP004316_1840101 Oryza sativa (japonica cultivar-group) genom...   109   4e-23   
gb:AP003541_1830654 Oryza sativa (japonica cultivar-group) genom...    65   1e-09   
gb:OSJN00053_1693959 Oryza sativa genomic DNA, chromosome 4, BAC...    65   1e-09   
gb:AY223246_1176709 Schistosoma japonicum clone ZZD402 mRNA sequ...    34   2.1     
gb:AE006574_220316 Streptococcus pyogenes M1 GAS, section 103 of...    34   2.1     
gb:AP004192_1838809 Oryza sativa (japonica cultivar-group) genom...    34   2.7     
gb:ATAC009895_1543072 Arabidopsis thaliana chromosome III BAC T2...    33   3.6     
gb:CP000003_861011 Streptococcus pyogenes MGAS10394, complete ge...    33   6.1     
gb:BA000034_713746 Streptococcus pyogenes SSI-1 DNA, complete ge...    33   6.1     
gb:AE014157_304515 Streptococcus pyogenes MGAS315, section 22 of...    33   6.1     
gb:AE010058_258857 Streptococcus pyogenes strain MGAS8232, secti...    33   6.1     
gb:AFA5C11_1810871 Aspergillus fumigatus BAC AFA5C11.                  32   8.0     
gb:BX649606_1643419 Aspergillus fumigatus BAC pilot project supe...    32   8.0     


>pir|T00440|T00440 hypothetical protein At2g47440 [imported] -
           Arabidopsis thaliana>gb:AC002535_1530846 Arabidopsis
           thaliana chromosome 2 clone T30B22 map CIC06C03,
           complete sequence.>gb:AY099575_1576601 Arabidopsis
           thaliana unknown protein (At2g47440) mRNA, complete
           cds.>gb:BT002157_1635760 Arabidopsis thaliana unknown
           protein (At2g47440) mRNA, complete cds.
          Length = 526

 Score =  201 bits (510), Expect = 1e-50
 Identities = 99/161 (61%), Positives = 120/161 (74%)
 Frame = +3

Query: 201 KQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLL 380
           K+HWW T+RK+ DKY+KDA  L+AS++   +ASAL++LDAAL +SPRLE A+ELKAR+LL
Sbjct: 11  KKHWWFTHRKLVDKYIKDATTLMASEEANDVASALHLLDAALSISPRLETALELKARSLL 70

Query: 381 FLRRFKDVADMLQDYIPSLKVAPDEAXXXXXXXXXXXXXXXXXXRERVKLLSSGDDEPTF 560
           FLRRFKDVADMLQDYIPSLK+  DE                    + + LLS      +F
Sbjct: 71  FLRRFKDVADMLQDYIPSLKL-DDEGSASSQGSSSS---------DGINLLSDASSPGSF 120

Query: 561 KCFSVSDLKKKVMAGLCKSCEKDGLWRYLVLGQACCHLGLM 683
           KCFSVSDLKKKVMAG+CK C+K+G WRY+VLGQACCHLGLM
Sbjct: 121 KCFSVSDLKKKVMAGICKKCDKEGQWRYVVLGQACCHLGLM 161



>gb:BT004635_1637669 Arabidopsis thaliana At4g02100 gene, complete
           cds.
          Length = 546

 Score =  199 bits (506), Expect = 4e-50
 Identities = 105/169 (62%), Positives = 124/169 (73%), Gaps = 5/169 (2%)
 Frame = +3

Query: 192 GEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKAR 371
           GEKK HWWL N+KI DKY+K+AK LIASQDP  + SALN+L++AL +SPR ELA+ELKAR
Sbjct: 5   GEKK-HWWLRNKKIVDKYMKEAKSLIASQDPNDVKSALNLLESALSVSPRYELALELKAR 63

Query: 372 TLLFLRRFKDVADMLQDYIPSLKVAPDEAXXXXXXXXXXXXXXXXXXRERVKLLSS---- 539
           +LL+LRR+KDVADMLQDYIPSLK+A                      RE VKLL+     
Sbjct: 64  SLLYLRRYKDVADMLQDYIPSLKLA---GGGEDSGIGSSELSFTHSSRESVKLLNDLPSH 120

Query: 540 -GDDEPTFKCFSVSDLKKKVMAGLCKSCEKDGLWRYLVLGQACCHLGLM 683
               + +FKCFSVSDLKKKVMAGL K+C++ G WRYLVLGQACCHLGLM
Sbjct: 121 HHHHDSSFKCFSVSDLKKKVMAGLTKNCDEQGQWRYLVLGQACCHLGLM 169



>gb:BT002307_1635910 Arabidopsis thaliana At3g62570/T12C14_270 mRNA,
           complete cds.>gb:AF419555_1798417 Arabidopsis thaliana
           AT3g62570/T12C14_270 mRNA, complete cds.
          Length = 552

 Score =  186 bits (471), Expect = 4e-46
 Identities = 90/161 (55%), Positives = 117/161 (72%)
 Frame = +3

Query: 201 KQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLL 380
           K+HWW T++KI DKY+KDA+ L+ S++   +ASA+++LDAAL +SPR E A+ELKAR+LL
Sbjct: 11  KKHWWFTHKKIVDKYIKDARSLMESEEQNDVASAIHLLDAALSISPRSETALELKARSLL 70

Query: 381 FLRRFKDVADMLQDYIPSLKVAPDEAXXXXXXXXXXXXXXXXXXRERVKLLSSGDDEPTF 560
           FLRRFKDV DMLQDYIPSLK+A +E                     ++   SS   + +F
Sbjct: 71  FLRRFKDVVDMLQDYIPSLKLAVNEEDGSYSYEGSSYSSSSSQLSRKLLSDSSPRRDSSF 130

Query: 561 KCFSVSDLKKKVMAGLCKSCEKDGLWRYLVLGQACCHLGLM 683
           KCFSVS LKKK+MAG+CK+ ++D  WRY+VLGQACCHLGLM
Sbjct: 131 KCFSVSYLKKKIMAGICKNRDQDKQWRYVVLGQACCHLGLM 171



>pir|T01511|T01511 hypothetical protein T10M13.11 - Arabidopsis
           thaliana>gb:ATAF001308_1543837 Arabidopsis thaliana BAC
           T10M13 from chromosome IV, from 10.8 cM to 11.6 cM,
           complete sequence.>gb:ATCHRIV5_1545733 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No. 5.
          Length = 571

 Score =  179 bits (454), Expect = 4e-44
 Identities = 97/168 (57%), Positives = 117/168 (69%), Gaps = 5/168 (2%)
 Frame = +3

Query: 195 EKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKART 374
           E+ Q      + I DKY+K+AK LIASQDP  + SALN+L++AL +SPR ELA+ELKAR+
Sbjct: 30  ERIQRTSSKGKSIVDKYMKEAKSLIASQDPNDVKSALNLLESALSVSPRYELALELKARS 89

Query: 375 LLFLRRFKDVADMLQDYIPSLKVAPDEAXXXXXXXXXXXXXXXXXXRERVKLLSS----- 539
           LL+LRR+KDVADMLQDYIPSLK+A                      RE VKLL+      
Sbjct: 90  LLYLRRYKDVADMLQDYIPSLKLA---GGGEDSGIGSSELSFTHSSRESVKLLNDLPSHH 146

Query: 540 GDDEPTFKCFSVSDLKKKVMAGLCKSCEKDGLWRYLVLGQACCHLGLM 683
              + +FKCFSVSDLKKKVMAGL K+C++ G WRYLVLGQACCHLGLM
Sbjct: 147 HHHDSSFKCFSVSDLKKKVMAGLTKNCDEQGQWRYLVLGQACCHLGLM 194



>pir|E86156|E86156 T14P4.7 protein - Arabidopsis
           thaliana>gb:AE005172_889286 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC022521_1539083 Arabidopsis thaliana
           chromosome I BAC T14P4 genomic sequence, complete
           sequence.
          Length = 513

 Score =  153 bits (387), Expect = 2e-36
 Identities = 83/160 (51%), Positives = 105/160 (65%), Gaps = 2/160 (1%)
 Frame = +3

Query: 210 WWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMELKARTLLFLR 389
           WW  NRK  DKY+K+AK LI SQDP  + SAL++L++ L +SP  ELA+ELKAR+LL+LR
Sbjct: 6   WWKRNRKKVDKYMKNAKDLITSQDPNDIVSALSLLNSTLSISPHHELALELKARSLLYLR 65

Query: 390 RFKDVADMLQDYIPSLKVAPDEAXXXXXXXXXXXXXXXXXXRERVKLLSSG--DDEPTFK 563
           RFKDVA +L +YIPSL++  ++                      + LL SG    + +FK
Sbjct: 66  RFKDVAVLLHNYIPSLRIDNEDVSSVFAASSELSSL--------MLLLPSGSPSHDSSFK 117

Query: 564 CFSVSDLKKKVMAGLCKSCEKDGLWRYLVLGQACCHLGLM 683
           CFS S LKKKVMAGL  + +  G WRYLVLGQAC HLGLM
Sbjct: 118 CFSYSYLKKKVMAGLSNNSQVQGQWRYLVLGQACYHLGLM 157



>gb:AP004316_1840101 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0597G07.
          Length = 603

 Score =  109 bits (273), Expect = 4e-23
 Identities = 67/182 (36%), Positives = 96/182 (52%), Gaps = 19/182 (10%)
 Frame = +3

Query: 195 EKKQHWWLTNRK-IADKYVKDAKVLIASQ----------DPGAMASALNVLDAALLLSPR 341
           +++++W   +RK I   Y+ +A+  +A+           +  A  +AL +++A L +SPR
Sbjct: 7   DRRRNWLRGHRKQIIGDYLAEARAALAAAAAAPLDGEGGEHSAATAALGLVEAVLEMSPR 66

Query: 342 LELAMELKARTLLFLRRFKDVADMLQDYIPSLKVAPDEAXXXXXXXXXXXXXXXXXXRER 521
           +E A+EL+AR+LL LRR++ VADML+DYIPS      +                     R
Sbjct: 67  MEAALELRARSLLALRRYRAVADMLRDYIPSC----TKPCSADDTSSSSSSSSSCSSASR 122

Query: 522 VKLLSSGDDEPT--------FKCFSVSDLKKKVMAGLCKSCEKDGLWRYLVLGQACCHLG 677
             LLS   D             CF +SDLK +V+AG  K+   D  WRYLVLGQAC HLG
Sbjct: 123 TDLLSPARDRSDAASAASRFLCCFDISDLKHRVLAGFSKNTSADTQWRYLVLGQACFHLG 182

Query: 678 LM 683
           LM
Sbjct: 183 LM 184



>gb:AP003541_1830654 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0530H05.>gb:AP004733_1843966 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBa0023I22.
          Length = 253

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 39/96 (40%), Positives = 59/96 (61%), Gaps = 9/96 (9%)
 Frame = +3

Query: 174 SPCFAGGEKKQHWWLTNRK-IADKYVKDAKVLIASQDP--------GAMASALNVLDAAL 326
           SP  +  +K++ W   +RK I   Y+ +A+   A+  P         A  +AL +++A L
Sbjct: 36  SPSSSPPDKRRIWLRGHRKQIIGDYLIEARAAFAAAAPLNGECGDHSAATTALGLVEAVL 95

Query: 327 LLSPRLELAMELKARTLLFLRRFKDVADMLQDYIPS 434
            LSPR+E A+EL+A +LL  RR++ VADML+DYIPS
Sbjct: 96  ELSPRMEAALELRACSLLAFRRYRGVADMLRDYIPS 131



>gb:OSJN00053_1693959 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0081L15, complete sequence.
          Length = 222

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 39/96 (40%), Positives = 59/96 (61%), Gaps = 9/96 (9%)
 Frame = +3

Query: 174 SPCFAGGEKKQHWWLTNRK-IADKYVKDAKVLIASQDP--------GAMASALNVLDAAL 326
           SP  +  +K++ W   +RK I   Y+ +A+   A+  P         A  +AL +++A L
Sbjct: 36  SPSSSPPDKRRIWLRGHRKQIIGDYLIEARAAFAAAAPLNGECGDHSAATTALGLVEAVL 95

Query: 327 LLSPRLELAMELKARTLLFLRRFKDVADMLQDYIPS 434
            LSPR+E A+EL+A +LL  RR++ VADML+DYIPS
Sbjct: 96  ELSPRMEAALELRACSLLAFRRYRGVADMLRDYIPS 131



>gb:AY223246_1176709 Schistosoma japonicum clone ZZD402 mRNA
           sequence.
          Length = 342

 Score = 34.3 bits (77), Expect = 2.1
 Identities = 22/52 (42%), Positives = 31/52 (59%), Gaps = 1/52 (1%)
 Frame = +3

Query: 303 LNVLDAALLLSPRLELAMELKARTLLFLRRFKDVADMLQDYIPSLKV-APDE 455
           LN  D   L S  L+   E+KA+ LL+LR   ++ DM+ D+I SL +  PDE
Sbjct: 264 LNWEDDLELYSRFLDRKDEIKAQYLLYLRDHPEIYDMISDFIKSLLLRKPDE 315



>gb:AE006574_220316 Streptococcus pyogenes M1 GAS, section 103 of
           167 of the complete genome.>gb:AF280764_495295
           Streptococcus pyogenes DNA polymerase III gamma/tau
           subunits (dnaX) gene, partial cds.>gb:AE004092_1106162
           Streptococcus pyogenes M1 GAS, complete genome.
          Length = 556

 Score = 34.3 bits (77), Expect = 2.1
 Identities = 22/51 (43%), Positives = 29/51 (56%)
 Frame = +3

Query: 210 WWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSPRLELAMEL 362
           W L    IA  Y  DA  LIA +  G M  AL++LD AL LSP  ++A+ +
Sbjct: 188 WVLDKEGIA--YEVDALNLIARRAEGGMRDALSILDQALSLSPDNQVAIAI 236



>gb:AP004192_1838809 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1643_A10.
          Length = 455

 Score = 33.9 bits (76), Expect = 2.7
 Identities = 20/60 (33%), Positives = 27/60 (45%)
 Frame = +3

Query: 279 DPGAMASALNVLDAALLLSPRLELAMELKARTLLFLRRFKDVADMLQDYIPSLKVAPDEA 458
           DP  + S    +D A L +     A+ L AR L   RRF D   +L  +IP+    P  A
Sbjct: 49  DPDRVVSLFEAIDDASLSASSTRHALSLAARRLSRSRRFADAEALLSSHIPASPTEPQLA 108



>gb:ATAC009895_1543072 Arabidopsis thaliana chromosome III BAC T21P5
           genomic sequence, complete sequence.
          Length = 272

 Score = 33.5 bits (75), Expect = 3.6
 Identities = 28/101 (27%), Positives = 47/101 (46%), Gaps = 7/101 (6%)
 Frame = +3

Query: 150 ELGTTM-SESPCFAG-----GEKKQHWWLTNRKIADKYVKDAKVLIASQDPGAMASALNV 311
           E+G T  S  PCF        ++  HW+ T +K  +     A V     D G +A  ++ 
Sbjct: 49  EMGETYPSVVPCFGLHPWFIADRSPHWFKTLKKFFET-TPTAAVGEIGLDKGPLAGGIDY 107

Query: 312 LDAALLLSPRLELAMEL-KARTLLFLRRFKDVADMLQDYIP 431
            D  ++  P+LELA EL K   +  +  F D+ ++++   P
Sbjct: 108 SDQLVVFRPQLELAKELNKPVAVHCIDAFDDLLEIMRSIGP 148



>gb:CP000003_861011 Streptococcus pyogenes MGAS10394, complete
           genome.
          Length = 556

 Score = 32.7 bits (73), Expect = 6.1
 Identities = 21/43 (48%), Positives = 24/43 (55%)
 Frame = +3

Query: 210 WWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSP 338
           W L    IA  Y  DA  LIA +  G M  AL++LD AL LSP
Sbjct: 188 WVLDKEGIA--YEVDALNLIARRAEGGMRDALSILDQALSLSP 228



>gb:BA000034_713746 Streptococcus pyogenes SSI-1 DNA, complete
           genome.
          Length = 557

 Score = 32.7 bits (73), Expect = 6.1
 Identities = 21/43 (48%), Positives = 24/43 (55%)
 Frame = +3

Query: 210 WWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSP 338
           W L    IA  Y  DA  LIA +  G M  AL++LD AL LSP
Sbjct: 189 WVLDKEGIA--YEVDALNLIARRAEGGMRDALSILDQALSLSP 229



>gb:AE014157_304515 Streptococcus pyogenes MGAS315, section 22 of 37
           of the complete genome.>gb:AE014074_927694 Streptococcus
           pyogenes MGAS315, complete genome.
          Length = 556

 Score = 32.7 bits (73), Expect = 6.1
 Identities = 21/43 (48%), Positives = 24/43 (55%)
 Frame = +3

Query: 210 WWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSP 338
           W L    IA  Y  DA  LIA +  G M  AL++LD AL LSP
Sbjct: 188 WVLDKEGIA--YEVDALNLIARRAEGGMRDALSILDQALSLSP 228



>gb:AE010058_258857 Streptococcus pyogenes strain MGAS8232, section
           106 of 173 of the complete genome.>gb:AE009949_905239
           Streptococcus pyogenes strain MGAS8232, complete genome.
          Length = 556

 Score = 32.7 bits (73), Expect = 6.1
 Identities = 21/43 (48%), Positives = 24/43 (55%)
 Frame = +3

Query: 210 WWLTNRKIADKYVKDAKVLIASQDPGAMASALNVLDAALLLSP 338
           W L    IA  Y  DA  LIA +  G M  AL++LD AL LSP
Sbjct: 188 WVLDKEGIA--YEVDALNLIARRAEGGMRDALSILDQALSLSP 228



>gb:AFA5C11_1810871 Aspergillus fumigatus BAC AFA5C11.
          Length = 858

 Score = 32.3 bits (72), Expect = 8.0
 Identities = 18/56 (32%), Positives = 26/56 (46%)
 Frame = +3

Query: 273 SQDPGAMASALNVLDAALLLSPRLELAMELKARTLLFLRRFKDVADMLQDYIPSLK 440
           S DP A+   L      +LL  RL   +  K   +L   +FK   D+LQD+   L+
Sbjct: 601 SDDPAAIDETLVTASGKMLLLDRLVPCLLKKGHKILIFSQFKTQLDILQDWATQLR 656



>gb:BX649606_1643419 Aspergillus fumigatus BAC pilot project
           supercontig; segment 2/3.
          Length = 867

 Score = 32.3 bits (72), Expect = 8.0
 Identities = 18/56 (32%), Positives = 26/56 (46%)
 Frame = +3

Query: 273 SQDPGAMASALNVLDAALLLSPRLELAMELKARTLLFLRRFKDVADMLQDYIPSLK 440
           S DP A+   L      +LL  RL   +  K   +L   +FK   D+LQD+   L+
Sbjct: 610 SDDPAAIDETLVTASGKMLLLDRLVPCLLKKGHKILIFSQFKTQLDILQDWATQLR 665


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 659,356,184
Number of Sequences: 1806583
Number of extensions: 12451773
Number of successful extensions: 31378
Number of sequences better than 10.0: 18
Number of HSP's better than 10.0 without gapping: 30525
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31348
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 39068697605
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)