BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig6271
         (888 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY084529_1569618 Arabidopsis thaliana clone 11084 mRNA, compl...   155   1e-36   
pir|G86463|G86463 hypothetical protein F12G12.18 - Arabidopsis t...   154   2e-36   Arabidopsis thaliana [mouse-ear cress]
gb:AP003243_1826107 Oryza sativa (japonica cultivar-group) genom...    78   3e-13   
pir|F90096|F90096 high light inducible protein [imported] - Guil...    49   1e-04   Guillardia theta
gb:AP008231_580965 Synechococcus elongatus PCC 6301 DNA, complet...    40   0.046   
gb:AE017161_394568 Prochlorococcus marinus subsp. marinus str. C...    39   0.13    
gb:BX572090_795719 Prochlorococcus marinus MED4 complete genome;...    39   0.17    
gb:BX569694_777082 Synechococcus sp. WH8102 complete genome; seg...    38   0.23    
sp|Q02060|PSBS_SPIOL|PSBS_SPIOL Photosystem II 22 kDa protein, chloroplast ...    38   0.23    Spinacia oleracea
gb:BT002251_1635854 Arabidopsis thaliana At1g44575/T18F15 mRNA, ...    37   0.51    
gb:AB015859_1512731 Arabidopsis thaliana psbS mRNA for photosyst...    37   0.51    
gb:BX572099_798982 Prochlorococcus marinus MIT9313 complete geno...    37   0.51    
gb:BX569693_776351 Synechococcus sp. WH8102 complete genome; seg...    37   0.51    
sp|Q9XF91|PSBS_ARATH|PSBS_ARATH Photosystem II 22 kDa protein, chloroplast ...    37   0.51    Arabidopsis thaliana [mouse-ear cress]
gb:AP008231_580124 Synechococcus elongatus PCC 6301 DNA, complet...    37   0.66    
gb:BA000045_741518 Gloeobacter violaceus PCC 7421 DNA, complete ...    36   1.1     
gb:OSJN00076_1694426 Oryza sativa genomic DNA, chromosome 4, BAC...    35   1.9     
gb:AY291061_1595613 Zea mays photosystem II subunit PsbS precurs...    35   1.9     
gb:AP003235_1825894 Oryza sativa (japonica cultivar-group) genom...    35   2.5     
sp|Q9SMB4|PSBS_TOBAC|PSBS_TOBAC Photosystem II 22 kDa protein, chloroplast ...    35   2.5     Nicotiana tabacum [American tobacco]
gb:AC016163_1538116 Arabidopsis thaliana chromosome 1 BAC F26A9 ...    34   3.3     
gb:AB159049_1528427 Chlamydomonas reinhardtii mRNA for Lhc-like ...    34   3.3     
gb:BA000045_742789 Gloeobacter violaceus PCC 7421 DNA, complete ...    34   3.3     
gb:BA000039_726230 Thermosynechococcus elongatus BP-1 DNA, compl...    34   3.3     
gb:AJ628858_1494510 Cyanophage S-BM4 partial psbD gene, psbA gen...    34   4.3     
gb:AE017165_396092 Prochlorococcus marinus subsp. marinus str. C...    34   4.3     
pir|JC6204|JC6204 photosystem II 22-K chlorophyll-binding protei...    34   4.3     Oryza sativa Japonica Group [Japonica rice]
sp|P27516|CBR_DUNBA|CBR_DUNBA Carotene biosynthesis-related protein CBR, c...    34   4.3     
gb:BX572090_795690 Prochlorococcus marinus MED4 complete genome;...    33   5.6     
gb:BA000039_727539 Thermosynechococcus elongatus BP-1 DNA, compl...    33   5.6     
gb:AE017263_420948 Mesoplasma florum L1 complete genome.               33   5.6     
sp|Q9FPP4|PSBS_SOLSG|PSBS_SOLSG Photosystem II 22 kDa protein, chloroplast ...    33   5.6     Solanum sogarandinum
sp|P54773|PSBS_LYCES|PSBS_LYCES Photosystem II 22 kDa protein, chloroplast ...    33   5.6     Solanum lycopersicum
gb:AB002583_1508809 Cyanidioschyzon merolae chloroplast DNA, com...    33   9.6     


>gb:AY084529_1569618 Arabidopsis thaliana clone 11084 mRNA, complete
           sequence.
          Length = 171

 Score =  155 bits (391), Expect = 1e-36
 Identities = 95/178 (53%), Positives = 102/178 (57%), Gaps = 2/178 (1%)
 Frame = +3

Query: 141 MSVASSSSFPCIKFPNRSVVQXXXXXXXXXXXYTFMRFCVSKPPALNIRNSQAEGPFRRX 320
           MSVAS     CI+  N S               +F     +KP    IR SQ EGP RR 
Sbjct: 1   MSVASP--IQCIRILNPS-----SSSSSSTASSSFRFSTTTKPCVFIIRCSQTEGPLRRP 53

Query: 321 XXXXXXXXXXXXXXXXXXXXXXXXX--XXXXXXEDKSVVTLEFQRQKAKELQEYFKQKKL 494
                                            + KSV T+EFQRQKAKELQEYFKQKKL
Sbjct: 54  SAPPALREPQKPVPASQPSSSPPPPPPQKSVAIDGKSVTTVEFQRQKAKELQEYFKQKKL 113

Query: 495 DDANQGPFFGFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQVKILLSNFGILDLE 668
           + A QGPFFGF  KNEI+NGRWAMFGFAVGMLTEYATGSD VDQVKILLSNFGILDLE
Sbjct: 114 EAAGQGPFFGFQPKNEISNGRWAMFGFAVGMLTEYATGSDLVDQVKILLSNFGILDLE 171



>pir|G86463|G86463 hypothetical protein F12G12.18 - Arabidopsis
           thaliana>gb:AE005172_892203 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC015446_1537988 Arabidopsis thaliana
           chromosome I BAC F12G12 genomic sequence, complete
           sequence.>gb:AY045977_1561474 Arabidopsis thaliana
           unknown protein (At1g34000) mRNA, complete
           cds.>gb:AY050472_1562246 Arabidopsis thaliana
           At1g34000/F12G12_210 mRNA, complete
           cds.>gb:AY057393_1563884 Arabidopsis thaliana one-helix
           protein (OHP2) mRNA, complete cds.>gb:AY091438_1574638
           Arabidopsis thaliana putative photosystem II 22 kDa
           protein (At1g34000) mRNA, complete
           cds.>gb:AC079286_1732503 Arabidopsis thaliana chromosome
           1 BAC T15K4 genomic sequence, complete
           sequence.>gb:AF378874_1793459 Arabidopsis thaliana
           At1g34000/F12G12_210 mRNA, complete cds.
          Length = 172

 Score =  154 bits (390), Expect = 2e-36
 Identities = 95/179 (53%), Positives = 102/179 (56%), Gaps = 3/179 (1%)
 Frame = +3

Query: 141 MSVASSSSFPCIKFPNRSVVQXXXXXXXXXXXYTFMRFCVSKPPALNIRNSQAEGPFRRX 320
           MSVAS     CI+  N S               +F     +KP    IR SQ EGP RR 
Sbjct: 1   MSVASP--IQCIRILNPS-----SSSSSSTASSSFRFSTTTKPCVFIIRCSQTEGPLRRP 53

Query: 321 XXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXEDKSVVTLEFQRQKAKELQEYFKQKK 491
                                             + KSV T+EFQRQKAKELQEYFKQKK
Sbjct: 54  SAPPTLREPQKPVPPSQPSSSPPPSPPPQKAVAVDGKSVTTVEFQRQKAKELQEYFKQKK 113

Query: 492 LDDANQGPFFGFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQVKILLSNFGILDLE 668
           L+ A QGPFFGF  KNEI+NGRWAMFGFAVGMLTEYATGSD VDQVKILLSNFGILDLE
Sbjct: 114 LEAAGQGPFFGFQPKNEISNGRWAMFGFAVGMLTEYATGSDLVDQVKILLSNFGILDLE 172



>gb:AP003243_1826107 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0415C01.
          Length = 535

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 34/43 (79%), Positives = 42/43 (97%)
 Frame = +3

Query: 429 VTLEFQRQKAKELQEYFKQKKLDDANQGPFFGFIGKNEIANGR 557
           VTLE+QR+ AK+LQ+YFKQKKLD+A+QGPFFGF+GKNEI+NGR
Sbjct: 460 VTLEYQRKVAKDLQDYFKQKKLDEADQGPFFGFLGKNEISNGR 502



>pir|F90096|F90096 high light inducible protein [imported] -
           Guillardia theta nucleomorph>gb:AF165818_1773855
           Guillardia theta nucleomorph chromosome 1, complete
           sequence.
          Length = 127

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +3

Query: 444 QRQKAKELQEYFKQKKLD-DANQGPFFGFIGKNEIANGRWAMFGFAVGMLTEYATGSDFV 620
           + +K K L E +K ++L+ +  +   FGF   +EI NGR AMF    G+LTE  T    +
Sbjct: 54  REKKLKILAEKWKNERLEKEILENKIFGFSKYSEIINGRIAMFFITTGLLTELWTKQSLI 113

Query: 621 DQVKILLSNFGILD 662
            Q++I+L   GI++
Sbjct: 114 SQIEIMLRVLGIIN 127



>gb:AP008231_580965 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 47

 Score = 40.4 bits (93), Expect = 0.046
 Identities = 20/46 (43%), Positives = 25/46 (54%)
 Frame = +3

Query: 501 ANQGPFFGFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQVKIL 638
           + Q   FGF    E  NGR AM GF VG+ TE  TG   + Q+ +L
Sbjct: 2   SEQNTKFGFTAFAETWNGRLAMIGFVVGLATELLTGQGILSQIGLL 47



>gb:AE017161_394568 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 1 of 6 of the complete
           genome.>gb:AE017126_1030237 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 49

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 17/39 (43%), Positives = 23/39 (58%)
 Frame = +3

Query: 513 PFFGFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQV 629
           P +GF+   EI NGR AM G  +G+ TE  TG   + Q+
Sbjct: 8   PRYGFVNYAEIWNGRLAMLGIVIGLSTELLTGQGILGQI 46



>gb:BX572090_795719 Prochlorococcus marinus MED4 complete genome;
           segment 1/5.
          Length = 48

 Score = 38.5 bits (88), Expect = 0.17
 Identities = 20/48 (41%), Positives = 28/48 (58%)
 Frame = +3

Query: 492 LDDANQGPFFGFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQVKI 635
           +++ NQ P FGF+   E  NGR AM G  +G+ TE  TG   + Q+ I
Sbjct: 1   MNEDNQ-PRFGFVNFAETWNGRMAMMGILIGLGTELITGQSILRQIGI 47



>gb:BX569694_777082 Synechococcus sp. WH8102 complete genome;
           segment 6/7.
          Length = 46

 Score = 38.1 bits (87), Expect = 0.23
 Identities = 17/37 (45%), Positives = 22/37 (59%)
 Frame = +3

Query: 519 FGFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQV 629
           FGF+   E  NGR AM GF +G+ TE  TG   + Q+
Sbjct: 7   FGFVNFAETWNGRLAMMGFVIGLGTELLTGQGILSQI 43



>sp|Q02060|PSBS_SPIOL Photosystem II 22 kDa protein, chloroplast
           precursor (CP22).>pir|S26953|S26953 photosystem II 22K
           protein precursor - spinach>gb:S49864_1704239
           psbS=photosystem II 22 kda polypeptide [spinach, mRNA,
           1012 nt].>gb:SOPSII_1715862 S.oleracea mRNA for
           photosystem II 22kDa protein.
          Length = 274

 Score = 38.1 bits (87), Expect = 0.23
 Identities = 18/43 (41%), Positives = 24/43 (55%)
 Frame = +3

Query: 507 QGPFFGFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQVKI 635
           +GP FGF   NE+  GR A  GFA  ++ E  TG   + Q+ I
Sbjct: 192 KGPLFGFTKSNELFVGRLAQLGFAFSLIGEIITGKGALAQLNI 234



 Score = 37.4 bits (85), Expect = 0.39
 Identities = 26/71 (36%), Positives = 37/71 (52%), Gaps = 3/71 (4%)
 Frame = +3

Query: 432 TLEFQRQKAKELQEYFKQK-KLDDANQGPF--FGFIGKNEIANGRWAMFGFAVGMLTEYA 602
           TL   + KAK  ++  K K K++D   G     GF  +NE+  GR AM GFA  +L E  
Sbjct: 60  TLALFKSKAKAPKKVEKPKLKVEDGLFGTSGGIGFTKENELFVGRVAMIGFAASLLGEGI 119

Query: 603 TGSDFVDQVKI 635
           TG   + Q+ +
Sbjct: 120 TGKGILSQLNL 130



>gb:BT002251_1635854 Arabidopsis thaliana At1g44575/T18F15 mRNA,
           complete cds.>gb:AF410304_1797118 Arabidopsis thaliana
           unknown protein mRNA, complete cds.
          Length = 265

 Score = 37.0 bits (84), Expect = 0.51
 Identities = 18/43 (41%), Positives = 23/43 (53%)
 Frame = +3

Query: 507 QGPFFGFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQVKI 635
           QGP FGF   NE+  GR A  G A  ++ E  TG   + Q+ I
Sbjct: 183 QGPLFGFTKANELFVGRLAQLGIAFSLIGEIITGKGALAQLNI 225



>gb:AB015859_1512731 Arabidopsis thaliana psbS mRNA for photosystem
           II 22 kDa protein, partial cds.
          Length = 155

 Score = 37.0 bits (84), Expect = 0.51
 Identities = 18/43 (41%), Positives = 23/43 (53%)
 Frame = +3

Query: 507 QGPFFGFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQVKI 635
           QGP FGF   NE+  GR A  G A  ++ E  TG   + Q+ I
Sbjct: 73  QGPLFGFTKANELFVGRLAQLGIAFSLIGEIITGKGALAQLNI 115



>gb:BX572099_798982 Prochlorococcus marinus MIT9313 complete genome;
           segment 5/7.
          Length = 73

 Score = 37.0 bits (84), Expect = 0.51
 Identities = 17/39 (43%), Positives = 22/39 (56%)
 Frame = +3

Query: 513 PFFGFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQV 629
           P FGF+   E  NGR AM G  +G+ TE  TG   + Q+
Sbjct: 32  PRFGFVNFAETWNGRLAMMGVIIGLSTELLTGQSILSQM 70



>gb:BX569693_776351 Synechococcus sp. WH8102 complete genome;
           segment 5/7.
          Length = 67

 Score = 37.0 bits (84), Expect = 0.51
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +3

Query: 540 EIANGRWAMFGFAVGMLTEYATGSDFVDQVKILLSNFGILDL 665
           E+ NGR AM GF +G+LTE  TG     Q+      FG+L +
Sbjct: 30  ELLNGRIAMLGFLIGLLTELITGQGIASQI-----GFGLLGI 66



>sp|Q9XF91|PSBS_ARATH Photosystem II 22 kDa protein, chloroplast
           precursor (CP22).>pir|T52313|T52313 photosystem II
           protein [imported] - Arabidopsis
           thaliana>gb:AC084807_1733815 Arabidopsis thaliana
           chromosome 1 BAC T18F15 genomic sequence, complete
           sequence.>gb:AF134131_1770999 Arabidopsis thaliana PsbS
           protein (PsbS) mRNA, complete cds.
          Length = 265

 Score = 37.0 bits (84), Expect = 0.51
 Identities = 18/43 (41%), Positives = 23/43 (53%)
 Frame = +3

Query: 507 QGPFFGFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQVKI 635
           QGP FGF   NE+  GR A  G A  ++ E  TG   + Q+ I
Sbjct: 183 QGPLFGFTKANELFVGRLAQLGIAFSLIGEIITGKGALAQLNI 225



>gb:AP008231_580124 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 119

 Score = 36.6 bits (83), Expect = 0.66
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 3/50 (6%)
 Frame = +3

Query: 498 DANQG--PFFGFIG-KNEIANGRWAMFGFAVGMLTEYATGSDFVDQVKIL 638
           D  QG  P +GF   + E  NGR+AM G  +G+LTE  TG   + Q+ +L
Sbjct: 70  DEQQGLDPNYGFTSVRAERWNGRFAMMGLLIGLLTEVLTGQGILHQLGLL 119



>gb:BA000045_741518 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 52

 Score = 35.8 bits (81), Expect = 1.1
 Identities = 17/32 (53%), Positives = 20/32 (62%)
 Frame = +3

Query: 513 PFFGFIGKNEIANGRWAMFGFAVGMLTEYATG 608
           P FGF    E+ NGR AM GFA  ++ E ATG
Sbjct: 11  PKFGFNPYAELLNGRLAMIGFAAALVVELATG 42



>gb:OSJN00076_1694426 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0039K24, complete sequence.
          Length = 248

 Score = 35.0 bits (79), Expect = 1.9
 Identities = 17/42 (40%), Positives = 22/42 (52%)
 Frame = +3

Query: 510 GPFFGFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQVKI 635
           GP FGF   NE+  GR A  G A  ++ E  TG   + Q+ I
Sbjct: 167 GPLFGFTKANELFVGRLAQLGIAFSLIGEIITGKGALAQLNI 208



 Score = 33.5 bits (75), Expect = 5.6
 Identities = 16/38 (42%), Positives = 22/38 (57%)
 Frame = +3

Query: 522 GFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQVKI 635
           GF  +NE+  GR AM GFA  +L E  TG   + Q+ +
Sbjct: 68  GFTKENELFVGRVAMLGFAASLLGEAVTGKGILAQLNL 105



>gb:AY291061_1595613 Zea mays photosystem II subunit PsbS precursor,
           mRNA, complete cds; nuclear gene for chloroplast
           product.
          Length = 265

 Score = 35.0 bits (79), Expect = 1.9
 Identities = 17/42 (40%), Positives = 22/42 (52%)
 Frame = +3

Query: 510 GPFFGFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQVKI 635
           GP FGF   NE+  GR A  G A  ++ E  TG   + Q+ I
Sbjct: 185 GPLFGFTKSNELFVGRMAQLGVAFSIIGEIITGKGALAQLNI 226



 Score = 33.1 bits (74), Expect = 7.3
 Identities = 16/38 (42%), Positives = 22/38 (57%)
 Frame = +3

Query: 522 GFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQVKI 635
           GF  +NE+  GR AM GFA  +L E  TG   + Q+ +
Sbjct: 85  GFTKENELFVGRVAMLGFAASLLGEAITGKGILAQLNL 122



>gb:AP003235_1825894 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0039A07.>gb:AP003286_1827296 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0677H08.
          Length = 268

 Score = 34.7 bits (78), Expect = 2.5
 Identities = 17/42 (40%), Positives = 22/42 (52%)
 Frame = +3

Query: 510 GPFFGFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQVKI 635
           GP FGF   NE+  GR A  G A  ++ E  TG   + Q+ I
Sbjct: 188 GPLFGFTKANELFVGRLAQLGIAFSIIGEIITGKGALAQLNI 229



 Score = 32.7 bits (73), Expect = 9.6
 Identities = 16/38 (42%), Positives = 22/38 (57%)
 Frame = +3

Query: 522 GFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQVKI 635
           GF  +NE+  GR AM GFA  +L E  TG   + Q+ +
Sbjct: 87  GFTKENELFVGRVAMLGFAASILGEAITGKGILAQLNL 124



>sp|Q9SMB4|PSBS_TOBAC Photosystem II 22 kDa protein, chloroplast
           precursor (CP22).>gb:NTPHIIPRC_1691683 N.tabacum mRNA
           for precursor of photosysten II 22 kDa protein.
          Length = 274

 Score = 34.7 bits (78), Expect = 2.5
 Identities = 23/73 (31%), Positives = 33/73 (45%), Gaps = 5/73 (6%)
 Frame = +3

Query: 432 TLEFQRQKAKELQEYFKQKKLDDANQGPF-----FGFIGKNEIANGRWAMFGFAVGMLTE 596
           T+   + KAK   +    K  +    G F      GF  +NE+  GR AM GFA  +L E
Sbjct: 57  TVALFKSKAKAPAKKVVPKPKEKVEDGIFGTSGGIGFTKQNELFVGRVAMIGFAASLLGE 116

Query: 597 YATGSDFVDQVKI 635
             TG   + Q+ +
Sbjct: 117 AITGKGILAQLNL 129



>gb:AC016163_1538116 Arabidopsis thaliana chromosome 1 BAC F26A9
           genomic sequence, complete sequence.>gb:AY087227_1572261
           Arabidopsis thaliana clone 33022 mRNA, complete
           sequence.>gb:AY093031_1574985 Arabidopsis thaliana
           unknown protein (At1g71500) mRNA, complete
           cds.>gb:AY128934_1581014 Arabidopsis thaliana unknown
           protein (At1g71500) mRNA, complete
           cds.>gb:AK119109_1817050 Arabidopsis thaliana At1g71500
           mRNA for unknown protein, complete cds, clone:
           RAFL21-46-D09.
          Length = 287

 Score = 34.3 bits (77), Expect = 3.3
 Identities = 22/57 (38%), Positives = 31/57 (54%)
 Frame = +3

Query: 492 LDDANQGPFFGFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQVKILLSNFGILD 662
           +D+ ++G  FGF  KNE+ NG+ A+ GF + +  E  TG       K LL   G LD
Sbjct: 230 VDEGSEG--FGFTKKNEVINGKAAVIGFLLLLDFELLTG-------KGLLKGTGFLD 277



>gb:AB159049_1528427 Chlamydomonas reinhardtii mRNA for Lhc-like
           protein Lhl4, complete cds.>gb:AB159050_1528428
           Chlamydomonas reinhardtii gene for Lhc-like protein
           Lhl4, complete cds.
          Length = 285

 Score = 34.3 bits (77), Expect = 3.3
 Identities = 18/44 (40%), Positives = 25/44 (56%)
 Frame = +3

Query: 498 DANQGPFFGFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQV 629
           D++ G  FGF    E   GRW+M GF   ++ E+ATG   + QV
Sbjct: 47  DSSDG-VFGFTPFAETWVGRWSMMGFVSSIVVEFATGKGTLAQV 89



 Score = 33.1 bits (74), Expect = 7.3
 Identities = 17/40 (42%), Positives = 21/40 (52%)
 Frame = +3

Query: 540 EIANGRWAMFGFAVGMLTEYATGSDFVDQVKILLSNFGIL 659
           E+ NGR AM GF   +L E  TG   + Q+   L   GIL
Sbjct: 240 EMTNGRAAMLGFLAAILVEAGTGEGIIRQIITYLKWSGIL 279



>gb:BA000045_742789 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 53

 Score = 34.3 bits (77), Expect = 3.3
 Identities = 16/42 (38%), Positives = 23/42 (54%)
 Frame = +3

Query: 495 DDANQGPFFGFIGKNEIANGRWAMFGFAVGMLTEYATGSDFV 620
           D+ ++ P FGF    E  NGR AM GF + ++ E  TG   +
Sbjct: 6   DEPSKEPMFGFTPFAEQLNGRLAMIGFVLTLIIEAQTGQSLL 47



>gb:BA000039_726230 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 56

 Score = 34.3 bits (77), Expect = 3.3
 Identities = 20/42 (47%), Positives = 23/42 (54%)
 Frame = +3

Query: 480 KQKKLDDANQGPFFGFIGKNEIANGRWAMFGFAVGMLTEYAT 605
           K  K +D N    FGF  + EI NGR AM GF   +LTE  T
Sbjct: 5   KTIKAEDRNAW-VFGFTPQAEIWNGRLAMIGFVAALLTELIT 45



>gb:AJ628858_1494510 Cyanophage S-BM4 partial psbD gene, psbA gene
           and hli gene.
          Length = 48

 Score = 33.9 bits (76), Expect = 4.3
 Identities = 16/42 (38%), Positives = 24/42 (57%)
 Frame = +3

Query: 492 LDDANQGPFFGFIGKNEIANGRWAMFGFAVGMLTEYATGSDF 617
           ++D N+   F  + + E+ NGRWAM G   G+L+   TG  F
Sbjct: 3   VEDYNRKGLFSPMQQREMYNGRWAMMGIISGVLSYAITGKLF 44



>gb:AE017165_396092 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 5 of 6 of the complete
           genome.>gb:AE017126_1031761 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 50

 Score = 33.9 bits (76), Expect = 4.3
 Identities = 14/32 (43%), Positives = 18/32 (56%)
 Frame = +3

Query: 513 PFFGFIGKNEIANGRWAMFGFAVGMLTEYATG 608
           P +GF    E  NGRWAM GF   ++ E+  G
Sbjct: 13  PSYGFHNHTENLNGRWAMIGFIALVIVEFKLG 44



>pir|JC6204|JC6204 photosystem II 22-K chlorophyll-binding protein -
           rice>gb:D84392_1674857 Oryza sativa (japonica
           cultivar-group) PSII-S mRNA for 22 kDa protein of
           photosystem II precursor, complete cds.
          Length = 254

 Score = 33.9 bits (76), Expect = 4.3
 Identities = 17/42 (40%), Positives = 22/42 (52%)
 Frame = +3

Query: 510 GPFFGFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQVKI 635
           GP FGF   NE+  GR A  G A  ++ E  TG   + Q+ I
Sbjct: 173 GPLFGFTKANELFVGRLAHVGIAFSLIGEIITGKGALAQLNI 214



 Score = 33.5 bits (75), Expect = 5.6
 Identities = 16/38 (42%), Positives = 22/38 (57%)
 Frame = +3

Query: 522 GFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQVKI 635
           GF  +NE+  GR AM GFA  +L E  TG   + Q+ +
Sbjct: 74  GFTKENELFVGRVAMLGFAASLLGEAVTGKGILAQLNL 111



>sp|P27516|CBR_DUNBA Carotene biosynthesis-related protein CBR,
           chloroplast precursor.>pir|A39458|A39458 carotene
           biosynthesis-related protein cbr - green alga
           (Dunaliella bardawil)>gb:DUNCBR02_1676199 Dunaliella
           bardawil novel carotenoid-binding protein (cbr) gene,
           complete cds.
          Length = 172

 Score = 33.9 bits (76), Expect = 4.3
 Identities = 16/36 (44%), Positives = 20/36 (55%)
 Frame = +3

Query: 522 GFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQV 629
           GF G  EI NGR AM GF   +  E +TG   + Q+
Sbjct: 72  GFSGAPEIINGRLAMLGFVAALGAELSTGESVLTQL 107



>gb:BX572090_795690 Prochlorococcus marinus MED4 complete genome;
           segment 1/5.
          Length = 77

 Score = 33.5 bits (75), Expect = 5.6
 Identities = 18/70 (25%), Positives = 38/70 (54%)
 Frame = +3

Query: 414 EDKSVVTLEFQRQKAKELQEYFKQKKLDDANQGPFFGFIGKNEIANGRWAMFGFAVGMLT 593
           E  +   +E ++  ++E++   +  +++D  +   FG+   +EI NGR+AM GF   +L 
Sbjct: 6   EQNNQEAMELEKTNSEEIKIEEQSIEIEDRYE---FGWSNYSEITNGRFAMLGFLAIILI 62

Query: 594 EYATGSDFVD 623
           E  +   F++
Sbjct: 63  ELISQKSFLN 72



>gb:BA000039_727539 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 52

 Score = 33.5 bits (75), Expect = 5.6
 Identities = 16/35 (45%), Positives = 21/35 (60%)
 Frame = +3

Query: 513 PFFGFIGKNEIANGRWAMFGFAVGMLTEYATGSDF 617
           P FG+    E  NGR+AM GF   +L E+ +G DF
Sbjct: 11  PQFGWSRYAERMNGRFAMIGFIALLLLEWVSGEDF 45



>gb:AE017263_420948 Mesoplasma florum L1 complete genome.
          Length = 435

 Score = 33.5 bits (75), Expect = 5.6
 Identities = 21/60 (35%), Positives = 31/60 (51%)
 Frame = +3

Query: 459 KELQEYFKQKKLDDANQGPFFGFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQVKIL 638
           KE++E F  K+  D    P F F    EI NG        V +++E    SD+V+QVK++
Sbjct: 311 KEIKESFVAKEKIDFYVTPIFNFGLIQEIPNG--------VSLISEAKVSSDYVNQVKVI 362



>sp|Q9FPP4|PSBS_SOLSG Photosystem II 22 kDa protein, chloroplast
           precursor (CP22).>gb:AF311720_1785071 Solanum
           sogarandinum line 1 photosystem II 22 kDa protein
           precursor (psbS) mRNA, complete cds; nuclear gene for
           chloroplast product.
          Length = 276

 Score = 33.5 bits (75), Expect = 5.6
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +3

Query: 480 KQKKLDDANQGPF--FGFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQVKI 635
           +++K++D   G     GF  +NE+  GR AM GFA  +L E  TG   + Q+ +
Sbjct: 78  EKQKVEDGIFGTSGGIGFTKQNELFVGRVAMIGFAASLLGEAITGKGILAQLNL 131



 Score = 33.1 bits (74), Expect = 7.3
 Identities = 16/40 (40%), Positives = 21/40 (52%)
 Frame = +3

Query: 510 GPFFGFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQV 629
           GP FGF   NE+  GR A  G A  ++ E  TG   + Q+
Sbjct: 196 GPLFGFTKANELFVGRLAQLGIAFSIIGEIITGKGALAQL 235



>sp|P54773|PSBS_LYCES Photosystem II 22 kDa protein, chloroplast
           precursor (CP22).>pir|T06331|T06331 photosystem II 22K
           protein - tomato>gb:LEU04336_1684690 Lycopersicon
           esculentum photosystem II 22 kDa component (psbS) gene,
           complete cds.
          Length = 276

 Score = 33.5 bits (75), Expect = 5.6
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 2/54 (3%)
 Frame = +3

Query: 480 KQKKLDDANQGPF--FGFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQVKI 635
           +++K++D   G     GF  +NE+  GR AM GFA  +L E  TG   + Q+ +
Sbjct: 78  EKQKVEDGIFGTSGGIGFTKQNELFVGRVAMIGFAASLLGEAITGKGILAQLNL 131



 Score = 33.1 bits (74), Expect = 7.3
 Identities = 16/40 (40%), Positives = 21/40 (52%)
 Frame = +3

Query: 510 GPFFGFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQV 629
           GP FGF   NE+  GR A  G A  ++ E  TG   + Q+
Sbjct: 196 GPLFGFTKANELFVGRLAQLGIAFSIIGEIITGKGALAQL 235



>gb:AB002583_1508809 Cyanidioschyzon merolae chloroplast DNA,
           complete genome, strain:10D.
          Length = 43

 Score = 32.7 bits (73), Expect = 9.6
 Identities = 16/39 (41%), Positives = 21/39 (53%)
 Frame = +3

Query: 522 GFIGKNEIANGRWAMFGFAVGMLTEYATGSDFVDQVKIL 638
           GF    E+ NGR AM GF   +LTE  TG   +  + +L
Sbjct: 5   GFNNNAEMLNGRLAMLGFVAALLTEALTGKGVLHFLGVL 43


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 775,973,867
Number of Sequences: 1806583
Number of extensions: 14166883
Number of successful extensions: 35551
Number of sequences better than 10.0: 34
Number of HSP's better than 10.0 without gapping: 34222
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 35519
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 61201187793
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)