BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig6263
         (1000 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP005681_1855913 Oryza sativa (japonica cultivar-group) genom...   225   9e-58   
gb:AC006841_1534638 Arabidopsis thaliana chromosome 2 clone F3K2...   206   6e-52   
pir|H84599|H84599 hypothetical protein At2g21320 [imported] - Ar...   182   9e-45   Arabidopsis thaliana [mouse-ear cress]
pir|T06056|T06056 hypothetical protein F19H22.60 - Arabidopsis t...   180   3e-44   Arabidopsis thaliana [mouse-ear cress]
gb:BT010927_1640873 Arabidopsis thaliana At4g38960 gene, complet...   151   2e-35   
gb:AB001883_1508676 Oryza sativa (japonica cultivar-group) mRNA ...   107   4e-22   
gb:AY087387_1572419 Arabidopsis thaliana clone 34830 mRNA, compl...   107   5e-22   
sp|Q9SYM2|COL7_ARATH|COL7_ARATH Zinc finger protein constans-like 7.>pir|F9...   107   5e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AP004839_1845779 Oryza sativa (japonica cultivar-group) genom...   105   1e-21   
gb:AB001885_1508678 Oryza sativa (japonica cultivar-group) mRNA ...   103   7e-21   
sp|Q96288|STO_ARATH|STO_ARATH Salt-tolerance protein.>pir|E86195|E86195 hy...   101   3e-20   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00022_1693444 Oryza sativa genomic DNA, chromosome 4, BAC...    99   1e-19   
pir|A84720|A84720 hypothetical protein At2g31380 [imported] - Ar...    97   4e-19   Arabidopsis thaliana [mouse-ear cress]
sp|Q9SID1|STH_ARATH|STH_ARATH Salt tolerance-like protein.>gb:AC007169_153...    97   4e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AC135920_1742854 Oryza sativa (japonica cultivar-group) chrom...    96   8e-19   
sp|Q9LQZ7|COL6_ARATH|COL6_ARATH Zinc finger protein constans-like 6.>pir|G9...    96   1e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AK118879_1816833 Arabidopsis thaliana At4g39070 mRNA for puta...    94   3e-18   
gb:AB001884_1508677 Oryza sativa (japonica cultivar-group) mRNA ...    94   4e-18   
pir|JE0116|JE0116 zinc-finger protein R2931 [imported] - rice>gb...    94   5e-18   Oryza sativa Japonica Group [Japonica rice]
pir|T08125|T08125 CONSTANS protein homolog COL1 - radish>gb:AF05...    92   2e-17   Raphanus sativus
gb:AF052584_1764359 Malus domestica cultivar Fuji CONSTANS-like ...    91   3e-17   
gb:AY085729_1570796 Arabidopsis thaliana clone 17434 mRNA, compl...    91   3e-17   
sp|Q9SK53|COL8_ARATH|COL8_ARATH Zinc finger protein constans-like 8.>pir|E8...    91   3e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AF510460_1807203 Brassica nigra isolate S216ET COL1 protein (...    91   4e-17   
gb:AF510489_1807232 Brassica nigra isolate 173ET COL1 protein (C...    91   5e-17   
gb:AF510487_1807230 Brassica nigra isolate 179ET COL1 protein (C...    91   5e-17   
gb:AF510482_1807225 Brassica nigra isolate 186ET COL1 protein (C...    91   5e-17   
gb:AF510463_1807206 Brassica nigra isolate S209ET COL1 protein (...    91   5e-17   
gb:AF510461_1807204 Brassica nigra isolate S215ET COL1 protein (...    91   5e-17   
gb:AF052585_1764360 Malus domestica cultivar Fuji CONSTANS-like ...    91   5e-17   
pir|T06067|T06067 hypothetical protein F19H22.170 - Arabidopsis ...    91   5e-17   Arabidopsis thaliana [mouse-ear cress]
gb:AF510454_1807197 Brassica nigra isolate S182GE COL1 protein (...    89   1e-16   
gb:AY052697_1562857 Arabidopsis thaliana AT5g24930/F6A4_140 mRNA...    89   1e-16   
gb:AF510469_1807212 Brassica nigra isolate 260SI COL1 protein (C...    89   1e-16   
gb:AF269128_1782058 Brassica nigra constans-like protein gene, c...    89   1e-16   
gb:AF510479_1807222 Brassica nigra isolate 68GE COL1 protein (CO...    89   2e-16   
gb:AF510471_1807214 Brassica nigra isolate 275SI COL1 protein (C...    89   2e-16   
gb:AF510458_1807201 Brassica nigra isolate S60SM COL1 protein (C...    89   2e-16   
gb:AF510456_1807199 Brassica nigra isolate 258SI COL1 protein (C...    89   2e-16   
gb:AF510451_1807194 Brassica nigra isolate 83GE COL1 protein (CO...    89   2e-16   
gb:AF510450_1807193 Brassica nigra isolate 38SPA COL1 protein (C...    89   2e-16   
gb:AF510449_1807192 Brassica nigra isolate S178GE COL1 protein (...    89   2e-16   
gb:AF510472_1807215 Brassica nigra isolate 274SI COL1 protein (C...    88   2e-16   
gb:AF510467_1807210 Brassica nigra isolate S110SP COL1 protein (...    88   2e-16   
pir|T01973|T01973 hypothetical protein T9A4.2 - Arabidopsis thal...    87   4e-16   Arabidopsis thaliana [mouse-ear cress]
sp|O50055|COL1_ARATH|COL1_ARATH Zinc finger protein CONSTANS-LIKE 1.>pir|T5...    87   5e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AY515151_1610736 Populus deltoides CONSTANS-like protein CO2 ...    86   9e-16   
gb:AY280868_1594659 Brassica napus putative beta-glucan elicitor...    86   1e-15   
sp|Q96502|COL2_ARATH|COL2_ARATH Zinc finger protein CONSTANS-LIKE 2.>gb:AC0...    85   3e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AF269126_1782057 Brassica nigra constans-like protein gene, c...    84   4e-15   
gb:AB185925_1529348 Physcomitrella patens mRNA for PpCOL1, compl...    84   4e-15   
sp|Q39057|CONS_ARATH|CONS_ARATH Zinc finger protein CONSTANS.>pir|A56133|A5...    84   4e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AY515150_1610735 Populus deltoides CONSTANS-like protein CO1 ...    84   6e-15   
gb:A50834_1449608 Sequence 7 from Patent WO9614414.>gb:AF016010_...    82   1e-14   
pir|T07835|T07835 CONSTANS homolog 1 - rape>gb:AY280868_1594660 ...    82   1e-14   Brassica napus [oilseed rape]
pir|T07836|T07836 CONSTANS homolog 9 - rape>gb:AF016011_1761479 ...    82   1e-14   Brassica napus [oilseed rape]
gb:A50832_1449607 Sequence 5 from Patent WO9614414.                    82   2e-14   
sp|O82256|COLA_ARATH|COLA_ARATH Zinc finger protein constans-like 10.>pir|G...    82   2e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AB041839_1519729 Oryza sativa (indica cultivar-group) Hd1 gen...    81   4e-14   
gb:AB041837_1519727 Oryza sativa (japonica cultivar-group) gene ...    80   5e-14   
gb:AB094489_1525254 Triticum aestivum TaHd1-3 gene for Hd1-like ...    79   2e-13   
gb:AB094488_1525253 Triticum aestivum TaHd1-2 gene for Hd1-like ...    79   2e-13   
gb:AB094487_1525252 Triticum aestivum TaHd1-1 gene for Hd1-like ...    79   2e-13   
gb:AB041841_1519731 Oryza sativa Hd1 gene, complete cds, strain:...    79   2e-13   
gb:AB041840_1519730 Oryza sativa Hd1 gene, complete cds, strain:...    79   2e-13   
gb:AF300700_1784219 Ipomoea nil CONSTANS-like protein mRNA, comp...    78   2e-13   
gb:AF510466_1807209 Brassica nigra isolate S13PO COL1 protein (C...    78   3e-13   
gb:AF490469_1804788 Hordeum vulgare subsp. vulgare cultivar Igri...    77   5e-13   
gb:AF001136_1760521 Pinus radiata zinc finger protein (PrCO) mRN...    75   2e-12   
gb:OSJN00052_1693947 Oryza sativa genomic DNA, chromosome 4, BAC...    73   8e-12   
gb:AY082958_1569216 Hordeum vulgare CONSTANS-like protein CO5 (C...    72   2e-11   
sp|Q9C7E8|COL3_ARATH|COL3_ARATH Zinc finger protein constans-like 3.>pir|B8...    71   3e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AF490474_1804793 Hordeum vulgare subsp. vulgare cultivar Igri...    71   4e-11   
gb:AK117800_1815814 Arabidopsis thaliana At1g68190 mRNA for puta...    70   5e-11   
sp|Q9C9F4|COL5_ARATH|COL5_ARATH Zinc finger protein constans-like 5.>pir|C9...    70   5e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AY356370_1601886 Brassica rapa cultivar Samjin Col-2-like pro...    70   7e-11   
gb:AY057632_1564045 Arabidopsis thaliana AT5g57660/MRI1_1 mRNA, ...    70   7e-11   
sp|Q9FHH8|COLF_ARATH|COLF_ARATH Zinc finger protein constans-like 15.>gb:AB...    70   7e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AY088432_1573451 Arabidopsis thaliana clone 6639 mRNA, comple...    70   8e-11   
gb:AY496442_1609101 Brassica rapa cultivar Kwonsim Col-2-like pr...    68   2e-10   
gb:AP004063_1837112 Oryza sativa (japonica cultivar-group) genom...    68   3e-10   
gb:BT002067_1635670 Arabidopsis thaliana putative CONSTANS-like ...    67   6e-10   
sp|O22800|COL9_ARATH|COL9_ARATH Zinc finger protein constans-like 9.>pir|C8...    67   6e-10   Arabidopsis thaliana [mouse-ear cress]
pir|JE0113|JE0113 zinc-finger protein S3574 [imported] - rice>gb...    65   2e-09   Oryza sativa Japonica Group [Japonica rice]
gb:AF490467_1804786 Hordeum vulgare subsp. vulgare cultivar Igri...    62   1e-08   
sp|Q9LUA9|COLE_ARATH|COLE_ARATH Zinc finger protein constans-like 14.>gb:AB...    61   4e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AY600919_1617349 Lolium perenne CONSTANS-like protein mRNA, c...    60   7e-08   
gb:AY553297_1613474 Lolium temulentum CONSTANS-like protein mRNA...    60   9e-08   
pir|JE0114|JE0114 zinc-finger protein C60910 [imported] - rice>g...    60   9e-08   Oryza sativa Japonica Group [Japonica rice]
gb:AP004274_1839603 Oryza sativa (japonica cultivar-group) genom...    59   1e-07   
sp|Q9SSE5|COLB_ARATH|COLB_ARATH Zinc finger protein constans-like 11.>gb:AT...    59   1e-07   Arabidopsis thaliana [mouse-ear cress]
gb:PFA929353_1393081 Plasmodium falciparum strain 3D7, chromosom...    57   4e-07   
pir|F71416|F71416 hypothetical protein - Arabidopsis thaliana>gb...    57   7e-07   Arabidopsis thaliana [mouse-ear cress]
sp|O23379|COLD_ARATH|COLD_ARATH Hypothetical zinc finger protein constans-l...    57   7e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AF490473_1804792 Hordeum vulgare subsp. vulgare cultivar Igri...    55   2e-06   
gb:AF490472_1804791 Hordeum vulgare subsp. vulgare cultivar More...    55   2e-06   
gb:AF490471_1804790 Hordeum vulgare subsp. vulgare cultivar CI16...    55   2e-06   
gb:AP004888_1846677 Oryza sativa (japonica cultivar-group) genom...    55   2e-06   
gb:AP004464_1841428 Oryza sativa (japonica cultivar-group) genom...    55   2e-06   
gb:AY082961_1569219 Hordeum vulgare clone HVSMEc0008O24f CONSTAN...    55   2e-06   
gb:AY082960_1569218 Hordeum vulgare CONSTANS-like protein CO6 (C...    55   2e-06   
gb:AP003579_1831219 Oryza sativa (japonica cultivar-group) genom...    54   6e-06   
gb:AP004993_1846903 Oryza sativa (japonica cultivar-group) genom...    53   8e-06   
gb:AP005495_1852858 Oryza sativa (japonica cultivar-group) genom...    53   1e-05   
gb:BT015778_1642396 Arabidopsis thaliana At1g25440 mRNA, complet...    53   1e-05   
gb:AY093174_1575128 Arabidopsis thaliana unknown protein (At1g25...    53   1e-05   
pir|E86384|E86384 probable zinc finger protein [imported] - Arab...    53   1e-05   Arabidopsis thaliana [mouse-ear cress]
sp|Q9LJ44|COLC_ARATH|COLC_ARATH Zinc finger protein constans-like 12.>gb:AP...    53   1e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AY084427_1569517 Arabidopsis thaliana clone 108109 mRNA, comp...    52   2e-05   
gb:AY054625_1563279 Arabidopsis thaliana putative B-box zinc fin...    52   2e-05   
pir|D96709|D96709 probable B-box zinc finger protein T26J14.9 [i...    52   2e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AY082964_1569222 Hordeum vulgare CONSTANS-like protein CO8 (C...    52   2e-05   
pir|JE0115|JE0115 zinc-finger protein S12569 [imported] - rice>g...    52   2e-05   Oryza sativa Japonica Group [Japonica rice]
gb:AY379532_1603828 Brassica rapa cultivar Tsoi-sim constans-lik...    51   3e-05   
gb:AY379531_1603827 Brassica rapa cultivar Pachuca constans-like...    51   3e-05   
gb:AP003992_1836053 Oryza sativa (japonica cultivar-group) genom...    50   7e-05   
gb:BT005302_1638242 Arabidopsis thaliana At1g49130 mRNA, complet...    50   7e-05   
sp|Q9M9B3|COL4_ARATH|COL4_ARATH Hypothetical zinc finger protein constans-l...    50   7e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AP005769_1857550 Oryza sativa (japonica cultivar-group) genom...    49   1e-04   
gb:PFA318337_1392297 Plasmodium falciparum krueppel1 gene for Kr...    49   2e-04   
gb:AE014187_938849 Plasmodium falciparum 3D7 chromosome 14 compl...    49   2e-04   
pir|T02277|T02277 hypothetical protein T13D8.14 - Arabidopsis th...    49   2e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AC087181_1733935 Oryza sativa chromosome 3 BAC OSJNBa0018H01 ...    48   3e-04   
gb:BT005244_1638184 Arabidopsis thaliana At3g21150 mRNA, complet...    47   5e-04   
gb:AB028622_1518072 Arabidopsis thaliana genomic DNA, chromosome...    47   5e-04   
pir|C96766|C96766 hypothetical protein F2P9.26 [imported] - Arab...    47   6e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AY740087_1626180 Ostreococcus tauri CONSTANS-like protein gen...    47   8e-04   
pir|T05755|T05755 hypothetical protein M4I22.120 - Arabidopsis t...    45   0.002   Arabidopsis thaliana [mouse-ear cress]
gb:AY070721_1566873 Arabidopsis thaliana AT4g27310/M4I22_120 mRN...    45   0.003   
gb:AP005284_1849824 Oryza sativa (japonica cultivar-group) genom...    44   0.007   
gb:CEZK1320_1371513 Caenorhabditis elegans cosmid ZK1320, comple...    43   0.011   
sp|Q09654|ARD1_CAEEL|ARD1_CAEEL Putative GTP-binding protein ARD-1 homolog.       43   0.011   Caenorhabditis elegans [roundworm]
gb:AP002842_1823072 Oryza sativa (japonica cultivar-group) genom...    42   0.015   
gb:BT012358_1641509 Arabidopsis thaliana At5g54470 mRNA, complet...    42   0.025   
gb:AB026634_1517041 Arabidopsis thaliana genomic DNA, chromosome...    42   0.025   
gb:CNS07EGF_1373787 chromosome VIII of strain GB-M1 of Encephali...    40   0.094   
gb:AB046809_1867448 Homo sapiens mRNA for KIAA1589 protein, part...    39   0.12    
gb:AX884055_1479587 Sequence 18960 from Patent EP1074617.>gb:AK0...    39   0.12    
gb:CR857141_1181391 Pongo pygmaeus mRNA; cDNA DKFZp469G0722 (fro...    39   0.12    
sp|Q9HBF4|ZEY1_HUMAN|ZEY1_HUMAN Zinc finger FYVE domain containing protein ...    39   0.12    Homo sapiens [man]
gb:AP004752_1844387 Oryza sativa (japonica cultivar-group) genom...    39   0.21    
gb:AK129400_2069631 Mus musculus mRNA for mKIAA1589 protein.           37   0.47    
sp|Q810J8|ZEY1_MOUSE|ZEY1_MOUSE Zinc finger FYVE domain containing protein ...    37   0.47    Mus musculus [mouse]
gb:BC077512_2560220 Xenopus laevis tripartite motif-containing 2...    35   2.3     
gb:BC088392_2565609 Danio rerio cDNA clone IMAGE:7048578, partia...    35   3.0     
gb:AF230399_1891679 Homo sapiens tripartite motif protein TRIM23...    35   3.0     
gb:AF230398_1891678 Homo sapiens tripartite motif protein TRIM23...    35   3.0     
pir|A46054|A46054 GTP-binding protein ARD 1 - human                    35   3.0     Homo sapiens [man]
sp|P36406|ARD1_HUMAN|ARD1_HUMAN GTP-binding protein ARD-1 (ADP-ribosylation...    35   3.0     Homo sapiens [man]
gb:A93469_1451286 Sequence 1 from Patent WO9740180.>gb:AAU46933_...    34   4.0     
gb:LMFL5213T_1388161 Leishmania major Friedlin cosmid L5213T.          34   4.0     
pir|S33494|S33494 hypothetical 14.4K protein - fowl adenovirus 1...    34   4.0     Fowl aviadenovirus 1
gb:AY118719_1300441 Drosophila melanogaster AT29177 full insert ...    34   5.2     
gb:AF050630_1236631 Drosophila melanogaster Ahr homolog spineles...    34   5.2     
gb:AE014297_1139880 Drosophila melanogaster chromosome 3R, compl...    34   5.2     
gb:AK030862_1162203 Mus musculus adult male thymus cDNA, RIKEN f...    33   6.8     
gb:AK030843_1162199 Mus musculus adult male thymus cDNA, RIKEN f...    33   6.8     
sp|Q8BGX0|ARD1_MOUSE|ARD1_MOUSE GTP-binding protein ARD-1 (ADP-ribosylation...    33   6.8     Mus musculus [mouse]
gb:AB062929_1868937 Macaca fascicularis brain cDNA clone:QccE-21...    33   8.8     
pir|T27752|T27752 hypothetical protein ZK1320.6 - Caenorhabditis...    33   8.8     Caenorhabditis elegans [roundworm]


>gb:AP005681_1855913 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OJ1439_F07.
          Length = 211

 Score =  225 bits (574), Expect = 9e-58
 Identities = 110/178 (61%), Positives = 125/178 (70%), Gaps = 16/178 (8%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDIC 315
           MRT+CDVCESA A+LFC ADEAALCR+CD+KVHMCNKLA RHVRVGLA+P   V RCDIC
Sbjct: 1   MRTICDVCESAPAVLFCVADEAALCRSCDEKVHMCNKLARRHVRVGLADPN-KVQRCDIC 59

Query: 316 ENAPAFFYCEVDGSSLCLQCDMIVHVGGKRTHSRYLLMRQRVEFPGDKAGQTEEPPRLTS 495
           ENAPAFFYCE+DG+SLCL CDM VHVGGKRTH RYLL+RQRVEFPGDK G  ++      
Sbjct: 60  ENAPAFFYCEIDGTSLCLSCDMTVHVGGKRTHGRYLLLRQRVEFPGDKPGHMDDVAMQQK 119

Query: 496 DPGQQ----------------NHAAAAAVPVSDNTKDGHAKRENKMIDLNMKPTRIHG 621
           DP  +                NH   +  P SD   D     ++KMIDLNM+P R HG
Sbjct: 120 DPENRTDQKKAPHSVTKEQMANHHNVSDDPASDGNCDDQGNIDSKMIDLNMRPVRTHG 177



>gb:AC006841_1534638 Arabidopsis thaliana chromosome 2 clone F3K23
           map mi148, complete sequence.>gb:AY060570_1564877
           Arabidopsis thaliana At2g21320/F3K23.8 mRNA, complete
           cds.>gb:AY125573_1580378 Arabidopsis thaliana
           At2g21320/F3K23.8 mRNA, complete cds.
          Length = 172

 Score =  206 bits (524), Expect = 6e-52
 Identities = 100/165 (60%), Positives = 121/165 (73%), Gaps = 4/165 (2%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDIC 315
           MR LCD CESAAAI+FCAADEAALC +CD+KVH CNKLASRH+RVGLA+P    P CDIC
Sbjct: 1   MRILCDACESAAAIVFCAADEAALCCSCDEKVHKCNKLASRHLRVGLADPSNA-PSCDIC 59

Query: 316 ENAPAFFYCEVDGSSLCLQCDMIVHVGGKRTHSRYLLMRQRVEFPGDKAGQTEE----PP 483
           ENAPAFFYCE+DGSSLCLQCDM+VHVGGKRTH R+LL+RQR+EFPGDK    ++      
Sbjct: 60  ENAPAFFYCEIDGSSLCLQCDMVVHVGGKRTHRRFLLLRQRIEFPGDKPNHADQLGLRCQ 119

Query: 484 RLTSDPGQQNHAAAAAVPVSDNTKDGHAKRENKMIDLNMKPTRIH 618
           + +S  GQ++              +G+   ++ MIDLN  P R+H
Sbjct: 120 KASSGRGQES--------------NGNGDHDHNMIDLNSNPQRVH 150



>pir|H84599|H84599 hypothetical protein At2g21320 [imported] -
           Arabidopsis thaliana
          Length = 103

 Score =  182 bits (462), Expect = 9e-45
 Identities = 83/103 (80%), Positives = 93/103 (90%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDIC 315
           MR LCD CESAAAI+FCAADEAALC +CD+KVH CNKLASRH+RVGLA+P    P CDIC
Sbjct: 1   MRILCDACESAAAIVFCAADEAALCCSCDEKVHKCNKLASRHLRVGLADPSNA-PSCDIC 59

Query: 316 ENAPAFFYCEVDGSSLCLQCDMIVHVGGKRTHSRYLLMRQRVE 444
           ENAPAFFYCE+DGSSLCLQCDM+VHVGGKRTH R+LL+RQR+E
Sbjct: 60  ENAPAFFYCEIDGSSLCLQCDMVVHVGGKRTHRRFLLLRQRIE 102



>pir|T06056|T06056 hypothetical protein F19H22.60 - Arabidopsis
           thaliana>gb:ATCHRIV90_1547880 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           90.>gb:ATF19H22_1549318 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F19H22 (ESSA project).
          Length = 170

 Score =  180 bits (457), Expect = 3e-44
 Identities = 93/161 (57%), Positives = 108/161 (67%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDIC 315
           MR LCD CE+AAAI+FCAADEAALCR CD+KVHMCNKLASRHVRVGLA P    P CDIC
Sbjct: 1   MRILCDACENAAAIIFCAADEAALCRPCDEKVHMCNKLASRHVRVGLAEPS-NAPCCDIC 59

Query: 316 ENAPAFFYCEVDGSSLCLQCDMIVHVGGKRTHSRYLLMRQRVEFPGDKAGQTEEPPRLTS 495
           ENAPAFFYCE+DGSSLCLQCDM+VHVGGKRTH             GDK      P    +
Sbjct: 60  ENAPAFFYCEIDGSSLCLQCDMVVHVGGKRTH-------------GDK------PKENNT 100

Query: 496 DPGQQNHAAAAAVPVSDNTKDGHAKRENKMIDLNMKPTRIH 618
               QN   +     ++   + + K +++MIDLN  P R+H
Sbjct: 101 RDNLQNQRVS-----TNGNGEANGKIDDEMIDLNANPQRVH 136



>gb:BT010927_1640873 Arabidopsis thaliana At4g38960 gene, complete
           cds.>gb:BT011638_1641160 Arabidopsis thaliana At4g38960
           mRNA, complete cds.
          Length = 150

 Score =  151 bits (381), Expect = 2e-35
 Identities = 75/128 (58%), Positives = 90/128 (70%)
 Frame = +1

Query: 235 MCNKLASRHVRVGLANPPIVVPRCDICENAPAFFYCEVDGSSLCLQCDMIVHVGGKRTHS 414
           MCNKLASRHVRVGLA P    P CDICENAPAFFYCE+DGSSLCLQCDM+VHVGGKRTH 
Sbjct: 1   MCNKLASRHVRVGLAEPSNA-PCCDICENAPAFFYCEIDGSSLCLQCDMVVHVGGKRTHG 59

Query: 415 RYLLMRQRVEFPGDKAGQTEEPPRLTSDPGQQNHAAAAAVPVSDNTKDGHAKRENKMIDL 594
           R+LL+RQR+EFPGDK      P    +    QN   +     ++   + + K +++MIDL
Sbjct: 60  RFLLLRQRIEFPGDK------PKENNTRDNLQNQRVS-----TNGNGEANGKIDDEMIDL 108

Query: 595 NMKPTRIH 618
           N  P R+H
Sbjct: 109 NANPQRVH 116



>gb:AB001883_1508676 Oryza sativa (japonica cultivar-group) mRNA for
           zinc finger protein, complete cds,
           clone:E10707.>gb:OSJN00061_1694130 Oryza sativa genomic
           DNA, chromosome 4, BAC clone: OSJNBb0091E11, complete
           sequence.>gb:OSJN00138_1695525 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OJ990528_30, complete sequence.
          Length = 257

 Score =  107 bits (267), Expect = 4e-22
 Identities = 60/139 (43%), Positives = 75/139 (53%), Gaps = 7/139 (5%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGL-ANPPIVVPRCDI 312
           MR  CD CE+AAA + C ADEAALC  CD ++H  NKLAS+H R+ L A  P  +PRCD+
Sbjct: 1   MRIQCDACEAAAATVVCCADEAALCARCDVEIHAANKLASKHQRLPLDAALPAALPRCDV 60

Query: 313 CENAPAFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRYLLMRQRVEFPGDKAGQTEE--- 477
           C+   AF +C  D +  C  CD  +HV G     H RYL    RV F    +   +    
Sbjct: 61  CQEKAAFIFCVEDRALFCRDCDEPIHVPGTLSGNHQRYLTTGIRVGFSSVCSANADHLPP 120

Query: 478 -PPRLTSDPGQQNHAAAAA 531
             P+  S P     AAAAA
Sbjct: 121 PAPKGNSKPPASGIAAAAA 139



>gb:AY087387_1572419 Arabidopsis thaliana clone 34830 mRNA, complete
           sequence.>gb:AY093108_1575062 Arabidopsis thaliana
           highly similar to rice zinc finger protein (At1g78600)
           mRNA, complete cds.>gb:BT006324_1639216 Arabidopsis
           thaliana At1g78600 mRNA, complete cds.
          Length = 299

 Score =  107 bits (266), Expect = 5e-22
 Identities = 53/134 (39%), Positives = 76/134 (56%), Gaps = 8/134 (5%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDIC 315
           M+  C+VCE+A A + C ADEAALC ACD+K+H  NKLA +H RV L+     +P+CDIC
Sbjct: 1   MKIQCNVCEAAEATVLCCADEAALCWACDEKIHAANKLAGKHQRVPLSASASSIPKCDIC 60

Query: 316 ENAPAFFYCEVDGSSLCLQCDMIVHVGGKR--THSRYLLMRQRVEF------PGDKAGQT 471
           + A  FF+C  D + LC +CD+ +H        H R+LL   +V        P  K+  T
Sbjct: 61  QEASGFFFCLQDRALLCRKCDVAIHTVNPHVSAHQRFLLTGIKVGLESIDTGPSTKSSPT 120

Query: 472 EEPPRLTSDPGQQN 513
            +   + + P  Q+
Sbjct: 121 NDDKTMETKPFVQS 134



>sp|Q9SYM2|COL7_ARATH Zinc finger protein constans-like
           7.>pir|F96814|F96814 hypothetical protein T30F21.7
           [imported] - Arabidopsis thaliana>gb:AE005173_895378
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC007260_1535704 Arabidopsis thaliana
           chromosome I BAC T30F21 genomic sequence, complete
           sequence.
          Length = 327

 Score =  107 bits (266), Expect = 5e-22
 Identities = 53/134 (39%), Positives = 76/134 (56%), Gaps = 8/134 (5%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDIC 315
           M+  C+VCE+A A + C ADEAALC ACD+K+H  NKLA +H RV L+     +P+CDIC
Sbjct: 1   MKIQCNVCEAAEATVLCCADEAALCWACDEKIHAANKLAGKHQRVPLSASASSIPKCDIC 60

Query: 316 ENAPAFFYCEVDGSSLCLQCDMIVHVGGKR--THSRYLLMRQRVEF------PGDKAGQT 471
           + A  FF+C  D + LC +CD+ +H        H R+LL   +V        P  K+  T
Sbjct: 61  QEASGFFFCLQDRALLCRKCDVAIHTVNPHVSAHQRFLLTGIKVGLESIDTGPSTKSSPT 120

Query: 472 EEPPRLTSDPGQQN 513
            +   + + P  Q+
Sbjct: 121 NDDKTMETKPFVQS 134



>gb:AP004839_1845779 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0519A12.>gb:AP005306_1850247 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0030D07.
          Length = 269

 Score =  105 bits (263), Expect = 1e-21
 Identities = 56/147 (38%), Positives = 77/147 (52%), Gaps = 10/147 (6%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANP--------PI 291
           M+  CDVC + AA +FC ADEAALC ACD +VH  NKLA +H R  L NP          
Sbjct: 1   MKVQCDVCAAEAASVFCCADEAALCDACDHRVHRANKLAGKHRRFSLLNPSASGRSPTST 60

Query: 292 VVPRCDICENAPAFFYCEVDGSSLCLQCDMIVHVGGKRT--HSRYLLMRQRVEFPGDKAG 465
             P CDIC+    F +C+ D + LC +CD+ VH   + T  HSRYLL   R+        
Sbjct: 61  TAPLCDICQEKRGFLFCKEDRAILCRECDVPVHTASELTMRHSRYLLTGVRL-------- 112

Query: 466 QTEEPPRLTSDPGQQNHAAAAAVPVSD 546
            + EP    + P ++ ++++      D
Sbjct: 113 -SSEPAASPAPPSEEENSSSFCCSADD 138



>gb:AB001885_1508678 Oryza sativa (japonica cultivar-group) mRNA for
           zinc finger protein, complete cds,
           clone:R1577.>gb:AP004111_1837751 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1058_F07.>gb:AP006438_1861649 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0030C08.
          Length = 271

 Score =  103 bits (256), Expect = 7e-21
 Identities = 51/106 (48%), Positives = 62/106 (58%), Gaps = 2/106 (1%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDIC 315
           M+  CD CESAAA + C ADEAALC ACD +VH  NKLA +H R+ L      +PRCD+C
Sbjct: 1   MKIQCDACESAAAAVVCCADEAALCAACDVEVHAANKLAGKHQRLPLEALSARLPRCDVC 60

Query: 316 ENAPAFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRYLLMRQRVEF 447
           +   AF +C  D +  C  CD  +HV G     H RYL    RV F
Sbjct: 61  QEKAAFIFCVEDRALFCRDCDEPIHVPGTLSGNHQRYLATGIRVGF 106



>sp|Q96288|STO_ARATH Salt-tolerance protein.>pir|E86195|E86195
           hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_889621 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:ATSTO_1554178 A.thaliana mRNA for
           salt-tolerance protein.>gb:AY045794_1561310 Arabidopsis
           thaliana putative salt-tolerance protein (At1g06040)
           mRNA, complete cds.>gb:AY079377_1568267 Arabidopsis
           thaliana putative salt-tolerance protein (At1g06040)
           mRNA, complete cds.>gb:T21E18_1723754 Sequence of BAC
           T21E18 from Arabidopsis thaliana chromosome 1, complete
           sequence.
          Length = 248

 Score =  101 bits (251), Expect = 3e-20
 Identities = 54/151 (35%), Positives = 76/151 (50%), Gaps = 17/151 (11%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDIC 315
           M+  CDVCE A A + C ADEAALC  CD ++H  NKLAS+H R+ L +     PRCDIC
Sbjct: 1   MKIQCDVCEKAPATVICCADEAALCPQCDIEIHAANKLASKHQRLHLNSLSTKFPRCDIC 60

Query: 316 ENAPAFFYCEVDGSSLCLQCDMIVHVGGKRT--HSRYLLMRQRVEF-------------- 447
           +   AF +C  D + LC  CD  +HV   R+  H R+L    +V                
Sbjct: 61  QEKAAFIFCVEDRALLCRDCDESIHVANSRSANHQRFLATGIKVALTSTICSKEIEKNQP 120

Query: 448 -PGDKAGQTEEPPRLTSDPGQQNHAAAAAVP 537
            P +   +  + P  ++   QQ  ++A  +P
Sbjct: 121 EPSNNQQKANQIPAKSTSQQQQQPSSATPLP 151



>gb:OSJN00022_1693444 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0011L07, complete sequence.
          Length = 250

 Score = 99.0 bits (245), Expect = 1e-19
 Identities = 53/123 (43%), Positives = 68/123 (55%), Gaps = 9/123 (7%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANP------PIVV 297
           M+  CDVC + AA +FC ADEAALC ACD +VH  NKLA +H R  L  P          
Sbjct: 1   MKVQCDVCAAEAASVFCCADEAALCDACDRRVHSANKLAGKHRRFSLLQPLASSSSAQKP 60

Query: 298 PRCDICENAPAFFYCEVDGSSLCLQCDMIVHVGGK--RTHSRYLLMRQRV-EFPGDKAGQ 468
           P CDIC+    F +C+ D + LC +CD+ VH   +  R H R+LL   R+   P D    
Sbjct: 61  PLCDICQEKRGFLFCKEDRAILCRECDVTVHTTSELTRRHGRFLLTGVRLSSAPMDSPAP 120

Query: 469 TEE 477
           +EE
Sbjct: 121 SEE 123



>pir|A84720|A84720 hypothetical protein At2g31380 [imported] -
           Arabidopsis thaliana
          Length = 237

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 54/127 (42%), Positives = 63/127 (49%), Gaps = 2/127 (1%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDIC 315
           M+  CDVCE A A L C ADEAALC  CD +VH  NKLAS+H R+ L +     P CDIC
Sbjct: 1   MKIQCDVCEKAPATLICCADEAALCAKCDVEVHAANKLASKHQRLFLDSLSTKFPPCDIC 60

Query: 316 ENAPAFFYCEVDGSSLCLQCDMIVHVGGKRT--HSRYLLMRQRVEFPGDKAGQTEEPPRL 489
               AF +C  D + LC  CD   H    R+  H R+L    RV        Q  E    
Sbjct: 61  LEKAAFIFCVEDRALLCRDCDEATHAPNTRSANHQRFLATGIRVALSSTSCNQEVEKNHF 120

Query: 490 TSDPGQQ 510
             DP  Q
Sbjct: 121 --DPSNQ 125



>sp|Q9SID1|STH_ARATH Salt tolerance-like
           protein.>gb:AC007169_1535449 Arabidopsis thaliana
           chromosome 2 clone T28P16 map nga361, complete
           sequence.>gb:AY063097_1565672 Arabidopsis thaliana
           putative CONSTANS B-box zinc finger protein (At2g31380)
           mRNA, complete cds.>gb:AF323666_1786304 Arabidopsis
           thaliana B-box zinc finger protein STH mRNA, complete
           cds.>gb:AF325077_1786531 Arabidopsis thaliana putative
           CONSTANS-like B-box zinc finger protein (At2g31380)
           mRNA, complete cds.>gb:AF370311_1792195 Arabidopsis
           thaliana putative CONSTANS B-box zinc finger protein
           (At2g31380) mRNA, complete cds.
          Length = 238

 Score = 97.4 bits (241), Expect = 4e-19
 Identities = 54/127 (42%), Positives = 63/127 (49%), Gaps = 2/127 (1%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDIC 315
           M+  CDVCE A A L C ADEAALC  CD +VH  NKLAS+H R+ L +     P CDIC
Sbjct: 1   MKIQCDVCEKAPATLICCADEAALCAKCDVEVHAANKLASKHQRLFLDSLSTKFPPCDIC 60

Query: 316 ENAPAFFYCEVDGSSLCLQCDMIVHVGGKRT--HSRYLLMRQRVEFPGDKAGQTEEPPRL 489
               AF +C  D + LC  CD   H    R+  H R+L    RV        Q  E    
Sbjct: 61  LEKAAFIFCVEDRALLCRDCDEATHAPNTRSANHQRFLATGIRVALSSTSCNQEVEKNHF 120

Query: 490 TSDPGQQ 510
             DP  Q
Sbjct: 121 --DPSNQ 125



>gb:AC135920_1742854 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0015G13, complete sequence.
          Length = 378

 Score = 96.3 bits (238), Expect = 8e-19
 Identities = 51/138 (36%), Positives = 72/138 (52%), Gaps = 16/138 (11%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV--------------G 273
           M+ LC  CE+A A + C ADEAALC  CD  +H  N+LA +H+R+               
Sbjct: 37  MKLLCSACEAAEASVLCCADEAALCARCDRDIHAANRLAGKHLRLPLLSPASSSSSSAAA 96

Query: 274 LANPPIVVPRCDICENAPAFFYCEVDGSSLCLQCDMIVHVGGK--RTHSRYLLMRQRVEF 447
           LA PP   P+CDIC+ + A+F+C  D + LC  CD+ VH        H R+LL   +V  
Sbjct: 97  LAPPPPSPPKCDICQESHAYFFCLEDRALLCRSCDVAVHTANAFVSAHRRFLLTGVQVGQ 156

Query: 448 PGDKAGQTEEPPRLTSDP 501
             D+   + +PP  +  P
Sbjct: 157 EQDE--HSPDPPEPSPPP 172



>sp|Q9LQZ7|COL6_ARATH Zinc finger protein constans-like
           6.>pir|G96785|G96785 protein F10A5.24 [imported] -
           Arabidopsis thaliana>gb:AE005173_895093 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC006434_1534227 Genomic sequence for
           Arabidopsis thaliana BAC F10A5, complete sequence.
          Length = 331

 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 45/102 (44%), Positives = 60/102 (58%), Gaps = 5/102 (4%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPP---IVVPRC 306
           M+  CDVC+   A +FC ADEA+LC  CD +VH  NKLAS+H+R  L  P       P C
Sbjct: 1   MKIRCDVCDKEEASVFCTADEASLCGGCDHQVHHANKLASKHLRFSLLYPSSSNTSSPLC 60

Query: 307 DICENAPAFFYCEVDGSSLCLQCDMIVHVGGKRT--HSRYLL 426
           DIC++  A  +C+ D + LC  CD  +H   + T  H R+LL
Sbjct: 61  DICQDKKALLFCQQDRAILCKDCDSSIHAANEHTKKHDRFLL 102



>gb:AK118879_1816833 Arabidopsis thaliana At4g39070 mRNA for
           putative zinc finger protein, complete cds, clone:
           RAFL21-21-B16.
          Length = 242

 Score = 94.4 bits (233), Expect = 3e-18
 Identities = 44/100 (44%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIV-VPRCDI 312
           M+  C VC+   A +FC ADEAALC  CD  VH  NKLA +H+R  L +P     P CDI
Sbjct: 1   MKIWCAVCDKEEASVFCCADEAALCNGCDRHVHFANKLAGKHLRFSLTSPTFKDAPLCDI 60

Query: 313 CENAPAFFYCEVDGSSLCLQCDMIVHVGGKRT--HSRYLL 426
           C    A  +C+ D + LC +CD+ +H   + T  H+R+LL
Sbjct: 61  CGERRALLFCQEDRAILCRECDIPIHQANEHTKKHNRFLL 100



>gb:AB001884_1508677 Oryza sativa (japonica cultivar-group) mRNA for
           zinc finger protein, complete cds,
           clone:R1479.>gb:AP004329_1840264 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OJ1663_H12.>gb:AP005463_1852296 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0712G01.
          Length = 308

 Score = 94.0 bits (232), Expect = 4e-18
 Identities = 53/143 (37%), Positives = 71/143 (49%), Gaps = 11/143 (7%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANP---------P 288
           MR  CDVC +  A + C ADEAALC ACD +VH  N+LAS+H R+ L +P          
Sbjct: 1   MRVQCDVCAAEPAAVLCCADEAALCSACDRRVHRANRLASKHRRLPLVHPSSSSSGDGGA 60

Query: 289 IVVPRCDICENAPAFFYCEVDGSSLCLQCDMIVHVGGKRT--HSRYLLMRQRVEFPGDKA 462
              P CD+C       +C  D + LC  CD  +H     T  H+R+LL+  ++       
Sbjct: 61  AAAPLCDVCREKRGLVFCVEDRAILCADCDEPIHSANDLTAKHTRFLLVGAKL-----SP 115

Query: 463 GQTEEPPRLTSDPGQQNHAAAAA 531
               E P  +SD    + AAAAA
Sbjct: 116 AALAEQPLPSSDCSSDDDAAAAA 138



>pir|JE0116|JE0116 zinc-finger protein R2931 [imported] -
           rice>gb:AB001886_1508679 Oryza sativa (japonica
           cultivar-group) mRNA for zinc finger protein, complete
           cds, clone:R2931.>gb:AP004806_1845418 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0710H01.>gb:AP006554_1862420 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0529C07.
          Length = 360

 Score = 93.6 bits (231), Expect = 5e-18
 Identities = 54/149 (36%), Positives = 74/149 (49%), Gaps = 9/149 (6%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGL---------ANPP 288
           M+  C+ C +A A + C ADEAALC ACD++VH  NKLA +H RV L         A   
Sbjct: 1   MKIQCNACGAAEARVLCCADEAALCTACDEEVHAANKLAGKHQRVPLLSDDGGAAPAAAA 60

Query: 289 IVVPRCDICENAPAFFYCEVDGSSLCLQCDMIVHVGGKRTHSRYLLMRQRVEFPGDKAGQ 468
             VP+CDIC+ A  +F+C  D + LC  CD+ +H     T + ++ + QR    G + G 
Sbjct: 61  PAVPKCDICQEASGYFFCLEDRALLCRDCDVSIH-----TVNSFVSVHQRFLLTGVQVGL 115

Query: 469 TEEPPRLTSDPGQQNHAAAAAVPVSDNTK 555
               P     P    H  +A   V   TK
Sbjct: 116 DPADP---VPPVADKHVKSAGGSVDSATK 141



>pir|T08125|T08125 CONSTANS protein homolog COL1 -
           radish>gb:AF052690_1764389 Raphanus sativus
           CONSTANS-like 1 protein (COL1) mRNA, complete cds.
          Length = 307

 Score = 91.7 bits (226), Expect = 2e-17
 Identities = 47/93 (50%), Positives = 53/93 (56%), Gaps = 2/93 (2%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENA 324
           LCD C SAAA L+C AD A LC  CD K+H  NKLASRH RV L         C ICE A
Sbjct: 5   LCDSCRSAAATLYCRADAAFLCGECDGKIHTANKLASRHERVLL---------CQICEQA 55

Query: 325 PAFFYCEVDGSSLCLQCDMIVHVGG--KRTHSR 417
           PA   CE D ++LC+ CD  +H      R H R
Sbjct: 56  PAHVTCEADAAALCVTCDRDIHSANPLSRRHER 88



 Score = 50.8 bits (120), Expect = 4e-05
 Identities = 22/44 (50%), Positives = 27/44 (61%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGL 276
           LC +CE A A + C AD AALC  CD  +H  N L+ RH RV +
Sbjct: 48  LCQICEQAPAHVTCEADAAALCVTCDRDIHSANPLSRRHERVSV 91



>gb:AF052584_1764359 Malus domestica cultivar Fuji CONSTANS-like
           protein 1 (Col1) mRNA, complete cds.
          Length = 340

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 42/90 (46%), Positives = 53/90 (58%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENA 324
           LCD C+SA   LFC AD A LC  CD K+H  NKLASRH RV L         C++CE A
Sbjct: 5   LCDSCKSATGTLFCRADSAFLCVNCDSKIHAANKLASRHARVWL---------CEVCEQA 55

Query: 325 PAFFYCEVDGSSLCLQCDMIVHVGGKRTHS 414
           PA   C+ D ++LC+ CD  +H     +H+
Sbjct: 56  PAHVTCKADDAALCVTCDRDIHSANPLSHA 85



 Score = 47.0 bits (110), Expect = 6e-04
 Identities = 21/42 (50%), Positives = 26/42 (61%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           LC+VCE A A + C AD+AALC  CD  +H  N L+    RV
Sbjct: 48  LCEVCEQAPAHVTCKADDAALCVTCDRDIHSANPLSHADERV 89



>gb:AY085729_1570796 Arabidopsis thaliana clone 17434 mRNA, complete
           sequence.
          Length = 294

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 46/97 (47%), Positives = 55/97 (56%), Gaps = 2/97 (2%)
 Frame = +1

Query: 133 SMRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDI 312
           S   LCD C+S AA LFC AD A LC  CD K+H  NKLASRH RV L         C++
Sbjct: 3   SSSRLCDSCKSTAATLFCRADAAFLCGNCDGKIHTANKLASRHERVWL---------CEV 53

Query: 313 CENAPAFFYCEVDGSSLCLQCDMIVHVGG--KRTHSR 417
           CE APA   C+ D ++LC+ CD  +H      R H R
Sbjct: 54  CEQAPAHVTCKADAAALCVTCDRDIHSANPLSRRHER 90



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 23/42 (54%), Positives = 27/42 (64%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           LC+VCE A A + C AD AALC  CD  +H  N L+ RH RV
Sbjct: 50  LCEVCEQAPAHVTCKADAAALCVTCDRDIHSANPLSRRHERV 91



>sp|Q9SK53|COL8_ARATH Zinc finger protein constans-like
           8.>pir|E84640|E84640 CONSTANS-like B-box zinc finger
           protein [imported] - Arabidopsis
           thaliana>gb:AC006585_1534524 Arabidopsis thaliana
           chromosome 2 clone F27C12 map mi238, complete
           sequence.>gb:AC007266_1535745 Arabidopsis thaliana
           chromosome 2 clone F27A10 map mi238, complete
           sequence.>gb:AY058130_1564268 Arabidopsis thaliana
           At2g24790/F27A10.10 mRNA, complete
           cds.>gb:AY140103_1582543 Arabidopsis thaliana
           CONSTANS-like B-box zinc finger protein (At2g24790)
           mRNA, complete cds.>gb:BT002107_1635710 Arabidopsis
           thaliana CONSTANS-like B-box zinc finger protein
           (At2g24790) mRNA, complete cds.
          Length = 294

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 46/97 (47%), Positives = 55/97 (56%), Gaps = 2/97 (2%)
 Frame = +1

Query: 133 SMRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDI 312
           S   LCD C+S AA LFC AD A LC  CD K+H  NKLASRH RV L         C++
Sbjct: 3   SSSRLCDSCKSTAATLFCRADAAFLCGDCDGKIHTANKLASRHERVWL---------CEV 53

Query: 313 CENAPAFFYCEVDGSSLCLQCDMIVHVGG--KRTHSR 417
           CE APA   C+ D ++LC+ CD  +H      R H R
Sbjct: 54  CEQAPAHVTCKADAAALCVTCDRDIHSANPLSRRHER 90



 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 23/42 (54%), Positives = 27/42 (64%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           LC+VCE A A + C AD AALC  CD  +H  N L+ RH RV
Sbjct: 50  LCEVCEQAPAHVTCKADAAALCVTCDRDIHSANPLSRRHERV 91



>gb:AF510460_1807203 Brassica nigra isolate S216ET COL1 protein
           (COL1) gene, complete cds.
          Length = 345

 Score = 90.9 bits (224), Expect = 4e-17
 Identities = 52/154 (33%), Positives = 76/154 (49%), Gaps = 10/154 (6%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C SAA  ++C AD A LC +CD ++H  N+LASRH RV +         C+ CE AP
Sbjct: 12  CDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRV---------CESCERAP 62

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRYLLMRQRVEFPGDKAGQTEEPPRLT--- 492
           A F+C+ D +SLC  CD  +H      R H R  ++        + + +T EP  +    
Sbjct: 63  AAFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHSSETTEPENIVVVG 122

Query: 493 SDPGQQNHAAAAAVPVS-----DNTKDGHAKREN 579
            +   +  AA+  +P S     DN  + +   EN
Sbjct: 123 QEEEDEAEAASWLLPSSVKNCGDNNNNNNNNSEN 156



 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 23/42 (54%), Positives = 28/42 (66%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+ CE A A  FC AD A+LC ACD ++H  N LA RH RV
Sbjct: 54  VCESCERAPAAFFCKADAASLCTACDSQIHSANPLARRHQRV 95



>gb:AF510489_1807232 Brassica nigra isolate 173ET COL1 protein
           (COL1) gene, complete cds.
          Length = 345

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 52/154 (33%), Positives = 76/154 (49%), Gaps = 10/154 (6%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C SAA  ++C AD A LC +CD ++H  N+LASRH RV +         C+ CE AP
Sbjct: 12  CDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRV---------CESCERAP 62

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRYLLMRQRVEFPGDKAGQTEEPPRLT--- 492
           A F+C+ D +SLC  CD  +H      R H R  ++        + + +T EP  +    
Sbjct: 63  AAFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHSSKTTEPENIVVVG 122

Query: 493 SDPGQQNHAAAAAVPVS-----DNTKDGHAKREN 579
            +   +  AA+  +P S     DN  + +   EN
Sbjct: 123 QEEEDEAEAASWLLPSSVKNCGDNNNNNNNNSEN 156



 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 23/42 (54%), Positives = 28/42 (66%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+ CE A A  FC AD A+LC ACD ++H  N LA RH RV
Sbjct: 54  VCESCERAPAAFFCKADAASLCTACDSQIHSANPLARRHQRV 95



>gb:AF510487_1807230 Brassica nigra isolate 179ET COL1 protein
           (COL1) gene, complete cds.
          Length = 345

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 52/154 (33%), Positives = 76/154 (49%), Gaps = 10/154 (6%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C SAA  ++C AD A LC +CD ++H  N+LASRH RV +         C+ CE AP
Sbjct: 12  CDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRV---------CESCERAP 62

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRYLLMRQRVEFPGDKAGQTEEPPRLT--- 492
           A F+C+ D +SLC  CD  +H      R H R  ++        + + +T EP  +    
Sbjct: 63  AAFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHSSKTTEPENIVVVG 122

Query: 493 SDPGQQNHAAAAAVPVS-----DNTKDGHAKREN 579
            +   +  AA+  +P S     DN  + +   EN
Sbjct: 123 QEEEDEAEAASWLLPSSVKNCGDNNNNNNNNSEN 156



 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 23/42 (54%), Positives = 28/42 (66%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+ CE A A  FC AD A+LC ACD ++H  N LA RH RV
Sbjct: 54  VCESCERAPAAFFCKADAASLCTACDSQIHSANPLARRHQRV 95



>gb:AF510482_1807225 Brassica nigra isolate 186ET COL1 protein
           (COL1) gene, complete cds.
          Length = 345

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 52/154 (33%), Positives = 76/154 (49%), Gaps = 10/154 (6%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C SAA  ++C AD A LC +CD ++H  N+LASRH RV +         C+ CE AP
Sbjct: 12  CDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRV---------CESCERAP 62

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRYLLMRQRVEFPGDKAGQTEEPPRLT--- 492
           A F+C+ D +SLC  CD  +H      R H R  ++        + + +T EP  +    
Sbjct: 63  AAFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHSSKTTEPENIVVVG 122

Query: 493 SDPGQQNHAAAAAVPVS-----DNTKDGHAKREN 579
            +   +  AA+  +P S     DN  + +   EN
Sbjct: 123 QEEEDEAEAASWLLPSSVKNCGDNNNNNNNNSEN 156



 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 23/42 (54%), Positives = 28/42 (66%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+ CE A A  FC AD A+LC ACD ++H  N LA RH RV
Sbjct: 54  VCESCERAPAAFFCKADAASLCTACDSQIHSANPLARRHQRV 95



>gb:AF510463_1807206 Brassica nigra isolate S209ET COL1 protein
           (COL1) gene, complete cds.
          Length = 345

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 52/154 (33%), Positives = 76/154 (49%), Gaps = 10/154 (6%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C SAA  ++C AD A LC +CD ++H  N+LASRH RV +         C+ CE AP
Sbjct: 12  CDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRV---------CESCERAP 62

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRYLLMRQRVEFPGDKAGQTEEPPRLT--- 492
           A F+C+ D +SLC  CD  +H      R H R  ++        + + +T EP  +    
Sbjct: 63  AAFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHSSKTTEPENIVVVG 122

Query: 493 SDPGQQNHAAAAAVPVS-----DNTKDGHAKREN 579
            +   +  AA+  +P S     DN  + +   EN
Sbjct: 123 QEEEDEAEAASWLLPSSVKNCGDNNNNNNNNSEN 156



 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 23/42 (54%), Positives = 28/42 (66%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+ CE A A  FC AD A+LC ACD ++H  N LA RH RV
Sbjct: 54  VCESCERAPAAFFCKADAASLCTACDSQIHSANPLARRHQRV 95



>gb:AF510461_1807204 Brassica nigra isolate S215ET COL1 protein
           (COL1) gene, complete cds.>gb:AF510462_1807205 Brassica
           nigra isolate S210ET COL1 protein (COL1) gene, complete
           cds.>gb:AF510483_1807226 Brassica nigra isolate 185ET
           COL1 protein (COL1) gene, complete
           cds.>gb:AF510484_1807227 Brassica nigra isolate 183ET
           COL1 protein (COL1) gene, complete
           cds.>gb:AF510485_1807228 Brassica nigra isolate 182ET
           COL1 protein (COL1) gene, complete
           cds.>gb:AF510486_1807229 Brassica nigra isolate 180ET
           COL1 protein (COL1) gene, complete
           cds.>gb:AF510488_1807231 Brassica nigra isolate 176ET
           COL1 protein (COL1) gene, complete cds.
          Length = 345

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 52/154 (33%), Positives = 76/154 (49%), Gaps = 10/154 (6%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C SAA  ++C AD A LC +CD ++H  N+LASRH RV +         C+ CE AP
Sbjct: 12  CDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRV---------CESCERAP 62

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRYLLMRQRVEFPGDKAGQTEEPPRLT--- 492
           A F+C+ D +SLC  CD  +H      R H R  ++        + + +T EP  +    
Sbjct: 63  AAFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHSSKTTEPENIVVVG 122

Query: 493 SDPGQQNHAAAAAVPVS-----DNTKDGHAKREN 579
            +   +  AA+  +P S     DN  + +   EN
Sbjct: 123 QEEEDEAEAASWLLPSSVKNCGDNNNNNNNNSEN 156



 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 23/42 (54%), Positives = 28/42 (66%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+ CE A A  FC AD A+LC ACD ++H  N LA RH RV
Sbjct: 54  VCESCERAPAAFFCKADAASLCTACDSQIHSANPLARRHQRV 95



>gb:AF052585_1764360 Malus domestica cultivar Fuji CONSTANS-like
           protein 2 (Col2) mRNA, complete cds.
          Length = 329

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 42/82 (51%), Positives = 51/82 (62%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENA 324
           LCD C+SA A LFC AD A LC  CD K+H  NKLASRH RV L         C++CE A
Sbjct: 5   LCDSCQSATATLFCRADSAFLCVNCDSKIHAANKLASRHPRVWL---------CEVCEQA 55

Query: 325 PAFFYCEVDGSSLCLQCDMIVH 390
           PA   C+ D ++LC+ CD  +H
Sbjct: 56  PAHVTCKADDAALCVTCDRDIH 77



 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 24/42 (57%), Positives = 29/42 (69%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           LC+VCE A A + C AD+AALC  CD  +H  N L+SRH RV
Sbjct: 48  LCEVCEQAPAHVTCKADDAALCVTCDRDIHSANPLSSRHDRV 89



 Score = 38.5 bits (88), Expect = 0.21
 Identities = 13/33 (39%), Positives = 19/33 (57%)
 Frame = +1

Query: 304 CDICENAPAFFYCEVDGSSLCLQCDMIVHVGGK 402
           CD C++A A  +C  D + LC+ CD  +H   K
Sbjct: 6   CDSCQSATATLFCRADSAFLCVNCDSKIHAANK 38



>pir|T06067|T06067 hypothetical protein F19H22.170 - Arabidopsis
           thaliana>gb:ATCHRIV90_1547891 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           90.>gb:ATF19H22_1549329 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F19H22 (ESSA project).
          Length = 241

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 44/100 (44%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIV-VPRCDI 312
           M+  C VC+   A +FC ADEAALC  CD  VH  NKLA +H+R  L +P     P CDI
Sbjct: 1   MKIWCAVCDKEEASVFCCADEAALCNGCDRHVHFANKLAGKHLRFSLTSPTFKDAPLCDI 60

Query: 313 CENAPAFFYCEVDGSSLCLQCDMIVHVGGKRT--HSRYLL 426
           C    A  +C+ D + LC +CD+ +H   + T  H+R+LL
Sbjct: 61  C-GRRALLFCQEDRAILCRECDIPIHQANEHTKKHNRFLL 99



>gb:AF510454_1807197 Brassica nigra isolate S182GE COL1 protein
           (COL1) gene, complete cds.
          Length = 348

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 53/151 (35%), Positives = 74/151 (49%), Gaps = 7/151 (4%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C SAA  ++C AD A LC +CD ++H  N+LASRH RV +         C+ CE AP
Sbjct: 12  CDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRV---------CESCERAP 62

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRY-LLMRQRVEFPGDKAGQTEEPPRLT-- 492
           A F+C+ D +SLC  CD  +H      R H R  +L           + +T EP  +   
Sbjct: 63  AVFFCQADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHHSSETTEPENIVVV 122

Query: 493 -SDPGQQNHAAAAAVPVS-DNTKDGHAKREN 579
             +   +  AA+  +P S  N  D +   EN
Sbjct: 123 GQEEEDEAEAASWLLPSSVKNCGDNNNNTEN 153



 Score = 56.6 bits (135), Expect = 7e-07
 Identities = 23/42 (54%), Positives = 29/42 (69%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+ CE A A+ FC AD A+LC ACD ++H  N LA RH RV
Sbjct: 54  VCESCERAPAVFFCQADAASLCTACDSQIHSANPLARRHQRV 95



>gb:AY052697_1562857 Arabidopsis thaliana AT5g24930/F6A4_140 mRNA,
           complete cds.>gb:AY143826_1583283 Arabidopsis thaliana
           At5g24930/F6A4_140 mRNA, complete cds.
          Length = 232

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 43/93 (46%), Positives = 54/93 (58%), Gaps = 2/93 (2%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENA 324
           LCD C+SA A L+C  D A LC +CD KVH  NKLASRH RV +         C++CE A
Sbjct: 5   LCDSCKSATAALYCRPDAAFLCLSCDSKVHAANKLASRHARVWM---------CEVCEQA 55

Query: 325 PAFFYCEVDGSSLCLQCDMIVHVGG--KRTHSR 417
           PA   C+ D ++LC+ CD  +H      R H R
Sbjct: 56  PAHVTCKADAAALCVTCDRDIHSANPLARRHER 88



 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 23/42 (54%), Positives = 27/42 (64%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+VCE A A + C AD AALC  CD  +H  N LA RH RV
Sbjct: 48  MCEVCEQAPAHVTCKADAAALCVTCDRDIHSANPLARRHERV 89



>gb:AF510469_1807212 Brassica nigra isolate 260SI COL1 protein
           (COL1) gene, complete cds.
          Length = 348

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 54/157 (34%), Positives = 75/157 (47%), Gaps = 7/157 (4%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C SAA  ++C AD A LC +CD ++H  N+LASRH RV +         C+ CE AP
Sbjct: 12  CDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRV---------CESCERAP 62

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRY-LLMRQRVEFPGDKAGQTEEPPRLT-- 492
           A F+C+ D +SLC  CD  +H      R H R  +L           + +T EP  +   
Sbjct: 63  AAFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHHSSETTEPENIVVV 122

Query: 493 -SDPGQQNHAAAAAVPVS-DNTKDGHAKRENKMIDLN 597
             +   +  AA+  +P S  N  D +    N  I  N
Sbjct: 123 GQEEEDEAEAASWLLPSSVKNCGDNNNNNNNNNISEN 159



 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 23/42 (54%), Positives = 28/42 (66%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+ CE A A  FC AD A+LC ACD ++H  N LA RH RV
Sbjct: 54  VCESCERAPAAFFCKADAASLCTACDSQIHSANPLARRHQRV 95



>gb:AF269128_1782058 Brassica nigra constans-like protein gene,
           complete cds.>gb:AF510468_1807211 Brassica nigra isolate
           S105SP COL1 protein (COL1) gene, complete cds.
          Length = 348

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 54/157 (34%), Positives = 75/157 (47%), Gaps = 7/157 (4%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C SAA  ++C AD A LC +CD ++H  N+LASRH RV +         C+ CE AP
Sbjct: 12  CDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRV---------CESCERAP 62

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRY-LLMRQRVEFPGDKAGQTEEPPRLT-- 492
           A F+C+ D +SLC  CD  +H      R H R  +L           + +T EP  +   
Sbjct: 63  AAFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHHSSETTEPENIVVV 122

Query: 493 -SDPGQQNHAAAAAVPVS-DNTKDGHAKRENKMIDLN 597
             +   +  AA+  +P S  N  D +    N  I  N
Sbjct: 123 GQEEEDEAEAASWLLPSSVKNCGDNNNNNNNNNISEN 159



 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 23/42 (54%), Positives = 28/42 (66%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+ CE A A  FC AD A+LC ACD ++H  N LA RH RV
Sbjct: 54  VCESCERAPAAFFCKADAASLCTACDSQIHSANPLARRHQRV 95



>gb:AF510479_1807222 Brassica nigra isolate 68GE COL1 protein (COL1)
           gene, complete cds.
          Length = 342

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 53/151 (35%), Positives = 74/151 (49%), Gaps = 7/151 (4%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C SAA  ++C AD A LC +CD ++H  N+LASRH RV +         C+ CE AP
Sbjct: 12  CDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRV---------CESCERAP 62

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRY-LLMRQRVEFPGDKAGQTEEPPRLT-- 492
           A F+C+ D +SLC  CD  +H      R H R  +L           + +T EP  +   
Sbjct: 63  AAFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHHSSETTEPENIVVV 122

Query: 493 -SDPGQQNHAAAAAVPVS-DNTKDGHAKREN 579
             +   +  AA+  +P S  N  D +   EN
Sbjct: 123 GQEEEDEAEAASWLLPSSVKNCGDNNNNTEN 153



 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 23/42 (54%), Positives = 28/42 (66%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+ CE A A  FC AD A+LC ACD ++H  N LA RH RV
Sbjct: 54  VCESCERAPAAFFCKADAASLCTACDSQIHSANPLARRHQRV 95



>gb:AF510471_1807214 Brassica nigra isolate 275SI COL1 protein
           (COL1) gene, complete cds.
          Length = 342

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 53/151 (35%), Positives = 74/151 (49%), Gaps = 7/151 (4%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C SAA  ++C AD A LC +CD ++H  N+LASRH RV +         C+ CE AP
Sbjct: 12  CDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRV---------CESCERAP 62

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRY-LLMRQRVEFPGDKAGQTEEPPRLT-- 492
           A F+C+ D +SLC  CD  +H      R H R  +L           + +T EP  +   
Sbjct: 63  AAFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHHSSETTEPENIVVV 122

Query: 493 -SDPGQQNHAAAAAVPVS-DNTKDGHAKREN 579
             +   +  AA+  +P S  N  D +   EN
Sbjct: 123 GQEEEDEAEAASWLLPSSVKNCGDNNNNTEN 153



 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 23/42 (54%), Positives = 28/42 (66%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+ CE A A  FC AD A+LC ACD ++H  N LA RH RV
Sbjct: 54  VCESCERAPAAFFCKADAASLCTACDSQIHSANPLARRHQRV 95



>gb:AF510458_1807201 Brassica nigra isolate S60SM COL1 protein
           (COL1) gene, complete cds.
          Length = 342

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 53/151 (35%), Positives = 74/151 (49%), Gaps = 7/151 (4%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C SAA  ++C AD A LC +CD ++H  N+LASRH RV +         C+ CE AP
Sbjct: 12  CDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRV---------CESCERAP 62

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRY-LLMRQRVEFPGDKAGQTEEPPRLT-- 492
           A F+C+ D +SLC  CD  +H      R H R  +L           + +T EP  +   
Sbjct: 63  AAFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHHSSETTEPENIVVV 122

Query: 493 -SDPGQQNHAAAAAVPVS-DNTKDGHAKREN 579
             +   +  AA+  +P S  N  D +   EN
Sbjct: 123 GQEEEDEAEAASWLLPSSVKNCGDNNNNTEN 153



 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 23/42 (54%), Positives = 28/42 (66%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+ CE A A  FC AD A+LC ACD ++H  N LA RH RV
Sbjct: 54  VCESCERAPAAFFCKADAASLCTACDSQIHSANPLARRHQRV 95



>gb:AF510456_1807199 Brassica nigra isolate 258SI COL1 protein
           (COL1) gene, complete cds.>gb:AF510457_1807200 Brassica
           nigra isolate S67SM COL1 protein (COL1) gene, complete
           cds.>gb:AF510459_1807202 Brassica nigra isolate S6PO
           COL1 protein (COL1) gene, complete
           cds.>gb:AF510464_1807207 Brassica nigra isolate S170GE
           COL1 protein (COL1) gene, complete
           cds.>gb:AF510465_1807208 Brassica nigra isolate S158GE
           COL1 protein (COL1) gene, complete
           cds.>gb:AF510470_1807213 Brassica nigra isolate S1PO
           COL1 protein (COL1) gene, complete
           cds.>gb:AF510473_1807216 Brassica nigra isolate 273SI
           COL1 protein (COL1) gene, complete
           cds.>gb:AF510474_1807217 Brassica nigra isolate 272SI
           COL1 protein (COL1) gene, complete
           cds.>gb:AF510475_1807218 Brassica nigra isolate 72GE
           COL1 protein (COL1) gene, complete
           cds.>gb:AF510476_1807219 Brassica nigra isolate 71GE
           COL1 protein (COL1) gene, complete
           cds.>gb:AF510477_1807220 Brassica nigra isolate 70GE
           COL1 protein (COL1) gene, complete
           cds.>gb:AF510478_1807221 Brassica nigra isolate 69GE
           COL1 protein (COL1) gene, complete
           cds.>gb:AF510480_1807223 Brassica nigra isolate 64GE
           COL1 protein (COL1) gene, complete
           cds.>gb:AF510481_1807224 Brassica nigra isolate 54GE
           COL1 protein (COL1) gene, complete cds.
          Length = 342

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 53/151 (35%), Positives = 74/151 (49%), Gaps = 7/151 (4%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C SAA  ++C AD A LC +CD ++H  N+LASRH RV +         C+ CE AP
Sbjct: 12  CDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRV---------CESCERAP 62

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRY-LLMRQRVEFPGDKAGQTEEPPRLT-- 492
           A F+C+ D +SLC  CD  +H      R H R  +L           + +T EP  +   
Sbjct: 63  AAFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHHSSETTEPENIVVV 122

Query: 493 -SDPGQQNHAAAAAVPVS-DNTKDGHAKREN 579
             +   +  AA+  +P S  N  D +   EN
Sbjct: 123 GQEEEDEAEAASWLLPSSVKNCGDNNNNTEN 153



 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 23/42 (54%), Positives = 28/42 (66%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+ CE A A  FC AD A+LC ACD ++H  N LA RH RV
Sbjct: 54  VCESCERAPAAFFCKADAASLCTACDSQIHSANPLARRHQRV 95



>gb:AF510451_1807194 Brassica nigra isolate 83GE COL1 protein (COL1)
           gene, complete cds.
          Length = 348

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 53/151 (35%), Positives = 74/151 (49%), Gaps = 7/151 (4%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C SAA  ++C AD A LC +CD ++H  N+LASRH RV +         C+ CE AP
Sbjct: 12  CDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRV---------CESCERAP 62

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRY-LLMRQRVEFPGDKAGQTEEPPRLT-- 492
           A F+C+ D +SLC  CD  +H      R H R  +L           + +T EP  +   
Sbjct: 63  AAFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHHSSETTEPENIVVV 122

Query: 493 -SDPGQQNHAAAAAVPVS-DNTKDGHAKREN 579
             +   +  AA+  +P S  N  D +   EN
Sbjct: 123 GQEEEDEAEAASWLLPSSVKNCGDNNNNTEN 153



 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 23/42 (54%), Positives = 28/42 (66%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+ CE A A  FC AD A+LC ACD ++H  N LA RH RV
Sbjct: 54  VCESCERAPAAFFCKADAASLCTACDSQIHSANPLARRHQRV 95



>gb:AF510450_1807193 Brassica nigra isolate 38SPA COL1 protein
           (COL1) gene, complete cds.
          Length = 348

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 53/151 (35%), Positives = 74/151 (49%), Gaps = 7/151 (4%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C SAA  ++C AD A LC +CD ++H  N+LASRH RV +         C+ CE AP
Sbjct: 12  CDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRV---------CESCERAP 62

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRY-LLMRQRVEFPGDKAGQTEEPPRLT-- 492
           A F+C+ D +SLC  CD  +H      R H R  +L           + +T EP  +   
Sbjct: 63  AAFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHHSSETTEPENIVVV 122

Query: 493 -SDPGQQNHAAAAAVPVS-DNTKDGHAKREN 579
             +   +  AA+  +P S  N  D +   EN
Sbjct: 123 GQEEEDEAEAASWLLPSSVKNCGDNNNNTEN 153



 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 23/42 (54%), Positives = 28/42 (66%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+ CE A A  FC AD A+LC ACD ++H  N LA RH RV
Sbjct: 54  VCESCERAPAAFFCKADAASLCTACDSQIHSANPLARRHQRV 95



>gb:AF510449_1807192 Brassica nigra isolate S178GE COL1 protein
           (COL1) gene, complete cds.>gb:AF510452_1807195 Brassica
           nigra isolate S53SM COL1 protein (COL1) gene, complete
           cds.>gb:AF510453_1807196 Brassica nigra isolate 27SPA
           COL1 protein (COL1) gene, complete
           cds.>gb:AF510455_1807198 Brassica nigra isolate 24SPA
           COL1 protein (COL1) gene, complete cds.
          Length = 348

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 53/151 (35%), Positives = 74/151 (49%), Gaps = 7/151 (4%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C SAA  ++C AD A LC +CD ++H  N+LASRH RV +         C+ CE AP
Sbjct: 12  CDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRV---------CESCERAP 62

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRY-LLMRQRVEFPGDKAGQTEEPPRLT-- 492
           A F+C+ D +SLC  CD  +H      R H R  +L           + +T EP  +   
Sbjct: 63  AAFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHHSSETTEPENIVVV 122

Query: 493 -SDPGQQNHAAAAAVPVS-DNTKDGHAKREN 579
             +   +  AA+  +P S  N  D +   EN
Sbjct: 123 GQEEEDEAEAASWLLPSSVKNCGDNNNNTEN 153



 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 23/42 (54%), Positives = 28/42 (66%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+ CE A A  FC AD A+LC ACD ++H  N LA RH RV
Sbjct: 54  VCESCERAPAAFFCKADAASLCTACDSQIHSANPLARRHQRV 95



>gb:AF510472_1807215 Brassica nigra isolate 274SI COL1 protein
           (COL1) gene, complete cds.
          Length = 344

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 48/131 (36%), Positives = 66/131 (50%), Gaps = 3/131 (2%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C SAA  ++C AD A LC +CD ++H  N+LASRH RV +         C+ CE AP
Sbjct: 12  CDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRV---------CESCERAP 62

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRY-LLMRQRVEFPGDKAGQTEEPPRLTSD 498
           A F+C+ D +SLC  CD  +H      R H R  +L           + +T EP  +   
Sbjct: 63  AAFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHHSSETTEPENIVVV 122

Query: 499 PGQQNHAAAAA 531
             ++   A AA
Sbjct: 123 GQEEEDEAEAA 133



 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 23/42 (54%), Positives = 28/42 (66%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+ CE A A  FC AD A+LC ACD ++H  N LA RH RV
Sbjct: 54  VCESCERAPAAFFCKADAASLCTACDSQIHSANPLARRHQRV 95



>gb:AF510467_1807210 Brassica nigra isolate S110SP COL1 protein
           (COL1) gene, complete cds.
          Length = 345

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 48/131 (36%), Positives = 66/131 (50%), Gaps = 3/131 (2%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C SAA  ++C AD A LC +CD ++H  N+LASRH RV +         C+ CE AP
Sbjct: 12  CDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRV---------CESCERAP 62

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRY-LLMRQRVEFPGDKAGQTEEPPRLTSD 498
           A F+C+ D +SLC  CD  +H      R H R  +L           + +T EP  +   
Sbjct: 63  AAFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGCVATNHHSSETTEPENIVVV 122

Query: 499 PGQQNHAAAAA 531
             ++   A AA
Sbjct: 123 GQEEEDEAEAA 133



 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 23/42 (54%), Positives = 28/42 (66%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+ CE A A  FC AD A+LC ACD ++H  N LA RH RV
Sbjct: 54  VCESCERAPAAFFCKADAASLCTACDSQIHSANPLARRHQRV 95



>pir|T01973|T01973 hypothetical protein T9A4.2 - Arabidopsis
           thaliana>gb:ATCHRIV28_1544738 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           28.>gb:ATF24G24_1549873 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F24G24 (ESSA
           project).>gb:AY122916_1579794 Arabidopsis thaliana
           putative zinc-finger protein (At4g10240) mRNA, complete
           cds.>gb:T9A4_1724186 Arabidopsis thaliana BAC T9A4.
          Length = 162

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 44/103 (42%), Positives = 56/103 (54%), Gaps = 6/103 (5%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGL------ANPPIVV 297
           M+  C+VCE A A + C +DEA LC+ CD KVH  NKL  RH RV L      A      
Sbjct: 1   MKIQCEVCEKAEAEVLCCSDEAVLCKPCDIKVHEANKLFQRHHRVALQKDAASATTASGA 60

Query: 298 PRCDICENAPAFFYCEVDGSSLCLQCDMIVHVGGKRTHSRYLL 426
           P CDIC+    +F+C  D + LC  CD  +H     +H R+LL
Sbjct: 61  PLCDICQERKGYFFCLEDRAMLCNDCDEAIHT--CNSHQRFLL 101



>sp|O50055|COL1_ARATH Zinc finger protein CONSTANS-LIKE
           1.>pir|T51414|T51414 CONSTANS-like 1 - Arabidopsis
           thaliana>gb:ATDNACON_1548067 Arabidopsis thaliana col1
           gene for constans-like protein 1.>gb:ATF14F8_1548575
           Arabidopsis thaliana DNA chromosome 5, BAC clone F14F8
           (ESSA project).>gb:ATRNACON_1554061 A.thaliana mRNA for
           CONSTANS like 1 (COL1) protein.>gb:AY074369_1567524
           Arabidopsis thaliana putative CONSTANS 1 protein
           (At5g15850) mRNA, complete cds.>gb:BT002363_1635966
           Arabidopsis thaliana clone U10630 putative CONSTANS 1
           protein (At5g15850) mRNA, complete cds.
          Length = 355

 Score = 87.0 bits (214), Expect = 5e-16
 Identities = 42/92 (45%), Positives = 52/92 (56%), Gaps = 2/92 (2%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C SAA  ++C AD A LC +CD +VH  N+LASRH RV +         C  CE AP
Sbjct: 12  CDTCRSAACTVYCRADSAYLCSSCDAQVHAANRLASRHERVRV---------CQSCERAP 62

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSR 417
           A F+C+ D +SLC  CD  +H      R H R
Sbjct: 63  AAFFCKADAASLCTTCDSEIHSANPLARRHQR 94



 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 22/42 (52%), Positives = 26/42 (61%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C  CE A A  FC AD A+LC  CD ++H  N LA RH RV
Sbjct: 54  VCQSCERAPAAFFCKADAASLCTTCDSEIHSANPLARRHQRV 95



>gb:AY515151_1610736 Populus deltoides CONSTANS-like protein CO2
           mRNA, complete cds.
          Length = 372

 Score = 86.3 bits (212), Expect = 9e-16
 Identities = 48/128 (37%), Positives = 66/128 (51%), Gaps = 6/128 (4%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENA 324
           LCD C +AA  ++C AD A LC  CD +VH  N++ASRH RV +         C+ CE A
Sbjct: 18  LCDTCRAAACTVYCRADSAYLCAGCDARVHAANRVASRHERVWV---------CESCERA 68

Query: 325 PAFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRYLLMR----QRVEFPGDKAGQTEEPPR 486
           PA   C+ D +SLC  CD  +H      R H R  ++           G  AG+TE+  R
Sbjct: 69  PAALLCKADAASLCTACDADIHSANPLARRHQRVPILPISGCLHGSQVGPAAGETED--R 126

Query: 487 LTSDPGQQ 510
            T+  G++
Sbjct: 127 FTTQEGEE 134



>gb:AY280868_1594659 Brassica napus putative beta-glucan elicitor
           receptor (Bger1), constans-like protein (CoL), and
           constans (Coa1) genes, complete cds.
          Length = 337

 Score = 85.9 bits (211), Expect = 1e-15
 Identities = 49/155 (31%), Positives = 76/155 (49%), Gaps = 10/155 (6%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C SAA  ++C AD A LC +CD ++H  N+LASRH RV +         C  CE AP
Sbjct: 12  CDTCRSAACTVYCRADSAYLCTSCDAQIHAANRLASRHERVRV---------CQSCERAP 62

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRYLLMRQRVEFPGDKAGQTEEPPRLT--- 492
           A F+C+ D +SL   CD  +H      R H R  ++        +++ +T E   +    
Sbjct: 63  AAFFCKADAASLYTACDSQIHSANPLARRHQRVPILPISGSMVTNRSSETTEAEDIVVVG 122

Query: 493 SDPGQQNHAAAAAVPVS-----DNTKDGHAKRENK 582
            +   +  AA+  +P S     DN  + +  ++N+
Sbjct: 123 QEEEDEAEAASWLLPTSVKNCGDNNNNNNNSQDNR 157



 Score = 50.1 bits (118), Expect = 7e-05
 Identities = 22/42 (52%), Positives = 26/42 (61%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C  CE A A  FC AD A+L  ACD ++H  N LA RH RV
Sbjct: 54  VCQSCERAPAAFFCKADAASLYTACDSQIHSANPLARRHQRV 95



>sp|Q96502|COL2_ARATH Zinc finger protein CONSTANS-LIKE
           2.>gb:AC068900_1540480 Arabidopsis thaliana chromosome 3
           BAC F11A12 genomic sequence, complete
           sequence.>gb:ATAC021640_1543719 Arabidopsis thaliana
           chromosome III BAC F16B3 genomic sequence, complete
           sequence.>gb:ATHCOL2_1553114 Arabidopsis thaliana
           Landsberg erecta COL2 (CONSTANS) gene, complete
           cds.>gb:ATHCOL2A_1553115 Arabidopsis thaliana Landsberg
           erecta COL2 (CONSTANS) mRNA, complete
           cds.>gb:AY059092_1564456 Arabidopsis thaliana putative
           flowering-time gene CONSTANS protein COL2 (At3g02380)
           mRNA, complete cds.>gb:AY088779_1573791 Arabidopsis
           thaliana clone 949 mRNA, complete
           sequence.>gb:AF370149_1792037 Arabidopsis thaliana
           putative flowering-time gene CONSTANS protein COL2
           (At3g02380) mRNA, complete cds.
          Length = 347

 Score = 84.7 bits (208), Expect = 3e-15
 Identities = 41/92 (44%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C SAA  ++C AD A LC  CD +VH  N++ASRH RV +         C  CE+AP
Sbjct: 16  CDTCRSAACTVYCEADSAYLCTTCDARVHAANRVASRHERVRV---------CQSCESAP 66

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSR 417
           A F C+ D +SLC  CD  +H      R H R
Sbjct: 67  AAFLCKADAASLCTACDAEIHSANPLARRHQR 98



 Score = 53.1 bits (126), Expect = 8e-06
 Identities = 23/42 (54%), Positives = 27/42 (64%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C  CESA A   C AD A+LC ACD ++H  N LA RH RV
Sbjct: 58  VCQSCESAPAAFLCKADAASLCTACDAEIHSANPLARRHQRV 99



>gb:AF269126_1782057 Brassica nigra constans-like protein gene,
           complete cds.
          Length = 380

 Score = 84.0 bits (206), Expect = 4e-15
 Identities = 42/92 (45%), Positives = 49/92 (53%), Gaps = 2/92 (2%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C S    ++C AD A LC +CD +VH  N++ASRH R         VP C+ CE AP
Sbjct: 22  CDTCRSTICTVYCHADSAYLCNSCDAEVHSANRVASRHKR---------VPVCESCERAP 72

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSR 417
           A F CE D  SLC  CD  VH      R H R
Sbjct: 73  AAFMCEADDVSLCTACDSEVHSANPLARRHQR 104



 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 22/42 (52%), Positives = 27/42 (64%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+ CE A A   C AD+ +LC ACD +VH  N LA RH RV
Sbjct: 64  VCESCERAPAAFMCEADDVSLCTACDSEVHSANPLARRHQRV 105



>gb:AB185925_1529348 Physcomitrella patens mRNA for PpCOL1, complete
           cds.
          Length = 358

 Score = 84.0 bits (206), Expect = 4e-15
 Identities = 39/81 (48%), Positives = 49/81 (60%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C  ++A +FC AD A LC  CD KVH  NKLASRH RV +         C++CE AP
Sbjct: 5   CDACHVSSAAVFCRADAAYLCVGCDGKVHGANKLASRHERVWM---------CEVCEVAP 55

Query: 328 AFFYCEVDGSSLCLQCDMIVH 390
           A   C+ D +SLC+ CD  +H
Sbjct: 56  AVVTCKADAASLCVACDTDIH 76



 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 23/42 (54%), Positives = 29/42 (69%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+VCE A A++ C AD A+LC ACD  +H  N LA RH RV
Sbjct: 47  MCEVCEVAPAVVTCKADAASLCVACDTDIHSANPLAQRHERV 88



 Score = 33.5 bits (75), Expect = 6.8
 Identities = 15/39 (38%), Positives = 21/39 (53%)
 Frame = +1

Query: 304 CDICENAPAFFYCEVDGSSLCLQCDMIVHVGGKRTHSRY 420
           CD C  + A  +C  D + LC+ CD  VH G  +  SR+
Sbjct: 5   CDACHVSSAAVFCRADAAYLCVGCDGKVH-GANKLASRH 42



>sp|Q39057|CONS_ARATH Zinc finger protein
           CONSTANS.>pir|A56133|A56133 constans protein -
           Arabidopsis thaliana>gb:A50828_1449606 Sequence 1 from
           Patent WO9614414.>gb:ATCONSTAN_1548012 A.thaliana mRNA
           for CONSTANS protein.>gb:ATF14F8_1548574 Arabidopsis
           thaliana DNA chromosome 5, BAC clone F14F8 (ESSA
           project).>gb:AY086574_1571621 Arabidopsis thaliana clone
           2588 mRNA, complete sequence.>gb:BT001926_1635529
           Arabidopsis thaliana clone C105432 putative CONSTANS
           protein (At5g15840) mRNA, complete cds.
          Length = 373

 Score = 84.0 bits (206), Expect = 4e-15
 Identities = 42/92 (45%), Positives = 51/92 (55%), Gaps = 2/92 (2%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C S A  ++C AD A LC +CD +VH  N++ASRH RV +         C+ CE AP
Sbjct: 20  CDTCRSNACTVYCHADSAYLCMSCDAQVHSANRVASRHKRVRV---------CESCERAP 70

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSR 417
           A F CE D +SLC  CD  VH      R H R
Sbjct: 71  AAFLCEADDASLCTACDSEVHSANPLARRHQR 102



 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 23/42 (54%), Positives = 28/42 (66%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+ CE A A   C AD+A+LC ACD +VH  N LA RH RV
Sbjct: 62  VCESCERAPAAFLCEADDASLCTACDSEVHSANPLARRHQRV 103



>gb:AY515150_1610735 Populus deltoides CONSTANS-like protein CO1
           mRNA, complete cds.
          Length = 422

 Score = 83.6 bits (205), Expect = 6e-15
 Identities = 47/121 (38%), Positives = 61/121 (50%), Gaps = 10/121 (8%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENA 324
           +CD C +AA  ++C AD A LC  CD +VH  N++ASRH RV +         C+ CE A
Sbjct: 69  VCDTCRAAACTVYCRADSAYLCAGCDARVHAANRVASRHERVRV---------CEACERA 119

Query: 325 PAFFYCEVDGSSLCLQCDMIVHVGG--KRTHSR--------YLLMRQRVEFPGDKAGQTE 474
           PA   C+ D +SLC  CD  +H      R H R        YL   Q     G  AG+TE
Sbjct: 120 PAALLCKADAASLCTACDADIHSANPLARRHQRVPILPISGYLYGTQ----VGPAAGETE 175

Query: 475 E 477
           +
Sbjct: 176 D 176



>gb:A50834_1449608 Sequence 7 from Patent
           WO9614414.>gb:AF016010_1761478 Brassica napus CONSTANS
           homolog (Bn1CON19) gene, complete cds.
          Length = 366

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 41/92 (44%), Positives = 50/92 (54%), Gaps = 2/92 (2%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C S    ++C AD A LC +CD +VH  N++ASRH RV +         C+ CE AP
Sbjct: 21  CDTCGSTICTVYCHADSAYLCNSCDAQVHSANRVASRHKRVRV---------CESCERAP 71

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSR 417
           A F CE D  SLC  CD+ VH      R H R
Sbjct: 72  AAFMCEADDVSLCTACDLEVHSANPLARRHQR 103



 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 25/54 (46%), Positives = 32/54 (59%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRC 306
           +C+ CE A A   C AD+ +LC ACD +VH  N LA RH RV +   PI+   C
Sbjct: 63  VCESCERAPAAFMCEADDVSLCTACDLEVHSANPLARRHQRVPVV--PIIGNSC 114



>pir|T07835|T07835 CONSTANS homolog 1 - rape>gb:AY280868_1594660
           Brassica napus putative beta-glucan elicitor receptor
           (Bger1), constans-like protein (CoL), and constans
           (Coa1) genes, complete cds.
          Length = 366

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 41/92 (44%), Positives = 50/92 (54%), Gaps = 2/92 (2%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C S    ++C AD A LC +CD +VH  N++ASRH RV +         C+ CE AP
Sbjct: 21  CDTCGSTICTVYCHADSAYLCNSCDAQVHSANRVASRHKRVRV---------CESCERAP 71

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSR 417
           A F CE D  SLC  CD+ VH      R H R
Sbjct: 72  AAFMCEADDVSLCTACDLEVHSANPLARRHQR 103



 Score = 51.2 bits (121), Expect = 3e-05
 Identities = 22/42 (52%), Positives = 27/42 (64%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+ CE A A   C AD+ +LC ACD +VH  N LA RH RV
Sbjct: 63  VCESCERAPAAFMCEADDVSLCTACDLEVHSANPLARRHQRV 104



>pir|T07836|T07836 CONSTANS homolog 9 - rape>gb:AF016011_1761479
           Brassica napus CONSTANS homolog (Bn9CON10) gene,
           complete cds.
          Length = 368

 Score = 82.4 bits (202), Expect = 1e-14
 Identities = 41/92 (44%), Positives = 50/92 (54%), Gaps = 2/92 (2%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C S    ++C AD A LC +CD +VH  N++ASRH RV +         C+ CE AP
Sbjct: 22  CDTCGSTICTVYCHADSAYLCNSCDAQVHSANRVASRHKRVRV---------CESCERAP 72

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSR 417
           A F CE D  SLC  CD+ VH      R H R
Sbjct: 73  AAFMCEADDVSLCTACDLEVHSANPLARRHQR 104



 Score = 51.2 bits (121), Expect = 3e-05
 Identities = 22/42 (52%), Positives = 27/42 (64%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+ CE A A   C AD+ +LC ACD +VH  N LA RH RV
Sbjct: 64  VCESCERAPAAFMCEADDVSLCTACDLEVHSANPLARRHQRV 105



>gb:A50832_1449607 Sequence 5 from Patent WO9614414.
          Length = 366

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 43/104 (41%), Positives = 53/104 (50%), Gaps = 2/104 (1%)
 Frame = +1

Query: 112 VG*SER*SMRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPI 291
           +G  E  +    CD C S    ++C AD A LC +CD +VH  N++ASRH RV +     
Sbjct: 9   IGSEENNTGARACDTCGSTICTVYCHADSAYLCNSCDAQVHSANRVASRHKRVRV----- 63

Query: 292 VVPRCDICENAPAFFYCEVDGSSLCLQCDMIVHVGG--KRTHSR 417
               C+ CE APA F CE D  SLC  CD  VH      R H R
Sbjct: 64  ----CESCERAPAAFMCEADDVSLCTACDSEVHSANPLARRHQR 103



 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 22/42 (52%), Positives = 27/42 (64%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+ CE A A   C AD+ +LC ACD +VH  N LA RH RV
Sbjct: 63  VCESCERAPAAFMCEADDVSLCTACDSEVHSANPLARRHQRV 104



>sp|O82256|COLA_ARATH Zinc finger protein constans-like
           10.>pir|G84920|G84920 hypothetical protein At2g47890
           [imported] - Arabidopsis thaliana>gb:AC005309_1532465
           Arabidopsis thaliana chromosome 2 clone F17A22 map
           CIC06C03, complete sequence.>gb:AC006072_1533398
           Arabidopsis thaliana chromosome 2 clone T9J23 map
           CIC06C03, complete sequence.
          Length = 332

 Score = 81.6 bits (200), Expect = 2e-14
 Identities = 37/91 (40%), Positives = 51/91 (56%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENA 324
           LCD C+S+ A+++C AD A LC ACD +VH+ N+L ++H R  L         CD C  +
Sbjct: 12  LCDYCDSSVALVYCKADSAKLCLACDKQVHVANQLFAKHFRSLL---------CDSCNES 62

Query: 325 PAFFYCEVDGSSLCLQCDMIVHVGGKRTHSR 417
           P+  +CE + S LC  CD   H      HSR
Sbjct: 63  PSSLFCETERSVLCQNCDWQHHTASSSLHSR 93



>gb:AB041839_1519729 Oryza sativa (indica cultivar-group) Hd1 gene,
           complete cds, strain:Kasalath.
          Length = 342

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 38/92 (41%), Positives = 53/92 (57%), Gaps = 2/92 (2%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C +A ++++C AD A LC +CD +VH  N++ASRH RV +         C+ CE AP
Sbjct: 35  CDGCRAAPSVVYCRADAAYLCASCDARVHAANRVASRHERVRV---------CEACEQAP 85

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSR 417
           A   C  D ++LC+ CD+ VH      R H R
Sbjct: 86  AALACRADAAALCVACDVQVHSANPLARRHQR 117



 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 30/61 (49%), Positives = 36/61 (59%), Gaps = 1/61 (1%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLAN-PPIVVPRCDICEN 321
           +C+ CE A A L C AD AALC ACD +VH  N LA RH RV +A  P I +P   +   
Sbjct: 77  VCEACEQAPAALACRADAAALCVACDVQVHSANPLARRHQRVPVAPLPAITIPATSVLAE 136

Query: 322 A 324
           A
Sbjct: 137 A 137



>gb:AB041837_1519727 Oryza sativa (japonica cultivar-group) gene for
           Hd1, complete cds.>gb:AB041838_1519728 Oryza sativa
           (japonica cultivar-group) mRNA for Hd1, complete
           cds.>gb:AP003044_1824345 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0038C05.>gb:AP005813_1858329 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0676F10.
          Length = 395

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 35/81 (43%), Positives = 50/81 (61%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C +A ++++C AD A LC +CD +VH  N++ASRH RV +         C+ CE AP
Sbjct: 35  CDGCRAAPSVVYCRADAAYLCASCDARVHAANRVASRHERVRV---------CEACERAP 85

Query: 328 AFFYCEVDGSSLCLQCDMIVH 390
           A   C  D ++LC+ CD+ VH
Sbjct: 86  AALACRADAAALCVACDVQVH 106



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 24/60 (40%), Positives = 29/60 (48%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENA 324
           +C+ CE A A L C AD AALC ACD +VH  N L           P I +P   +   A
Sbjct: 77  VCEACERAPAALACRADAAALCVACDVQVHSANPL-----------PAITIPATSVLAEA 125



 Score = 38.1 bits (87), Expect = 0.27
 Identities = 18/43 (41%), Positives = 22/43 (51%)
 Frame = +1

Query: 304 CDICENAPAFFYCEVDGSSLCLQCDMIVHVGGKRTHSRYLLMR 432
           CD C  AP+  YC  D + LC  CD  VH    R  SR+  +R
Sbjct: 35  CDGCRAAPSVVYCRADAAYLCASCDARVH-AANRVASRHERVR 76



>gb:AB094489_1525254 Triticum aestivum TaHd1-3 gene for Hd1-like
           protein, complete cds.>gb:AB094491_1525256 Triticum
           aestivum TaHd1-3 mRNA for Hd1-like protein, complete
           cds.
          Length = 369

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 35/81 (43%), Positives = 48/81 (59%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C +A + ++C AD A LC +CD +VH  N++ASRH RV +         C+ CE+AP
Sbjct: 27  CDGCHAAPSTVYCCADAAYLCASCDTQVHSANRVASRHERVRV---------CETCESAP 77

Query: 328 AFFYCEVDGSSLCLQCDMIVH 390
           A   C  D ++LC  CD  VH
Sbjct: 78  AVLACHADAAALCTACDAQVH 98



 Score = 59.7 bits (143), Expect = 9e-08
 Identities = 28/53 (52%), Positives = 35/53 (66%), Gaps = 1/53 (1%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVG-LANPPIVVP 300
           +C+ CESA A+L C AD AALC ACD +VH  N +A RH RV  L  P + +P
Sbjct: 69  VCETCESAPAVLACHADAAALCTACDAQVHSANPIAQRHQRVPVLPLPAVAIP 121



>gb:AB094488_1525253 Triticum aestivum TaHd1-2 gene for Hd1-like
           protein, complete cds.
          Length = 370

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 35/81 (43%), Positives = 48/81 (59%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C +A + ++C AD A LC +CD +VH  N++ASRH RV +         C+ CE+AP
Sbjct: 27  CDGCHAAPSAVYCCADAAYLCASCDTQVHSANRVASRHERVRV---------CETCESAP 77

Query: 328 AFFYCEVDGSSLCLQCDMIVH 390
           A   C  D ++LC  CD  VH
Sbjct: 78  AVLACHADAAALCTACDAQVH 98



 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 27/50 (54%), Positives = 33/50 (66%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIV 294
           +C+ CESA A+L C AD AALC ACD +VH  N +A RH RV +   P V
Sbjct: 69  VCETCESAPAVLACHADAAALCTACDAQVHSANPIAQRHQRVPVLPLPAV 118



>gb:AB094487_1525252 Triticum aestivum TaHd1-1 gene for Hd1-like
           protein, complete cds.>gb:AB094490_1525255 Triticum
           aestivum TaHd1-1 mRNA for Hd1-like protein, complete
           cds.
          Length = 369

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 35/81 (43%), Positives = 48/81 (59%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C +A + ++C AD A LC +CD +VH  N++ASRH RV +         C+ CE+AP
Sbjct: 27  CDGCHAAPSAVYCCADAAYLCASCDTQVHSANRVASRHERVRV---------CETCESAP 77

Query: 328 AFFYCEVDGSSLCLQCDMIVH 390
           A   C  D ++LC  CD  VH
Sbjct: 78  AVLACHADAAALCTACDAQVH 98



 Score = 59.7 bits (143), Expect = 9e-08
 Identities = 28/53 (52%), Positives = 35/53 (66%), Gaps = 1/53 (1%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVG-LANPPIVVP 300
           +C+ CESA A+L C AD AALC ACD +VH  N +A RH RV  L  P + +P
Sbjct: 69  VCETCESAPAVLACHADAAALCTACDAQVHSANPIAQRHQRVPVLPLPAVAIP 121



>gb:AB041841_1519731 Oryza sativa Hd1 gene, complete cds,
           strain:HS66.
          Length = 259

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 37/92 (40%), Positives = 53/92 (57%), Gaps = 2/92 (2%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C +A ++++C AD A LC +CD +VH  N++ASRH RV +         C+ CE AP
Sbjct: 35  CDGCRAAPSVVYCRADAAYLCASCDARVHAANRVASRHERVRV---------CEACERAP 85

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSR 417
           A   C  D ++LC+ CD+ V+      R H R
Sbjct: 86  AALACRADAAALCVACDVQVYSANPLARRHQR 117



 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 29/61 (47%), Positives = 36/61 (59%), Gaps = 1/61 (1%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLAN-PPIVVPRCDICEN 321
           +C+ CE A A L C AD AALC ACD +V+  N LA RH RV +A  P I +P   +   
Sbjct: 77  VCEACERAPAALACRADAAALCVACDVQVYSANPLARRHQRVPVAPLPAITIPATSVLAE 136

Query: 322 A 324
           A
Sbjct: 137 A 137



>gb:AB041840_1519730 Oryza sativa Hd1 gene, complete cds,
           strain:Ginbouzu.>gb:AB041842_1519732 Oryza sativa Hd1
           gene, complete cds, strain:HS110.
          Length = 407

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 37/92 (40%), Positives = 53/92 (57%), Gaps = 2/92 (2%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C +A ++++C AD A LC +CD +VH  N++ASRH RV +         C+ CE AP
Sbjct: 35  CDGCRAAPSVVYCRADAAYLCASCDARVHAANRVASRHERVRV---------CEACERAP 85

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSR 417
           A   C  D ++LC+ CD+ V+      R H R
Sbjct: 86  AALACRADAAALCVACDVQVYSANPLARRHQR 117



 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 29/61 (47%), Positives = 36/61 (59%), Gaps = 1/61 (1%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLAN-PPIVVPRCDICEN 321
           +C+ CE A A L C AD AALC ACD +V+  N LA RH RV +A  P I +P   +   
Sbjct: 77  VCEACERAPAALACRADAAALCVACDVQVYSANPLARRHQRVPVAPLPAITIPATSVLAE 136

Query: 322 A 324
           A
Sbjct: 137 A 137



>gb:AF300700_1784219 Ipomoea nil CONSTANS-like protein mRNA,
           complete cds.
          Length = 417

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 36/82 (43%), Positives = 48/82 (58%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENA 324
           +CD+C SAA  ++C AD A LC  CD +VH  N +A RH RV +         C+ CE+A
Sbjct: 33  VCDICRSAACSVYCRADLAYLCGGCDARVHGANTVAGRHERVLV---------CEACESA 83

Query: 325 PAFFYCEVDGSSLCLQCDMIVH 390
           PA   C+ D +SLC  CD  +H
Sbjct: 84  PATVICKADAASLCAACDSDIH 105



 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 23/42 (54%), Positives = 28/42 (66%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+ CESA A + C AD A+LC ACD  +H  N LA RH RV
Sbjct: 76  VCEACESAPATVICKADAASLCAACDSDIHSANPLARRHHRV 117



>gb:AF510466_1807209 Brassica nigra isolate S13PO COL1 protein
           (COL1) gene, complete cds.
          Length = 342

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 38/92 (41%), Positives = 50/92 (54%), Gaps = 2/92 (2%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD   SAA  ++C AD A  C +CD ++   N+LASRH RV +         C+ CE AP
Sbjct: 12  CDTXRSAACTVYCRADSAYXCTSCDAQIXAANRLASRHERVRV---------CESCERAP 62

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSR 417
           A F+C+ D +SLC  CD  +H      R H R
Sbjct: 63  AAFFCKADAASLCTACDSQIHSANPLARRHQR 94



 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 23/42 (54%), Positives = 28/42 (66%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+ CE A A  FC AD A+LC ACD ++H  N LA RH RV
Sbjct: 54  VCESCERAPAAFFCKADAASLCTACDSQIHSANPLARRHQRV 95



>gb:AF490469_1804788 Hordeum vulgare subsp. vulgare cultivar Igri
           CONSTANS-like protein (CO2) gene, complete
           cds.>gb:AF490470_1804789 Hordeum vulgare subsp. vulgare
           cultivar Morex CONSTANS-like protein (CO2) gene,
           complete cds.
          Length = 368

 Score = 77.0 bits (188), Expect = 5e-13
 Identities = 34/81 (41%), Positives = 47/81 (58%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C +A + ++C AD A LC +CD +VH  N++ASRH RV +         C+ CE+ P
Sbjct: 25  CDGCHAAPSAVYCCADAAYLCSSCDTQVHSANRVASRHERVRV---------CETCESTP 75

Query: 328 AFFYCEVDGSSLCLQCDMIVH 390
           A   C  D ++LC  CD  VH
Sbjct: 76  AVLACHADAAALCTACDAQVH 96



 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 27/53 (50%), Positives = 34/53 (64%), Gaps = 1/53 (1%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVG-LANPPIVVP 300
           +C+ CES  A+L C AD AALC ACD +VH  N +A RH RV  L  P + +P
Sbjct: 67  VCETCESTPAVLACHADAAALCTACDAQVHSANPIAQRHQRVPVLPLPAVAIP 119



>gb:AF001136_1760521 Pinus radiata zinc finger protein (PrCO) mRNA,
           complete cds.
          Length = 438

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 34/88 (38%), Positives = 52/88 (59%)
 Frame = +1

Query: 127 R*SMRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRC 306
           R SM  LCDVC+ ++++++C A  A LC  CD K+H  +K +  H RV +         C
Sbjct: 29  RMSMPKLCDVCQVSSSVIYCRAHTAQLCLVCDAKIHGGSKASLCHERVWV---------C 79

Query: 307 DICENAPAFFYCEVDGSSLCLQCDMIVH 390
           ++CE APA   C+ D ++LC+ CD  +H
Sbjct: 80  EVCEQAPAVVTCKADAAALCVACDTDIH 107



 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 24/41 (58%), Positives = 29/41 (70%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVR 267
           +C+VCE A A++ C AD AALC ACD  +H  N LASRH R
Sbjct: 78  VCEVCEQAPAVVTCKADAAALCVACDTDIHSANPLASRHER 118



 Score = 39.3 bits (90), Expect = 0.12
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 1/50 (2%)
 Frame = +1

Query: 256 RHVRVGLANPPIVVPR-CDICENAPAFFYCEVDGSSLCLQCDMIVHVGGK 402
           RH   G+    + +P+ CD+C+ + +  YC    + LCL CD  +H G K
Sbjct: 19  RHELRGIGGWRMSMPKLCDVCQVSSSVIYCRAHTAQLCLVCDAKIHGGSK 68



>gb:OSJN00052_1693947 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0067K08, complete sequence.
          Length = 333

 Score = 73.2 bits (178), Expect = 8e-12
 Identities = 49/141 (34%), Positives = 60/141 (42%), Gaps = 1/141 (0%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C   AA LFC AD A LC  CD + H      SRH RV L         C++CE+AP
Sbjct: 22  CDACGGEAARLFCRADAAFLCAGCDARAH---GPGSRHARVWL---------CEVCEHAP 69

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGGKRTHSRYLLMRQRVEFP-GDKAGQTEEPPRLTSDPG 504
           A   C  D ++LC  CD  +       HS   L R+    P     G   + P+    PG
Sbjct: 70  AAVTCRADAAALCAACDADI-------HSANPLARRHERLPVAPFFGALADAPK----PG 118

Query: 505 QQNHAAAAAVPVSDNTKDGHA 567
              H   AA    D + D  A
Sbjct: 119 SGAHGGDAAAADDDGSNDAEA 139



 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 25/45 (55%), Positives = 30/45 (66%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLA 279
           LC+VCE A A + C AD AALC ACD  +H  N LA RH R+ +A
Sbjct: 61  LCEVCEHAPAAVTCRADAAALCAACDADIHSANPLARRHERLPVA 105



 Score = 33.9 bits (76), Expect = 5.2
 Identities = 19/53 (35%), Positives = 23/53 (43%)
 Frame = +1

Query: 268 VGLANPPIVVPRCDICENAPAFFYCEVDGSSLCLQCDMIVHVGGKRTHSRYLL 426
           VG A   +    CD C    A  +C  D + LC  CD   H  G R H+R  L
Sbjct: 10  VGGAYWGLAARACDACGGEAARLFCRADAAFLCAGCDARAHGPGSR-HARVWL 61



>gb:AY082958_1569216 Hordeum vulgare CONSTANS-like protein CO5 (CO5)
           gene, complete cds.
          Length = 325

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 48/143 (33%), Positives = 63/143 (44%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C   AA L+C  D A LC  CD + H      SRH RV L         C++CE+AP
Sbjct: 30  CDTCAVDAARLYCRLDGAYLCAGCDARAHGAG---SRHARVWL---------CEVCEHAP 77

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGGKRTHSRYLLMRQRVEFPGDKAGQTEEPPRLTSDPGQ 507
           A   C  D ++LC  CD  +H       SR+LL+      P    G   +PP+    P  
Sbjct: 78  AAVTCRADAAALCATCDADIH-SANPLASRHLLL------PTPFFGALADPPQPVPSP-- 128

Query: 508 QNHAAAAAVPVSDNTKDGHAKRE 576
               ++AA    D   DG  + E
Sbjct: 129 ----SSAAATQEDAEDDGSNEAE 147



 Score = 57.8 bits (138), Expect = 3e-07
 Identities = 29/58 (50%), Positives = 35/58 (60%), Gaps = 6/58 (10%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV------GLANPPIVVP 300
           LC+VCE A A + C AD AALC  CD  +H  N LASRH+ +       LA+PP  VP
Sbjct: 69  LCEVCEHAPAAVTCRADAAALCATCDADIHSANPLASRHLLLPTPFFGALADPPQPVP 126



>sp|Q9C7E8|COL3_ARATH Zinc finger protein constans-like
           3.>pir|B86406|B86406 probable protein CONSTANS family
           zinc finger protein [imported] - Arabidopsis
           thaliana>gb:AE005172_891688 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC069471_1540851 Arabidopsis thaliana
           chromosome 1 BAC F13K9 genomic sequence, complete
           sequence.>gb:AY037206_1560100 Arabidopsis thaliana
           At1g28050/F13K9_15 mRNA, complete
           cds.>gb:BT002681_1636284 Arabidopsis thaliana
           At1g28050/F13K9_15 gene, complete cds.
          Length = 433

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 36/86 (41%), Positives = 42/86 (48%)
 Frame = +1

Query: 133 SMRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDI 312
           S R  CD C    A+LFC AD A LC  CD +VH  N L+ +HVR  +         CD 
Sbjct: 4   SERVPCDFCGERTAVLFCRADTAKLCLPCDQQVHTANLLSRKHVRSQI---------CDN 54

Query: 313 CENAPAFFYCEVDGSSLCLQCDMIVH 390
           C N P    C  D   LC +CD  VH
Sbjct: 55  CGNEPVSVRCFTDNLILCQECDWDVH 80



>gb:AF490474_1804793 Hordeum vulgare subsp. vulgare cultivar Igri
           CONSTANS-like protein (CO4) gene, complete
           cds.>gb:AF490475_1804794 Hordeum vulgare subsp. vulgare
           cultivar Morex CONSTANS-like protein (CO4) mRNA,
           complete cds.
          Length = 323

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 47/145 (32%), Positives = 61/145 (42%), Gaps = 7/145 (4%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C + AA LFC AD A LC  CD + H      SRH RV L         C++CE+AP
Sbjct: 21  CDSCATEAARLFCRADAAFLCAGCDARAH---GSGSRHARVWL---------CEVCEHAP 68

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSR-----YLLMRQRVEFPGDKAGQTEEPPR 486
           A   C+ D + LC  CD  +H      R H R     +         P   +G       
Sbjct: 69  AAVTCKADAAVLCASCDADIHAANPLARRHERVPVAPFFGAAADAHKPFPSSGAQAGAAA 128

Query: 487 LTSDPGQQNHAAAAAVPVSDNTKDG 561
              D G  +  AA+ +    + KDG
Sbjct: 129 SAEDDGSNDAEAASWLLPEPDHKDG 153



 Score = 53.9 bits (128), Expect = 5e-06
 Identities = 24/45 (53%), Positives = 29/45 (64%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLA 279
           LC+VCE A A + C AD A LC +CD  +H  N LA RH RV +A
Sbjct: 60  LCEVCEHAPAAVTCKADAAVLCASCDADIHAANPLARRHERVPVA 104



>gb:AK117800_1815814 Arabidopsis thaliana At1g68190 mRNA for
           putative zinc finger protein, complete cds, clone:
           RAFL17-49-D21.
          Length = 356

 Score = 70.5 bits (171), Expect = 5e-11
 Identities = 35/95 (36%), Positives = 47/95 (49%)
 Frame = +1

Query: 133 SMRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDI 312
           +M  +C+ C++  A+++C AD A LC  CD KVH  N L+ RH+R  L         CD 
Sbjct: 9   NMERVCEFCKAYRAVVYCIADTANLCLTCDAKVHSANSLSGRHLRTVL---------CDS 59

Query: 313 CENAPAFFYCEVDGSSLCLQCDMIVHVGGKRTHSR 417
           C+N P    C      LC  C+   H GG   H R
Sbjct: 60  CKNQPCVVRCFDHKMFLCHGCNDKFHGGGSSEHRR 94



>sp|Q9C9F4|COL5_ARATH Zinc finger protein constans-like
           5.>pir|C96705|C96705 probable zinc finger protein
           T22E19.18 [imported] - Arabidopsis
           thaliana>gb:AE005173_894440 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC016447_1538149 Arabidopsis thaliana
           chromosome 1 BAC T22E19 genomic sequence, complete
           sequence.
          Length = 356

 Score = 70.5 bits (171), Expect = 5e-11
 Identities = 35/95 (36%), Positives = 47/95 (49%)
 Frame = +1

Query: 133 SMRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDI 312
           +M  +C+ C++  A+++C AD A LC  CD KVH  N L+ RH+R  L         CD 
Sbjct: 9   NMERVCEFCKAYRAVVYCIADTANLCLTCDAKVHSANSLSGRHLRTVL---------CDS 59

Query: 313 CENAPAFFYCEVDGSSLCLQCDMIVHVGGKRTHSR 417
           C+N P    C      LC  C+   H GG   H R
Sbjct: 60  CKNQPCVVRCFDHKMFLCHGCNDKFHGGGSSEHRR 94



>gb:AY356370_1601886 Brassica rapa cultivar Samjin Col-2-like
           protein mRNA, complete cds.
          Length = 321

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 37/92 (40%), Positives = 47/92 (51%), Gaps = 2/92 (2%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C SAA  ++  AD   LC  CD +VH     A++ VRV           CD CE+AP
Sbjct: 15  CDTCRSAACTIYREADSTYLCTTCDARVH-----AAKRVRV-----------CDSCESAP 58

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSR 417
           A F+C+ D +SLC  CD  +H      R H R
Sbjct: 59  AAFFCKADAASLCTACDAEIHSANPLARRHQR 90



 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 25/46 (54%), Positives = 31/46 (67%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLAN 282
           +CD CESA A  FC AD A+LC ACD ++H  N LA RH RV + +
Sbjct: 50  VCDSCESAPAAFFCKADAASLCTACDAEIHSANPLARRHQRVPITS 95



>gb:AY057632_1564045 Arabidopsis thaliana AT5g57660/MRI1_1 mRNA,
           complete cds.>gb:AY080747_1568460 Arabidopsis thaliana
           putative CONSTANS B-box zinc finger protein (At5g57660)
           mRNA, complete cds.>gb:AY114006_1578417 Arabidopsis
           thaliana putative CONSTANS B-box zinc finger protein
           (At5g57660) mRNA, complete cds.
          Length = 355

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 32/81 (39%), Positives = 45/81 (55%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C+S  A +FC  D A LC ACD ++H      +RH RV +         C++CE AP
Sbjct: 22  CDACKSVTAAVFCRVDSAFLCIACDTRIHS----FTRHERVWV---------CEVCEQAP 68

Query: 328 AFFYCEVDGSSLCLQCDMIVH 390
           A   C+ D ++LC+ CD  +H
Sbjct: 69  AAVTCKADAAALCVSCDADIH 89



 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 24/42 (57%), Positives = 29/42 (69%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+VCE A A + C AD AALC +CD  +H  N LASRH RV
Sbjct: 60  VCEVCEQAPAAVTCKADAAALCVSCDADIHSANPLASRHERV 101



>sp|Q9FHH8|COLF_ARATH Zinc finger protein constans-like
           15.>gb:AB018118_1513872 Arabidopsis thaliana genomic
           DNA, chromosome 5, P1 clone:MRI1.
          Length = 351

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 32/81 (39%), Positives = 45/81 (55%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C+S  A +FC  D A LC ACD ++H      +RH RV +         C++CE AP
Sbjct: 22  CDACKSVTAAVFCRVDSAFLCIACDTRIHS----FTRHERVWV---------CEVCEQAP 68

Query: 328 AFFYCEVDGSSLCLQCDMIVH 390
           A   C+ D ++LC+ CD  +H
Sbjct: 69  AAVTCKADAAALCVSCDADIH 89



 Score = 54.7 bits (130), Expect = 3e-06
 Identities = 24/42 (57%), Positives = 29/42 (69%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+VCE A A + C AD AALC +CD  +H  N LASRH RV
Sbjct: 60  VCEVCEQAPAAVTCKADAAALCVSCDADIHSANPLASRHERV 101



>gb:AY088432_1573451 Arabidopsis thaliana clone 6639 mRNA, complete
           sequence.
          Length = 355

 Score = 69.7 bits (169), Expect = 8e-11
 Identities = 32/81 (39%), Positives = 45/81 (55%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C+S  A +FC  D A LC ACD ++H      +RH RV +         C++CE AP
Sbjct: 22  CDACKSVTAAVFCRVDSAFLCIACDTRIHS----FTRHERVWV---------CEVCEQAP 68

Query: 328 AFFYCEVDGSSLCLQCDMIVH 390
           A   C+ D ++LC+ CD  +H
Sbjct: 69  AAVTCKADAAALCVTCDADIH 89



 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 24/42 (57%), Positives = 28/42 (66%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +C+VCE A A + C AD AALC  CD  +H  N LASRH RV
Sbjct: 60  VCEVCEQAPAAVTCKADAAALCVTCDADIHSANPLASRHERV 101



>gb:AY496442_1609101 Brassica rapa cultivar Kwonsim Col-2-like
           protein mRNA, complete cds.
          Length = 321

 Score = 68.2 bits (165), Expect = 2e-10
 Identities = 36/92 (39%), Positives = 46/92 (50%), Gaps = 2/92 (2%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C SAA  ++  AD   LC  CD +VH     A++ VRV           CD CE+AP
Sbjct: 15  CDTCRSAACTIYREADSTYLCTTCDARVH-----AAKRVRV-----------CDSCESAP 58

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSR 417
           A F+C+ D + LC  CD  +H      R H R
Sbjct: 59  AAFFCKADAAPLCTACDAEIHSANPLARRHQR 90



 Score = 57.4 bits (137), Expect = 4e-07
 Identities = 25/46 (54%), Positives = 30/46 (65%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLAN 282
           +CD CESA A  FC AD A LC ACD ++H  N LA RH RV + +
Sbjct: 50  VCDSCESAPAAFFCKADAAPLCTACDAEIHSANPLARRHQRVPITS 95



>gb:AP004063_1837112 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1476_F05.
          Length = 332

 Score = 67.8 bits (164), Expect = 3e-10
 Identities = 37/92 (40%), Positives = 45/92 (48%), Gaps = 2/92 (2%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C   AA L+C AD A LC  CD + H      SRH RV L         C++CE+AP
Sbjct: 32  CDSCGGEAARLYCRADGAFLCARCDARAHGAG---SRHARVWL---------CEVCEHAP 79

Query: 328 AFFYCEVDGSSLCLQCDMIVHVGG--KRTHSR 417
           A   C  D ++LC  CD  +H      R H R
Sbjct: 80  AAVTCRADAAALCAACDADIHSANPLARRHER 111



 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 29/61 (47%), Positives = 35/61 (57%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENA 324
           LC+VCE A A + C AD AALC ACD  +H  N LA RH R+ +A  P   P  D  +  
Sbjct: 71  LCEVCEHAPAAVTCRADAAALCAACDADIHSANPLARRHERLPVA--PFFGPLADAPQPF 128

Query: 325 P 327
           P
Sbjct: 129 P 129



>gb:BT002067_1635670 Arabidopsis thaliana putative CONSTANS-like
           B-box zinc finger protein (At2g33500) mRNA, complete
           cds.
          Length = 402

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 35/92 (38%), Positives = 41/92 (44%), Gaps = 2/92 (2%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           C+ C    A+LFC AD A LC  CD  VH  N L+ +HVR  +         CD C   P
Sbjct: 12  CEFCGERTAVLFCRADTAKLCLPCDQHVHSANLLSRKHVRSQI---------CDNCSKEP 62

Query: 328 AFFYCEVDGSSLCLQCDMIVH--VGGKRTHSR 417
               C  D   LC +CD  VH       TH R
Sbjct: 63  VSVRCFTDNLVLCQECDWDVHGSCSSSATHER 94



 Score = 34.3 bits (77), Expect = 4.0
 Identities = 13/32 (40%), Positives = 16/32 (50%)
 Frame = +1

Query: 295 VPRCDICENAPAFFYCEVDGSSLCLQCDMIVH 390
           V  C+ C    A  +C  D + LCL CD  VH
Sbjct: 9   VVACEFCGERTAVLFCRADTAKLCLPCDQHVH 40



>sp|O22800|COL9_ARATH Zinc finger protein constans-like
           9.>pir|C84746|C84746 hypothetical protein At2g33500
           [imported] - Arabidopsis thaliana>gb:AC002332_1530322
           Arabidopsis thaliana chromosome 2 clone F4P9 map ve015,
           complete sequence.
          Length = 361

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 35/92 (38%), Positives = 41/92 (44%), Gaps = 2/92 (2%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           C+ C    A+LFC AD A LC  CD  VH  N L+ +HVR  +         CD C   P
Sbjct: 12  CEFCGERTAVLFCRADTAKLCLPCDQHVHSANLLSRKHVRSQI---------CDNCSKEP 62

Query: 328 AFFYCEVDGSSLCLQCDMIVH--VGGKRTHSR 417
               C  D   LC +CD  VH       TH R
Sbjct: 63  VSVRCFTDNLVLCQECDWDVHGSCSSSATHER 94



 Score = 34.3 bits (77), Expect = 4.0
 Identities = 13/32 (40%), Positives = 16/32 (50%)
 Frame = +1

Query: 295 VPRCDICENAPAFFYCEVDGSSLCLQCDMIVH 390
           V  C+ C    A  +C  D + LCL CD  VH
Sbjct: 9   VVACEFCGERTAVLFCRADTAKLCLPCDQHVH 40



>pir|JE0113|JE0113 zinc-finger protein S3574 [imported] -
           rice>gb:AB001888_1508681 Oryza sativa (japonica
           cultivar-group) mRNA for zinc finger protein, complete
           cds, clone:S3574.>gb:AP005113_1848084 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0685G12.
          Length = 407

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 32/85 (37%), Positives = 42/85 (49%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDIC 315
           M  LCD C    ++++C +D A+LC +CD  VH  N L+ RH R  L         CD C
Sbjct: 1   MDALCDFCREQRSMVYCRSDAASLCLSCDRNVHSANALSRRHTRTLL---------CDRC 51

Query: 316 ENAPAFFYCEVDGSSLCLQCDMIVH 390
              PA   C  + +SLC  CD   H
Sbjct: 52  VGQPAAVRCLEENTSLCQNCDWNGH 76



>gb:AF490467_1804786 Hordeum vulgare subsp. vulgare cultivar Igri
           CONSTANS-like protein (CO1) gene, complete
           cds.>gb:AF490468_1804787 Hordeum vulgare subsp. vulgare
           cultivar Morex CONSTANS-like protein (CO1) gene,
           complete cds.
          Length = 383

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 33/99 (33%), Positives = 52/99 (52%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENA 324
           LCD C +  ++++C AD A LC +CD ++H  N++ASRH RV L+         +  ++A
Sbjct: 23  LCDGCCTVPSVVYCRADSAYLCASCDAQIHAANRVASRHERVLLS---------EAYKHA 73

Query: 325 PAFFYCEVDGSSLCLQCDMIVHVGGKRTHSRYLLMRQRV 441
           P    C  D ++LC   +  VH     T     +M QR+
Sbjct: 74  PVMLDCHADAAALCAAYEAQVHYANLLT-----VMHQRM 107



 Score = 37.7 bits (86), Expect = 0.36
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 1/63 (1%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVG-LANPPIVVPRCDICEN 321
           L +  + A  +L C AD AALC A + +VH  N L   H R+  +++P + +P   +   
Sbjct: 66  LSEAYKHAPVMLDCHADAAALCAAYEAQVHYANLLTVMHQRMPVVSHPAVAIPPVSLFAE 125

Query: 322 APA 330
           A A
Sbjct: 126 AEA 128



>sp|Q9LUA9|COLE_ARATH Zinc finger protein constans-like
           14.>gb:AB023039_1515431 Arabidopsis thaliana genomic
           DNA, chromosome 5, P1 clone:MIF21.>gb:AY039957_1560466
           Arabidopsis thaliana unknown protein (At5g48250) mRNA,
           complete cds.>gb:AY142607_1583023 Arabidopsis thaliana
           unknown protein (At5g48250) mRNA, complete cds.
          Length = 373

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 31/91 (34%), Positives = 42/91 (46%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDIC 315
           M  +CD C    ++++C +D A LC +CD  VH  N L+ RH R  +         C+ C
Sbjct: 1   MGYMCDFCGEQRSMVYCRSDAACLCLSCDRNVHSANALSKRHSRTLV---------CERC 51

Query: 316 ENAPAFFYCEVDGSSLCLQCDMIVHVGGKRT 408
              PA   C  +  SLC  CD   H G   T
Sbjct: 52  NAQPASVRCSDERVSLCQNCDWSGHDGKNST 82



>gb:AY600919_1617349 Lolium perenne CONSTANS-like protein mRNA,
           complete cds.
          Length = 377

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 30/86 (34%), Positives = 44/86 (51%)
 Frame = +1

Query: 133 SMRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDI 312
           S   LCD C    ++++C AD A LC +CD ++H  N++ASRH RV L+         + 
Sbjct: 19  SWSRLCDGCCMVPSVVYCHADSAYLCASCDVRIHSANRVASRHERVCLS---------EA 69

Query: 313 CENAPAFFYCEVDGSSLCLQCDMIVH 390
            E+APA   C  D  + C   +   H
Sbjct: 70  HEHAPALLQCRTDAVASCAAYEAQAH 95



>gb:AY553297_1613474 Lolium temulentum CONSTANS-like protein mRNA,
           complete cds.
          Length = 376

 Score = 59.7 bits (143), Expect = 9e-08
 Identities = 30/86 (34%), Positives = 43/86 (50%)
 Frame = +1

Query: 133 SMRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDI 312
           S   LCD C    ++++C AD A LC +CD ++H  N++ASRH RV L+           
Sbjct: 19  SWSRLCDGCCMVPSVVYCHADSAYLCASCDVRIHSANRVASRHERVCLSKAH-------- 70

Query: 313 CENAPAFFYCEVDGSSLCLQCDMIVH 390
            E+APA   C  D  + C   +   H
Sbjct: 71  -EHAPALLQCRTDAVASCAAYEAQAH 95



>pir|JE0114|JE0114 zinc-finger protein C60910 [imported] -
           rice>gb:AB001882_1508675 Oryza sativa (japonica
           cultivar-group) mRNA for zinc finger protein, complete
           cds, clone:C60910.
          Length = 403

 Score = 59.7 bits (143), Expect = 9e-08
 Identities = 36/87 (41%), Positives = 41/87 (47%), Gaps = 1/87 (1%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C  AAA+++C AD A LC  CD  VH  N + SRH R          P C  C  A 
Sbjct: 38  CDYCGDAAAVVYCRADAARLCLPCDRHVHGANGVCSRHAR---------APLCAACAAAG 88

Query: 328 AFFYCEVDGSSLCLQCDMIVH-VGGKR 405
           A F     G  LC  CD   H  GG+R
Sbjct: 89  AVFR-RGAGGFLCSNCDFSRHRHGGER 114



>gb:AP004274_1839603 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0450A04.
          Length = 379

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 30/77 (38%), Positives = 37/77 (48%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C    A+++C AD A LC  CD  VH  N +++RH R          P C  C  AP
Sbjct: 24  CDFCGGLPAVVYCRADSARLCLPCDRHVHAANTVSTRHAR---------APLCSACRAAP 74

Query: 328 AFFYCEVDGSSLCLQCD 378
           A  +   DG  LC  CD
Sbjct: 75  AAAFHRGDG-FLCSSCD 90



 Score = 39.7 bits (91), Expect = 0.094
 Identities = 15/29 (51%), Positives = 16/29 (55%)
 Frame = +1

Query: 304 CDICENAPAFFYCEVDGSSLCLQCDMIVH 390
           CD C   PA  YC  D + LCL CD  VH
Sbjct: 24  CDFCGGLPAVVYCRADSARLCLPCDRHVH 52



>sp|Q9SSE5|COLB_ARATH Zinc finger protein constans-like
           11.>gb:ATAC009176_1542826 Arabidopsis thaliana
           chromosome III P1 MLP3 genomic sequence, complete
           sequence.
          Length = 372

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 30/93 (32%), Positives = 42/93 (45%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDIC 315
           M  +CD C    ++++C +D A LC +CD  VH  N L+ RH R  +         C+ C
Sbjct: 1   MGYMCDFCGEQRSMVYCRSDAACLCLSCDRSVHSANALSKRHSRTLV---------CERC 51

Query: 316 ENAPAFFYCEVDGSSLCLQCDMIVHVGGKRTHS 414
              PA   C  +  SLC  CD   H      +S
Sbjct: 52  NAQPATVRCVEERVSLCQNCDWSGHNNSNNNNS 84



>gb:PFA929353_1393081 Plasmodium falciparum strain 3D7, chromosome
           5, segment 3/4.
          Length = 547

 Score = 57.4 bits (137), Expect = 4e-07
 Identities = 25/77 (32%), Positives = 36/77 (46%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENA 324
           LCD C  A AIL+C +DE  LC  CD  +H  NK+  +H+R  L     +  +C      
Sbjct: 277 LCDYCSDAPAILYCESDEVKLCEKCDTLIHSQNKIVKKHIRKALNEAQKISGKCKRHMTN 336

Query: 325 PAFFYCEVDGSSLCLQC 375
               +C +    +C  C
Sbjct: 337 DVNMFCTICHIPICNLC 353



 Score = 45.1 bits (105), Expect = 0.002
 Identities = 17/36 (47%), Positives = 22/36 (61%)
 Frame = +1

Query: 295 VPRCDICENAPAFFYCEVDGSSLCLQCDMIVHVGGK 402
           +P CD C +APA  YCE D   LC +CD ++H   K
Sbjct: 275 LPLCDYCSDAPAILYCESDEVKLCEKCDTLIHSQNK 310



>pir|F71416|F71416 hypothetical protein - Arabidopsis
           thaliana>gb:ATCHRIV41_1545327 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 41.>gb:ATFCA3_1551575
           Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
           fragment No. 3.
          Length = 291

 Score = 56.6 bits (135), Expect = 7e-07
 Identities = 28/80 (35%), Positives = 37/80 (46%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDIC 315
           M   CD C +  A+++C +D A LC  CD  VH  N L+ RH R  L         C+ C
Sbjct: 1   MEARCDFCGTEKALIYCKSDSAKLCLNCDVNVHSANPLSQRHTRSLL---------CEKC 51

Query: 316 ENAPAFFYCEVDGSSLCLQC 375
              P   +C  +  SLC  C
Sbjct: 52  SLQPTAVHCMNENVSLCQGC 71



 Score = 42.4 bits (98), Expect = 0.015
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 2/44 (4%)
 Frame = +1

Query: 301 RCDICENAPAFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRYLL 426
           RCD C    A  YC+ D + LCL CD+ VH      + H+R LL
Sbjct: 4   RCDFCGTEKALIYCKSDSAKLCLNCDVNVHSANPLSQRHTRSLL 47



>sp|O23379|COLD_ARATH Hypothetical zinc finger protein constans-like
           13.
          Length = 330

 Score = 56.6 bits (135), Expect = 7e-07
 Identities = 28/80 (35%), Positives = 37/80 (46%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDIC 315
           M   CD C +  A+++C +D A LC  CD  VH  N L+ RH R  L         C+ C
Sbjct: 1   MEARCDFCGTEKALIYCKSDSAKLCLNCDVNVHSANPLSQRHTRSLL---------CEKC 51

Query: 316 ENAPAFFYCEVDGSSLCLQC 375
              P   +C  +  SLC  C
Sbjct: 52  SLQPTAVHCMNENVSLCQGC 71



 Score = 42.4 bits (98), Expect = 0.015
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 2/44 (4%)
 Frame = +1

Query: 301 RCDICENAPAFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRYLL 426
           RCD C    A  YC+ D + LCL CD+ VH      + H+R LL
Sbjct: 4   RCDFCGTEKALIYCKSDSAKLCLNCDVNVHSANPLSQRHTRSLL 47



>gb:AF490473_1804792 Hordeum vulgare subsp. vulgare cultivar Igri
           CONSTANS-like protein (CO3) gene, complete cds.
          Length = 329

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 25/41 (60%), Positives = 26/41 (63%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           CD C SA    +C AD AALC ACD  VH  N LASRH RV
Sbjct: 27  CDSCRSAPCAFYCRADSAALCAACDADVHSANTLASRHRRV 67



 Score = 43.5 bits (101), Expect = 0.007
 Identities = 16/30 (53%), Positives = 19/30 (63%)
 Frame = +1

Query: 301 RCDICENAPAFFYCEVDGSSLCLQCDMIVH 390
           RCD C +AP  FYC  D ++LC  CD  VH
Sbjct: 26  RCDSCRSAPCAFYCRADSAALCAACDADVH 55



>gb:AF490472_1804791 Hordeum vulgare subsp. vulgare cultivar Morex
           CONSTANS-like protein (CO3) mRNA, complete cds.
          Length = 217

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 25/41 (60%), Positives = 26/41 (63%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           CD C SA    +C AD AALC ACD  VH  N LASRH RV
Sbjct: 27  CDSCRSAPCAFYCRADSAALCAACDADVHSANTLASRHRRV 67



 Score = 43.5 bits (101), Expect = 0.007
 Identities = 16/30 (53%), Positives = 19/30 (63%)
 Frame = +1

Query: 301 RCDICENAPAFFYCEVDGSSLCLQCDMIVH 390
           RCD C +AP  FYC  D ++LC  CD  VH
Sbjct: 26  RCDSCRSAPCAFYCRADSAALCAACDADVH 55



>gb:AF490471_1804790 Hordeum vulgare subsp. vulgare cultivar CI16155
           CONSTANS-like protein (CO3) mRNA, complete cds.
          Length = 329

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 25/41 (60%), Positives = 26/41 (63%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           CD C SA    +C AD AALC ACD  VH  N LASRH RV
Sbjct: 27  CDSCRSAPCAFYCRADSAALCAACDADVHSANTLASRHRRV 67



 Score = 43.5 bits (101), Expect = 0.007
 Identities = 16/30 (53%), Positives = 19/30 (63%)
 Frame = +1

Query: 301 RCDICENAPAFFYCEVDGSSLCLQCDMIVH 390
           RCD C +AP  FYC  D ++LC  CD  VH
Sbjct: 26  RCDSCRSAPCAFYCRADSAALCAACDADVH 55



>gb:AP004888_1846677 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0617A09.>gb:AP005319_1850514 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0643A10.
          Length = 452

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 27/63 (42%), Positives = 37/63 (58%), Gaps = 2/63 (3%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRH--VRVGLANPPIVVPRCDICEN 321
           CD C    A  +CAAD+A LC+ CD  VH  N LA RH  +R+ +++PP +  R  + E 
Sbjct: 20  CDSCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHERLRLRVSSPPPLTARASVEEE 79

Query: 322 APA 330
           A A
Sbjct: 80  AAA 82



 Score = 38.1 bits (87), Expect = 0.27
 Identities = 31/93 (33%), Positives = 38/93 (40%), Gaps = 2/93 (2%)
 Frame = +1

Query: 304 CDICENAPAFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRYLLMRQRVEFPGDKAGQTEE 477
           CD C    A +YC  D + LC  CD  VH      R H R   +R RV            
Sbjct: 20  CDSCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHER---LRLRV----------SS 66

Query: 478 PPRLTSDPGQQNHAAAAAVPVSDNTKDGHAKRE 576
           PP LT+    +  AAAA    +  T    +KRE
Sbjct: 67  PPPLTARASVEEEAAAAVGTTTTTT----SKRE 95



>gb:AP004464_1841428 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0665C04.>gb:AP005439_1851768 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBa0033D24.
          Length = 488

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 34/81 (41%), Positives = 37/81 (45%), Gaps = 4/81 (4%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD C  AAA L C AD A LC ACD  VH  N L+ +HVR          P C  C   P
Sbjct: 18  CDYCGEAAAALHCRADAARLCVACDRHVHAANALSRKHVR---------APLCAACAARP 68

Query: 328 AFFYCEVDGSS----LCLQCD 378
           A     V  +S    LC  CD
Sbjct: 69  A--AARVASASAPAFLCADCD 87



 Score = 35.8 bits (81), Expect = 1.4
 Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 2/40 (5%)
 Frame = +1

Query: 304 CDICENAPAFFYCEVDGSSLCLQCDMIVHVGG--KRTHSR 417
           CD C  A A  +C  D + LC+ CD  VH      R H R
Sbjct: 18  CDYCGEAAAALHCRADAARLCVACDRHVHAANALSRKHVR 57



>gb:AY082961_1569219 Hordeum vulgare clone HVSMEc0008O24f
           CONSTANS-like protein CO6 (CO6) mRNA, complete
           cds.>gb:AY082962_1569220 Hordeum vulgare clone
           HVSMEb0009D03f CONSTANS-like protein CO6 (CO6) mRNA,
           complete cds.
          Length = 376

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 24/45 (53%), Positives = 30/45 (66%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLA 279
           +C+VCE + A + C AD A LC ACD  +H  N LA RHVRV +A
Sbjct: 55  VCEVCEVSPAAVTCKADAAVLCAACDADIHHANPLAERHVRVPIA 99



 Score = 44.3 bits (103), Expect = 0.004
 Identities = 30/100 (30%), Positives = 41/100 (41%), Gaps = 1/100 (1%)
 Frame = +1

Query: 94  KLRNFWVG*SER*SMRTLCDVCESAA-AILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           +LR +W     R      C  CE AA A + C      LC  CD +          H R 
Sbjct: 3   ELRKYWGVGGRR------CGGCEGAAPAAVHCRDCAGYLCTGCDAR--------PAHARA 48

Query: 271 GLANPPIVVPRCDICENAPAFFYCEVDGSSLCLQCDMIVH 390
           G     +    C++CE +PA   C+ D + LC  CD  +H
Sbjct: 49  GHERVWV----CEVCEVSPAAVTCKADAAVLCAACDADIH 84



>gb:AY082960_1569218 Hordeum vulgare CONSTANS-like protein CO6 (CO6)
           gene, partial cds.
          Length = 357

 Score = 55.1 bits (131), Expect = 2e-06
 Identities = 24/45 (53%), Positives = 30/45 (66%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLA 279
           +C+VCE + A + C AD A LC ACD  +H  N LA RHVRV +A
Sbjct: 35  VCEVCEVSPAAVTCKADAAVLCAACDADIHHANPLAERHVRVPIA 79



 Score = 39.3 bits (90), Expect = 0.12
 Identities = 21/68 (30%), Positives = 32/68 (47%)
 Frame = +1

Query: 187 AADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAPAFFYCEVDGSSLC 366
           AA  A  CR C    ++C    +R       +  + V  C++CE +PA   C+ D + LC
Sbjct: 1   AAPAAVHCRDCAG--YLCTGCDARPAHARAGHERVWV--CEVCEVSPAAVTCKADAAVLC 56

Query: 367 LQCDMIVH 390
             CD  +H
Sbjct: 57  AACDADIH 64



>gb:AP003579_1831219 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0709F06.
          Length = 370

 Score = 53.5 bits (127), Expect = 6e-06
 Identities = 24/45 (53%), Positives = 29/45 (64%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLA 279
           +C+VCE A A + C AD A LC ACD  +H  N LA RH RV +A
Sbjct: 54  VCEVCEVAPAAVTCKADAAVLCAACDADIHDANPLARRHARVPVA 98



 Score = 47.0 bits (110), Expect = 6e-04
 Identities = 33/111 (29%), Positives = 47/111 (42%), Gaps = 3/111 (2%)
 Frame = +1

Query: 94  KLRNFWVG*SER*SMRTLCDVCESAAAILFC-AADEAALCRACDDKVHMCNKLASRHVRV 270
           +LR +W     R      C  CE++ A + C       LC ACD +        + H RV
Sbjct: 2   ELRKYWGVGGRR------CGACEASPAAVHCRGCGGVYLCTACDARP---GHARAAHERV 52

Query: 271 GLANPPIVVPRCDICENAPAFFYCEVDGSSLCLQCDMIVHVGG--KRTHSR 417
            +         C++CE APA   C+ D + LC  CD  +H      R H+R
Sbjct: 53  WV---------CEVCEVAPAAVTCKADAAVLCAACDADIHDANPLARRHAR 94



>gb:AP004993_1846903 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0037N01.
          Length = 481

 Score = 53.1 bits (126), Expect = 8e-06
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 2/53 (3%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGL--ANPPIVVP 300
           CD C    A  +CAAD+A LC+ CD  VH  N LA RH R+ L  ++PP +VP
Sbjct: 21  CDGCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHERLRLRPSSPPPLVP 73



>gb:AP005495_1852858 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OSJNBb0003H03.>gb:AP005799_1857996 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OSJNBa0012K14.
          Length = 180

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 27/44 (61%), Positives = 29/44 (65%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLA 279
           C VC  AA + +CAAD AALC  CD  VH  N LASRH RV LA
Sbjct: 18  CGVCGGAATV-YCAADAAALCVPCDAAVHAANPLASRHDRVPLA 60



>gb:BT015778_1642396 Arabidopsis thaliana At1g25440 mRNA, complete
           cds.
          Length = 417

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 26/51 (50%), Positives = 32/51 (62%), Gaps = 2/51 (3%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGL--ANPPIV 294
           CD C    A  +CAAD+A LC++CD  VH  N LA RH RV L  A+P +V
Sbjct: 17  CDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRLKTASPAVV 67



 Score = 35.0 bits (79), Expect = 2.3
 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 2/43 (4%)
 Frame = +1

Query: 304 CDICENAPAFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRYLL 426
           CD C    A +YC  D + LC  CD +VH      R H R  L
Sbjct: 17  CDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRL 59



>gb:AY093174_1575128 Arabidopsis thaliana unknown protein
           (At1g25440) mRNA, complete cds.
          Length = 417

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 26/51 (50%), Positives = 32/51 (62%), Gaps = 2/51 (3%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGL--ANPPIV 294
           CD C    A  +CAAD+A LC++CD  VH  N LA RH RV L  A+P +V
Sbjct: 17  CDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRLKTASPAVV 67



 Score = 35.0 bits (79), Expect = 2.3
 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 2/43 (4%)
 Frame = +1

Query: 304 CDICENAPAFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRYLL 426
           CD C    A +YC  D + LC  CD +VH      R H R  L
Sbjct: 17  CDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRL 59



>pir|E86384|E86384 probable zinc finger protein [imported] -
           Arabidopsis thaliana>gb:AE005172_891465 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC079281_1732448 Arabidopsis thaliana
           chromosome 1 BAC F2J7 genomic sequence, complete
           sequence.
          Length = 416

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 26/51 (50%), Positives = 32/51 (62%), Gaps = 2/51 (3%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGL--ANPPIV 294
           CD C    A  +CAAD+A LC++CD  VH  N LA RH RV L  A+P +V
Sbjct: 16  CDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRLKTASPAVV 66



 Score = 35.0 bits (79), Expect = 2.3
 Identities = 17/43 (39%), Positives = 20/43 (46%), Gaps = 2/43 (4%)
 Frame = +1

Query: 304 CDICENAPAFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRYLL 426
           CD C    A +YC  D + LC  CD +VH      R H R  L
Sbjct: 16  CDSCVKRRARWYCAADDAFLCQSCDSLVHSANPLARRHERVRL 58



>sp|Q9LJ44|COLC_ARATH Zinc finger protein constans-like
           12.>gb:AP000739_1820603 Arabidopsis thaliana genomic
           DNA, chromosome 3, P1 clone:MEK6.
          Length = 337

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 27/80 (33%), Positives = 39/80 (48%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDIC 315
           M   CD C ++ A+++C +D A LC  CD  VH  N L+ RH+R  +         C+ C
Sbjct: 1   MEPKCDHCATSQALIYCKSDLAKLCLNCDVHVHSANPLSHRHIRSLI---------CEKC 51

Query: 316 ENAPAFFYCEVDGSSLCLQC 375
            + PA   C  +  S C  C
Sbjct: 52  FSQPAAIRCLDEKVSYCQGC 71



 Score = 42.0 bits (97), Expect = 0.019
 Identities = 16/38 (42%), Positives = 22/38 (57%)
 Frame = +1

Query: 298 PRCDICENAPAFFYCEVDGSSLCLQCDMIVHVGGKRTH 411
           P+CD C  + A  YC+ D + LCL CD+ VH     +H
Sbjct: 3   PKCDHCATSQALIYCKSDLAKLCLNCDVHVHSANPLSH 40



>gb:AY084427_1569517 Arabidopsis thaliana clone 108109 mRNA,
           complete sequence.
          Length = 405

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 24/43 (55%), Positives = 26/43 (60%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGL 276
           CD C    A  +CAAD+A LC ACD  VH  N LA RH RV L
Sbjct: 16  CDSCVKRRARWYCAADDAFLCHACDGSVHSANPLARRHERVRL 58



>gb:AY054625_1563279 Arabidopsis thaliana putative B-box zinc finger
           protein (At1g68520; T26J14.9) mRNA, complete
           cds.>gb:AY081541_1568801 Arabidopsis thaliana putative
           B-box zinc finger protein (At1g68520) mRNA, complete
           cds.
          Length = 406

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 24/43 (55%), Positives = 26/43 (60%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGL 276
           CD C    A  +CAAD+A LC ACD  VH  N LA RH RV L
Sbjct: 17  CDSCVKRRARWYCAADDAFLCHACDGSVHSANPLARRHERVRL 59



>pir|D96709|D96709 probable B-box zinc finger protein T26J14.9
           [imported] - Arabidopsis thaliana>gb:AE005173_894473
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC011915_1537545 Arabidopsis thaliana
           chromosome 1 BAC T26J14 genomic sequence, complete
           sequence.
          Length = 405

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 24/43 (55%), Positives = 26/43 (60%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGL 276
           CD C    A  +CAAD+A LC ACD  VH  N LA RH RV L
Sbjct: 16  CDSCVKRRARWYCAADDAFLCHACDGSVHSANPLARRHERVRL 58



>gb:AY082964_1569222 Hordeum vulgare CONSTANS-like protein CO8 (CO8)
           gene, complete cds.
          Length = 247

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 27/44 (61%), Positives = 29/44 (65%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLA 279
           C VC  +AA L+C AD AALC  CD  VH  N LASRH RV LA
Sbjct: 15  CAVCGGSAA-LYCPADAAALCVPCDAAVHSANPLASRHERVPLA 57



>pir|JE0115|JE0115 zinc-finger protein S12569 [imported] -
           rice>gb:AB001887_1508680 Oryza sativa (japonica
           cultivar-group) cDNA for zinc finger protein, complete
           cds, clone:S12569.
          Length = 335

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 23/41 (56%), Positives = 24/41 (58%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           CD C SA    +C AD AALC  CD  VH  N LA RH RV
Sbjct: 15  CDSCRSAPCAFYCLADSAALCATCDADVHSVNPLARRHRRV 55



 Score = 42.7 bits (99), Expect = 0.011
 Identities = 17/35 (48%), Positives = 21/35 (60%)
 Frame = +1

Query: 286 PIVVPRCDICENAPAFFYCEVDGSSLCLQCDMIVH 390
           P +  RCD C +AP  FYC  D ++LC  CD  VH
Sbjct: 9   PGLPQRCDSCRSAPCAFYCLADSAALCATCDADVH 43



>gb:AY379532_1603828 Brassica rapa cultivar Tsoi-sim constans-like
           protein gene, partial cds.
          Length = 235

 Score = 51.2 bits (121), Expect = 3e-05
 Identities = 22/38 (57%), Positives = 25/38 (65%)
 Frame = +1

Query: 157 CESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           CE A A  FC AD A+LC ACD ++H  N LA RH RV
Sbjct: 2   CERAPAAFFCKADAASLCTACDSQIHSANPLARRHQRV 39



 Score = 41.6 bits (96), Expect = 0.025
 Identities = 26/100 (26%), Positives = 45/100 (45%), Gaps = 10/100 (10%)
 Frame = +1

Query: 313 CENAPAFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRYLLMRQRVEFPGDKAGQTEEPPR 486
           CE APA F+C+ D +SLC  CD  +H      R H R  ++        + + +T E   
Sbjct: 2   CERAPAAFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGSMVTNHSSETTEAED 61

Query: 487 LT---SDPGQQNHAAAAAVPVS-----DNTKDGHAKRENK 582
           +     +   +  AA+  +P S     DN  + +  ++N+
Sbjct: 62  IVVVGQEEEDEAEAASWLLPTSVKNCGDNNNNDNNSQDNR 101



>gb:AY379531_1603827 Brassica rapa cultivar Pachuca constans-like
           protein gene, partial cds.
          Length = 235

 Score = 51.2 bits (121), Expect = 3e-05
 Identities = 22/38 (57%), Positives = 25/38 (65%)
 Frame = +1

Query: 157 CESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRV 270
           CE A A  FC AD A+LC ACD ++H  N LA RH RV
Sbjct: 2   CERAPAAFFCKADAASLCTACDSQIHSANPLARRHQRV 39



 Score = 43.1 bits (100), Expect = 0.009
 Identities = 26/100 (26%), Positives = 46/100 (46%), Gaps = 10/100 (10%)
 Frame = +1

Query: 313 CENAPAFFYCEVDGSSLCLQCDMIVHVGG--KRTHSRYLLMRQRVEFPGDKAGQTEEPPR 486
           CE APA F+C+ D +SLC  CD  +H      R H R  ++        +++ +T E   
Sbjct: 2   CERAPAAFFCKADAASLCTACDSQIHSANPLARRHQRVPILPISGSMVTNRSSETTEAED 61

Query: 487 LT---SDPGQQNHAAAAAVPVS-----DNTKDGHAKRENK 582
           +     +   +  AA+  +P S     DN  + +  ++N+
Sbjct: 62  IVVVGQEEEDEAEAASWLLPTSVKNCGDNNNNNNNSQDNR 101



>gb:AP003992_1836053 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1077_E05.
          Length = 222

 Score = 50.1 bits (118), Expect = 7e-05
 Identities = 24/40 (60%), Positives = 27/40 (67%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVR 267
           C++C   AA+  CAAD A LC  CDDKVH  N LASRH R
Sbjct: 15  CELCGGVAAV-HCAADSAFLCLVCDDKVHGANFLASRHRR 53



 Score = 36.6 bits (83), Expect = 0.80
 Identities = 32/93 (34%), Positives = 40/93 (43%), Gaps = 3/93 (3%)
 Frame = +1

Query: 304 CDICENAPAFFYCEVDGSSLCLQCDMIVHVGGKRTHSRYLLMRQRVEF--PGDKAGQTEE 477
           C++C    A  +C  D + LCL CD  VH G     SR+   R  VE     D A  T  
Sbjct: 15  CELCGGVAAV-HCAADSAFLCLVCDDKVH-GANFLASRHRRRRLGVEVVDEEDDARSTAS 72

Query: 478 PPRL-TSDPGQQNHAAAAAVPVSDNTKDGHAKR 573
              + T+D      AAAAAV   D  + G   R
Sbjct: 73  SSCVSTADSASSTAAAAAAVESEDVRRRGRRGR 105



>gb:BT005302_1638242 Arabidopsis thaliana At1g49130 mRNA, complete
           cds.>gb:AK117367_1815406 Arabidopsis thaliana At1g49130
           mRNA for putative B-box zinc finger protein, complete
           cds, clone: RAFL16-93-N14.
          Length = 311

 Score = 50.1 bits (118), Expect = 7e-05
 Identities = 19/43 (44%), Positives = 30/43 (69%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGL 276
           C++C +  A+ +CA+D+A LC  CD+ VH  N +A++H RV L
Sbjct: 28  CELCLNKHAVWYCASDDAFLCHVCDESVHSANHVATKHERVCL 70



 Score = 33.5 bits (75), Expect = 6.8
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%)
 Frame = +1

Query: 253 SRHVRVGLANPPIVVPR-CDICENAPAFFYCEVDGSSLCLQCDMIVH 390
           S  + +      +  PR C++C N  A +YC  D + LC  CD  VH
Sbjct: 10  SEKIMISKYQEDVKQPRACELCLNKHAVWYCASDDAFLCHVCDESVH 56



>sp|Q9M9B3|COL4_ARATH Hypothetical zinc finger protein constans-like
           4.>pir|C96528|C96528 protein F27J15.10 [imported] -
           Arabidopsis thaliana>gb:AE005173_892853 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC016041_1538073 Genomic sequence for
           Arabidopsis thaliana BAC F27J15 from chromosome I,
           complete sequence.
          Length = 313

 Score = 50.1 bits (118), Expect = 7e-05
 Identities = 19/43 (44%), Positives = 30/43 (69%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGL 276
           C++C +  A+ +CA+D+A LC  CD+ VH  N +A++H RV L
Sbjct: 15  CELCLNKHAVWYCASDDAFLCHVCDESVHSANHVATKHERVCL 57



 Score = 33.1 bits (74), Expect = 8.8
 Identities = 13/29 (44%), Positives = 17/29 (58%)
 Frame = +1

Query: 304 CDICENAPAFFYCEVDGSSLCLQCDMIVH 390
           C++C N  A +YC  D + LC  CD  VH
Sbjct: 15  CELCLNKHAVWYCASDDAFLCHVCDESVH 43



>gb:AP005769_1857550 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0051O02.
          Length = 241

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 27/50 (54%), Positives = 32/50 (64%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVV 297
           C +C +AAA+  C AD A LC ACD KVH  N LASRH R  +A   +VV
Sbjct: 8   CALCGAAAAV-HCEADAAFLCAACDAKVHGANFLASRHHRRRVAAGAVVV 56



 Score = 33.5 bits (75), Expect = 6.8
 Identities = 27/91 (29%), Positives = 37/91 (40%)
 Frame = +1

Query: 301 RCDICENAPAFFYCEVDGSSLCLQCDMIVHVGGKRTHSRYLLMRQRVEFPGDKAGQTEEP 480
           RC +C  A A  +CE D + LC  CD  VH G     SR+   R+RV        + EE 
Sbjct: 7   RCALC-GAAAAVHCEADAAFLCAACDAKVH-GANFLASRH--HRRRVAAGAVVVVEVEEE 62

Query: 481 PRLTSDPGQQNHAAAAAVPVSDNTKDGHAKR 573
               S     +  +  +   SD      A+R
Sbjct: 63  EGYESGASAASSTSCVSTADSDVAASAAARR 93



>gb:PFA318337_1392297 Plasmodium falciparum krueppel1 gene for
           Krueppel-like protein.
          Length = 1266

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 25/80 (31%), Positives = 36/80 (45%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENA 324
           +C+ C S  AI +C  D+  LC  CD K H  NK+   H R+ ++  P    +C    N 
Sbjct: 283 VCEYCYSTKAITYCYNDKVHLCDICDIKHHEKNKILKNHKRIHISESPYQFGKCPYHINE 342

Query: 325 PAFFYCEVDGSSLCLQCDMI 384
                C     +LC  C +I
Sbjct: 343 LIESVCMKCFCTLCPSCILI 362



>gb:AE014187_938849 Plasmodium falciparum 3D7 chromosome 14 complete
           sequence.>gb:AE014822_1227925 Plasmodium falciparum 3D7
           chromosome 14 section 7 of 13 of the complete sequence.
          Length = 1291

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 25/80 (31%), Positives = 36/80 (45%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENA 324
           +C+ C S  AI +C  D+  LC  CD K H  NK+   H R+ ++  P    +C    N 
Sbjct: 283 VCEYCYSTKAITYCYNDKVHLCDICDIKHHEKNKILKNHKRIHISESPYQFGKCPYHINE 342

Query: 325 PAFFYCEVDGSSLCLQCDMI 384
                C     +LC  C +I
Sbjct: 343 LIESVCMKCFCTLCPSCILI 362



>pir|T02277|T02277 hypothetical protein T13D8.14 - Arabidopsis
           thaliana>gb:AE005173_893705 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:T13D8_1723403 Arabidopsis thaliana
           chromosome 1 BAC T13D8, complete sequence.
          Length = 251

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 24/80 (30%), Positives = 33/80 (41%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDIC 315
           M  +C  C    A++ C  +    C  CD+  H  N + + HVR  L         CD C
Sbjct: 1   MAQVCHTCRHVTAVIHCVTEALNFCLTCDNLRHH-NNIHAEHVRYQL---------CDNC 50

Query: 316 ENAPAFFYCEVDGSSLCLQC 375
              P+  +C  DG  LC  C
Sbjct: 51  SMYPSILFCYEDGMVLCQSC 70



>gb:AC087181_1733935 Oryza sativa chromosome 3 BAC OSJNBa0018H01
           genomic sequence, complete sequence.
          Length = 421

 Score = 47.8 bits (112), Expect = 3e-04
 Identities = 26/55 (47%), Positives = 30/55 (54%), Gaps = 3/55 (5%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGL---ANPPIVVPR 303
           CD C    A   C AD+A LC+ACD  VH  N LA RH RV L   ++ P   PR
Sbjct: 20  CDGCMRRRARWHCPADDAFLCQACDASVHSANPLARRHHRVRLPSASSSPASSPR 74



>gb:BT005244_1638184 Arabidopsis thaliana At3g21150 mRNA, complete
           cds.>gb:AK117844_1815854 Arabidopsis thaliana At3g21150
           mRNA for unknown protein, complete cds, clone:
           RAFL18-04-G04.>gb:AP000604_1820431 Arabidopsis thaliana
           genomic DNA, chromosome 3, P1 clone: MSA6.
          Length = 225

 Score = 47.4 bits (111), Expect = 5e-04
 Identities = 25/57 (43%), Positives = 32/57 (56%)
 Frame = +1

Query: 136 MRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRC 306
           M + C++C  A A L CAAD A LCR+CD K H  N L +RH R       ++ P C
Sbjct: 1   MVSFCELC-GAEADLHCAADSAFLCRSCDAKFHASNFLFARHFR------RVICPNC 50



>gb:AB028622_1518072 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone:MZN24.>gb:AY086564_1571611 Arabidopsis thaliana
           clone 258241 mRNA, complete sequence.
          Length = 121

 Score = 47.4 bits (111), Expect = 5e-04
 Identities = 24/47 (51%), Positives = 30/47 (63%)
 Frame = +1

Query: 127 R*SMRTLCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVR 267
           R S+   C++C+  A++ FC AD A LCR CD  VH  N LA RHVR
Sbjct: 24  RPSVPVRCELCDGDASV-FCEADSAFLCRKCDRWVHGANFLAWRHVR 69



 Score = 35.8 bits (81), Expect = 1.4
 Identities = 16/39 (41%), Positives = 22/39 (56%)
 Frame = +1

Query: 274 LANPPIVVPRCDICENAPAFFYCEVDGSSLCLQCDMIVH 390
           L   P V  RC++C+   + F CE D + LC +CD  VH
Sbjct: 21  LCTRPSVPVRCELCDGDASVF-CEADSAFLCRKCDRWVH 58



>pir|C96766|C96766 hypothetical protein F2P9.26 [imported] -
           Arabidopsis thaliana>gb:AE005173_894933 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC016662_1538238 Arabidopsis thaliana
           chromosome 1 BAC F2P9 genomic sequence, complete
           sequence.>gb:BT015740_1642358 Arabidopsis thaliana
           At1g73870 mRNA, complete cds.>gb:BT020183_1642578
           Arabidopsis thaliana At1g73870 mRNA, complete cds.
          Length = 392

 Score = 47.0 bits (110), Expect = 6e-04
 Identities = 21/44 (47%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = +1

Query: 148 CDVC-ESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGL 276
           CD C + + A  +C AD+A LC++CD  +H  N LA RH RV L
Sbjct: 22  CDACMKRSRASWYCPADDAFLCQSCDASIHSANHLAKRHERVRL 65



>gb:AY740087_1626180 Ostreococcus tauri CONSTANS-like protein gene,
           complete cds.
          Length = 406

 Score = 46.6 bits (109), Expect = 8e-04
 Identities = 23/43 (53%), Positives = 27/43 (62%), Gaps = 3/43 (6%)
 Frame = +1

Query: 148 CDVCESAAA---ILFCAADEAALCRACDDKVHMCNKLASRHVR 267
           C+ C +AAA     FCA DEA LC ACD  VH  N +AS+H R
Sbjct: 10  CESCPTAAARAATWFCAQDEAYLCDACDAMVHAANGIASKHER 52



>pir|T05755|T05755 hypothetical protein M4I22.120 - Arabidopsis
           thaliana>gb:ATCHRIV66_1546612 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 66.>gb:ATM4I22_1553667
           Arabidopsis thaliana DNA chromosome 4, P1 clone M4I22
           (ESSA project).
          Length = 223

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 27/89 (30%), Positives = 42/89 (47%), Gaps = 3/89 (3%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD+C   A  ++C +D+A+LC  CD KVH  N L ++H R  L         C  C++  
Sbjct: 5   CDLCNGVAR-MYCESDQASLCWDCDGKVHGANFLVAKHTRCLL---------CSACQSLT 54

Query: 328 AFFYCEV---DGSSLCLQCDMIVHVGGKR 405
            +    +      S+C  C  + + GG R
Sbjct: 55  PWKATGLRLGPTFSVCESCVALKNAGGGR 83



>gb:AY070721_1566873 Arabidopsis thaliana AT4g27310/M4I22_120 mRNA,
           complete cds.
          Length = 223

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 27/89 (30%), Positives = 42/89 (47%), Gaps = 3/89 (3%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD+C   A  ++C +D+A+LC  CD KVH  N L ++H R  L         C  C++  
Sbjct: 5   CDLCNGVAR-MYCESDQASLCWDCDGKVHGANFLLAKHTRCLL---------CSACQSLT 54

Query: 328 AFFYCEV---DGSSLCLQCDMIVHVGGKR 405
            +    +      S+C  C  + + GG R
Sbjct: 55  PWKATGLRLGPTFSVCESCVALKNAGGGR 83



>gb:AP005284_1849824 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:B1121A12.>gb:AP005751_1857155 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0072H09.
          Length = 104

 Score = 43.5 bits (101), Expect = 0.007
 Identities = 18/35 (51%), Positives = 21/35 (60%)
 Frame = +1

Query: 157 CESAAAILFCAADEAALCRACDDKVHMCNKLASRH 261
           C   A++L C AD  ALC  CD +VH  N LA RH
Sbjct: 57  CTPQASVLACCADAVALCTTCDAEVHSANPLAQRH 91



>gb:CEZK1320_1371513 Caenorhabditis elegans cosmid ZK1320, complete
           sequence.
          Length = 539

 Score = 42.7 bits (99), Expect = 0.011
 Identities = 30/121 (24%), Positives = 53/121 (43%), Gaps = 12/121 (9%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD      A+++C   ++ LC  C +  H  N L S+H R+ L   P  +  C +  +  
Sbjct: 108 CDEDSEHVAVIYCTVCDSNLCERCSESTHSTNVL-SKHRRIPLTEKPPPLVHCRLHSSYV 166

Query: 328 AFFY-----CEVDGSSLCLQCDMIVHVGGKRTHSRYLL------MRQRV-EFPGDKAGQT 471
             F      C+ +   +C+ C      G  + HS  L+      +R++V E  G+ + Q+
Sbjct: 167 VEFVCKELSCDTESPLMCMMCR---DYGRHKGHSHVLIEKEVEDLREKVREHLGELSKQS 223

Query: 472 E 474
           E
Sbjct: 224 E 224



>sp|Q09654|ARD1_CAEEL Putative GTP-binding protein ARD-1 homolog.
          Length = 543

 Score = 42.7 bits (99), Expect = 0.011
 Identities = 30/121 (24%), Positives = 53/121 (43%), Gaps = 12/121 (9%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD      A+++C   ++ LC  C +  H  N L S+H R+ L   P  +  C +  +  
Sbjct: 112 CDEDSEHVAVIYCTVCDSNLCERCSESTHSTNVL-SKHRRIPLTEKPPPLVHCRLHSSYV 170

Query: 328 AFFY-----CEVDGSSLCLQCDMIVHVGGKRTHSRYLL------MRQRV-EFPGDKAGQT 471
             F      C+ +   +C+ C      G  + HS  L+      +R++V E  G+ + Q+
Sbjct: 171 VEFVCKELSCDTESPLMCMMCR---DYGRHKGHSHVLIEKEVEDLREKVREHLGELSKQS 227

Query: 472 E 474
           E
Sbjct: 228 E 228



>gb:AP002842_1823072 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0075G19.
          Length = 232

 Score = 42.4 bits (98), Expect = 0.015
 Identities = 24/76 (31%), Positives = 31/76 (40%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           C +C     ++FC A    LC  CD  +H  +  A  H R          P CD C  A 
Sbjct: 9   CQLCGGRRGVVFCGAHGGRLCLQCDRALHQAHGGAGDHPR---------APLCDSCNAAA 59

Query: 328 AFFYCEVDGSSLCLQC 375
           A      DG++LC  C
Sbjct: 60  AELRLN-DGATLCGPC 74



 Score = 33.9 bits (76), Expect = 5.2
 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 2/40 (5%)
 Frame = +1

Query: 304 CDICENAPAFFYCEVDGSSLCLQCDMIVHV--GGKRTHSR 417
           C +C       +C   G  LCLQCD  +H   GG   H R
Sbjct: 9   CQLCGGRRGVVFCGAHGGRLCLQCDRALHQAHGGAGDHPR 48



>gb:BT012358_1641509 Arabidopsis thaliana At5g54470 mRNA, complete
           cds.
          Length = 215

 Score = 41.6 bits (96), Expect = 0.025
 Identities = 17/40 (42%), Positives = 27/40 (67%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVR 267
           C++C    A ++C +D+A+LC  CD KVH  N L ++H+R
Sbjct: 6   CELC-CGVARMYCESDQASLCWDCDGKVHGANFLVAKHMR 44



>gb:AB026634_1517041 Arabidopsis thaliana genomic DNA, chromosome 5,
           BAC clone:F24B18.
          Length = 229

 Score = 41.6 bits (96), Expect = 0.025
 Identities = 17/40 (42%), Positives = 27/40 (67%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVR 267
           C++C    A ++C +D+A+LC  CD KVH  N L ++H+R
Sbjct: 6   CELC-CGVARMYCESDQASLCWDCDGKVHGANFLVAKHMR 44



>gb:CNS07EGF_1373787 chromosome VIII of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 462

 Score = 39.7 bits (91), Expect = 0.094
 Identities = 16/41 (39%), Positives = 24/41 (58%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVR 267
           +CD C    ++ FC A+ A+ C  CD++VH  +    RHVR
Sbjct: 192 ICDRCRMNQSVSFCPAERASFCAECDEEVH-SDHFLKRHVR 231



>gb:AB046809_1867448 Homo sapiens mRNA for KIAA1589 protein, partial
           cds.
          Length = 816

 Score = 39.3 bits (90), Expect = 0.12
 Identities = 28/90 (31%), Positives = 41/90 (45%), Gaps = 10/90 (11%)
 Frame = +1

Query: 172 AILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP-------- 327
           AI  C    +  C  C++++H   +L + H R+ L   P  VP CD+C+           
Sbjct: 69  AIFECDECCSLQCLRCEEELHRQERLRN-HERIRLK--PGHVPYCDLCKGLSGHLPGVRQ 125

Query: 328 -AFFYCEVDGSSLCLQCDMIVHVGG-KRTH 411
            A   C+    +LCL+C    H GG KR H
Sbjct: 126 RAIVRCQTCKINLCLECQKRTHSGGNKRRH 155



>gb:AX884055_1479587 Sequence 18960 from Patent
           EP1074617.>gb:AK027399_1910946 Homo sapiens cDNA
           FLJ14493 fis, clone MAMMA1002972.
          Length = 759

 Score = 39.3 bits (90), Expect = 0.12
 Identities = 28/90 (31%), Positives = 41/90 (45%), Gaps = 10/90 (11%)
 Frame = +1

Query: 172 AILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP-------- 327
           AI  C    +  C  C++++H   +L + H R+ L   P  VP CD+C+           
Sbjct: 30  AIFECDECCSLQCLRCEEELHRQERLRN-HERIRLK--PGHVPYCDLCKGLSGHLPGVRQ 86

Query: 328 -AFFYCEVDGSSLCLQCDMIVHVGG-KRTH 411
            A   C+    +LCL+C    H GG KR H
Sbjct: 87  RAIVRCQTCKINLCLECQKRTHSGGNKRRH 116



>gb:CR857141_1181391 Pongo pygmaeus mRNA; cDNA DKFZp469G0722 (from
           clone DKFZp469G0722).
          Length = 789

 Score = 39.3 bits (90), Expect = 0.12
 Identities = 28/90 (31%), Positives = 41/90 (45%), Gaps = 10/90 (11%)
 Frame = +1

Query: 172 AILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP-------- 327
           AI  C    +  C  C++++H   +L + H R+ L   P  VP CD+C+           
Sbjct: 30  AIFECDECCSLQCLRCEEELHRQERLRN-HERIRLK--PGHVPYCDLCKGLSGHLPGVRQ 86

Query: 328 -AFFYCEVDGSSLCLQCDMIVHVGG-KRTH 411
            A   C+    +LCL+C    H GG KR H
Sbjct: 87  RAIVRCQTCKINLCLECQKRTHSGGNKRRH 116



>sp|Q9HBF4|ZEY1_HUMAN Zinc finger FYVE domain containing protein 1
           (Double FYVE-containing protein 1) (Tandem FYVE
           fingers-1) (SR3) (pp10436).>gb:AX394539_1466910 Sequence
           7 from Patent WO0218946.>gb:AF251025_1892977 Homo
           sapiens double FYVE-containing protein 1 mRNA, complete
           cds.>gb:BC053520_1984947 Homo sapiens zinc finger, FYVE
           domain containing 1, transcript variant 1, mRNA (cDNA
           clone MGC:51992 IMAGE:5493027), complete
           cds.>gb:HSA310569_2003845 Homo sapiens mRNA for
           phosphoinositide-binding protein, isolate SR3.
          Length = 777

 Score = 39.3 bits (90), Expect = 0.12
 Identities = 28/90 (31%), Positives = 41/90 (45%), Gaps = 10/90 (11%)
 Frame = +1

Query: 172 AILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP-------- 327
           AI  C    +  C  C++++H   +L + H R+ L   P  VP CD+C+           
Sbjct: 30  AIFECDECCSLQCLRCEEELHRQERLRN-HERIRLK--PGHVPYCDLCKGLSGHLPGVRQ 86

Query: 328 -AFFYCEVDGSSLCLQCDMIVHVGG-KRTH 411
            A   C+    +LCL+C    H GG KR H
Sbjct: 87  RAIVRCQTCKINLCLECQKRTHSGGNKRRH 116



>gb:AP004752_1844387 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0501G04.
          Length = 454

 Score = 38.5 bits (88), Expect = 0.21
 Identities = 24/77 (31%), Positives = 30/77 (38%), Gaps = 1/77 (1%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAA-LCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENA 324
           CD C    A++ CA    A LC  CD        LA+ H     A+     P CD C  A
Sbjct: 39  CDSCRGERAVVHCAQHGGARLCLVCD--------LAAHHAAAARAHRR--APLCDACHAA 88

Query: 325 PAFFYCEVDGSSLCLQC 375
           PA    +    + C  C
Sbjct: 89  PAVARSDHHAEAFCASC 105



 Score = 35.8 bits (81), Expect = 1.4
 Identities = 18/44 (40%), Positives = 22/44 (50%), Gaps = 2/44 (4%)
 Frame = +1

Query: 292 VVPRCDICENAPAFFYC-EVDGSSLCLQCDMIV-HVGGKRTHSR 417
           VVP CD C    A  +C +  G+ LCL CD+   H    R H R
Sbjct: 35  VVPSCDSCRGERAVVHCAQHGGARLCLVCDLAAHHAAAARAHRR 78



>gb:AK129400_2069631 Mus musculus mRNA for mKIAA1589 protein.
          Length = 774

 Score = 37.4 bits (85), Expect = 0.47
 Identities = 32/119 (26%), Positives = 56/119 (47%), Gaps = 12/119 (10%)
 Frame = +1

Query: 172 AILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICE----NAP---- 327
           AI  C    +  C  C++++H   +L + H R+ L      VP CD C+    ++P    
Sbjct: 30  AIFECDECCSLQCLRCEEELHRQERLRN-HERIRLKAGH--VPYCDPCKGPNGHSPGVRQ 86

Query: 328 -AFFYCEVDGSSLCLQCDMIVHVGG-KRTH--SRYLLMRQRVEFPGDKAGQTEEPPRLT 492
            A   C+    +LCL+C    H GG KR H  + YL+ + +    G++  +  +  ++T
Sbjct: 87  RAAVRCQTCKINLCLECQKRTHSGGNKRRHPITVYLVSKVQESLEGEEMDEETKRKKMT 145



>sp|Q810J8|ZEY1_MOUSE Zinc finger FYVE domain containing protein
           1.>gb:BC050015_2100318 Mus musculus zinc finger, FYVE
           domain containing 1, mRNA (cDNA clone MGC:60726
           IMAGE:30016571), complete cds.
          Length = 777

 Score = 37.4 bits (85), Expect = 0.47
 Identities = 32/119 (26%), Positives = 56/119 (47%), Gaps = 12/119 (10%)
 Frame = +1

Query: 172 AILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICE----NAP---- 327
           AI  C    +  C  C++++H   +L + H R+ L      VP CD C+    ++P    
Sbjct: 30  AIFECDECCSLQCLRCEEELHRQERLRN-HERIRLKAGH--VPYCDPCKGPNGHSPGVRQ 86

Query: 328 -AFFYCEVDGSSLCLQCDMIVHVGG-KRTH--SRYLLMRQRVEFPGDKAGQTEEPPRLT 492
            A   C+    +LCL+C    H GG KR H  + YL+ + +    G++  +  +  ++T
Sbjct: 87  RAAVRCQTCKINLCLECQKRTHSGGNKRRHPITVYLVSKVQESLEGEEMDEETKRKKMT 145



>gb:BC077512_2560220 Xenopus laevis tripartite motif-containing 23,
           mRNA (cDNA clone MGC:82681 IMAGE:5073937), complete cds.
          Length = 588

 Score = 35.0 bits (79), Expect = 2.3
 Identities = 27/94 (28%), Positives = 36/94 (38%), Gaps = 1/94 (1%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD  E+  A ++C      LC  C    H    LA +H RV LA+ P     C   +   
Sbjct: 141 CDEDEAHMASVYCTVCATHLCADCSLHTHSTKTLA-KHRRVPLADKPYEKTLCSQHQVHA 199

Query: 328 AFFYCEVDGSSLC-LQCDMIVHVGGKRTHSRYLL 426
             F C  DG     L C +    G  + H   +L
Sbjct: 200 IEFVCLEDGCQTSPLMCCVCKEYGKHQGHKHAVL 233



>gb:BC088392_2565609 Danio rerio cDNA clone IMAGE:7048578, partial
           cds.
          Length = 510

 Score = 34.7 bits (78), Expect = 3.0
 Identities = 24/96 (25%), Positives = 41/96 (42%), Gaps = 2/96 (2%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICE-- 318
           +CD+CE   A+  C   +++ C     + H+   L    ++      P+      IC+  
Sbjct: 91  VCDLCEDRTAVKSCLVCQSSYC-----ETHLQPHLKVTGLKKHKLMHPVSNLEDYICQTH 145

Query: 319 NAPAFFYCEVDGSSLCLQCDMIVHVGGKRTHSRYLL 426
             P   +C  D  S+CL C +  H    +TH+  LL
Sbjct: 146 QRPLELFCRDDHMSVCLHCAVTDH----KTHNTVLL 177



>gb:AF230399_1891679 Homo sapiens tripartite motif protein TRIM23
           gamma mRNA, complete cds.
          Length = 546

 Score = 34.7 bits (78), Expect = 3.0
 Identities = 26/94 (27%), Positives = 36/94 (38%), Gaps = 1/94 (1%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD  E+  A ++C      LC  C    H    LA +H RV LA+ P     C   +   
Sbjct: 127 CDEDEAHLASVYCTVCATHLCSECSQVTHSTKTLA-KHRRVPLADKPHEKTMCSQHQVHA 185

Query: 328 AFFYCEVDGSSLC-LQCDMIVHVGGKRTHSRYLL 426
             F C  +G     L C +    G  + H   +L
Sbjct: 186 IEFVCLEEGCQTSPLMCCVCKEYGKHQGHKHSVL 219



>gb:AF230398_1891678 Homo sapiens tripartite motif protein TRIM23
           beta mRNA, complete cds.
          Length = 569

 Score = 34.7 bits (78), Expect = 3.0
 Identities = 26/94 (27%), Positives = 36/94 (38%), Gaps = 1/94 (1%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD  E+  A ++C      LC  C    H    LA +H RV LA+ P     C   +   
Sbjct: 127 CDEDEAHLASVYCTVCATHLCSECSQVTHSTKTLA-KHRRVPLADKPHEKTMCSQHQVHA 185

Query: 328 AFFYCEVDGSSLC-LQCDMIVHVGGKRTHSRYLL 426
             F C  +G     L C +    G  + H   +L
Sbjct: 186 IEFVCLEEGCQTSPLMCCVCKEYGKHQGHKHSVL 219



>pir|A46054|A46054 GTP-binding protein ARD 1 - human
          Length = 574

 Score = 34.7 bits (78), Expect = 3.0
 Identities = 26/94 (27%), Positives = 36/94 (38%), Gaps = 1/94 (1%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD  E+  A ++C      LC  C    H    LA +H RV LA+ P     C   +   
Sbjct: 127 CDEDEAHLASVYCTVCATHLCSECSQVTHSTKTLA-KHRRVPLADKPHEKTMCSQHQVHA 185

Query: 328 AFFYCEVDGSSLC-LQCDMIVHVGGKRTHSRYLL 426
             F C  +G     L C +    G  + H   +L
Sbjct: 186 IEFVCLEEGCQTSPLMCCVCKEYGKHQGHKHSVL 219



>sp|P36406|ARD1_HUMAN GTP-binding protein ARD-1 (ADP-ribosylation
           factor domain protein 1) (Tripartite motif protein 23)
           (RING finger protein 46).>gb:AF230397_1891677 Homo
           sapiens tripartite motif protein TRIM23 alpha mRNA,
           complete cds.>gb:BC022510_1977919 Homo sapiens
           tripartite motif-containing 23, transcript variant
           alpha, mRNA (cDNA clone MGC:26543 IMAGE:4811707),
           complete cds.>gb:HUMGUABIND_2031729 Human nucleotide
           binding protein mRNA, complete cds.
          Length = 574

 Score = 34.7 bits (78), Expect = 3.0
 Identities = 26/94 (27%), Positives = 36/94 (38%), Gaps = 1/94 (1%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD  E+  A ++C      LC  C    H    LA +H RV LA+ P     C   +   
Sbjct: 127 CDEDEAHLASVYCTVCATHLCSECSQVTHSTKTLA-KHRRVPLADKPHEKTMCSQHQVHA 185

Query: 328 AFFYCEVDGSSLC-LQCDMIVHVGGKRTHSRYLL 426
             F C  +G     L C +    G  + H   +L
Sbjct: 186 IEFVCLEEGCQTSPLMCCVCKEYGKHQGHKHSVL 219



>gb:A93469_1451286 Sequence 1 from Patent
           WO9740180.>gb:AAU46933_2155117 Avian adenovirus CELO,
           complete genome.
          Length = 131

 Score = 34.3 bits (77), Expect = 4.0
 Identities = 18/55 (32%), Positives = 25/55 (45%)
 Frame = +1

Query: 373 CDMIVHVGGKRTHSRYLLMRQRVEFPGDKAGQTEEPPRLTSDPGQQNHAAAAAVP 537
           C +I     KRTH    ++ Q  E P     Q  EPP LT +PG    +  + +P
Sbjct: 74  CAVIARPINKRTHIGIHVLNQNNELPAIFTIQYPEPPHLTDNPGAVRKSQKSLIP 128



>gb:LMFL5213T_1388161 Leishmania major Friedlin cosmid L5213T.
          Length = 983

 Score = 34.3 bits (77), Expect = 4.0
 Identities = 14/30 (46%), Positives = 18/30 (60%)
 Frame = +1

Query: 145 LCDVCESAAAILFCAADEAALCRACDDKVH 234
           LCDVCE   A + C++ +AA C  CD   H
Sbjct: 385 LCDVCEVEVAGVMCSSCKAAFCAGCDRARH 414



>pir|S33494|S33494 hypothetical 14.4K protein - fowl adenovirus
           1>gb:AAORFSA_2155081 Fowl adenovirus 1 DNA fragment.
          Length = 128

 Score = 34.3 bits (77), Expect = 4.0
 Identities = 18/55 (32%), Positives = 25/55 (45%)
 Frame = +1

Query: 373 CDMIVHVGGKRTHSRYLLMRQRVEFPGDKAGQTEEPPRLTSDPGQQNHAAAAAVP 537
           C +I     KRTH    ++ Q  E P     Q  EPP LT +PG    +  + +P
Sbjct: 71  CAVIARPINKRTHIGIHVLNQNNELPAIFTIQYPEPPHLTDNPGAVRKSQKSLIP 125



>gb:AY118719_1300441 Drosophila melanogaster AT29177 full insert
           cDNA.
          Length = 512

 Score = 33.9 bits (76), Expect = 5.2
 Identities = 29/128 (22%), Positives = 46/128 (35%), Gaps = 1/128 (0%)
 Frame = -1

Query: 613 SWLVSYSNRSFYSPSWHDHL*CYLKPEQXXXXXXXXXXXXXSAAAAPPSAQLYLPGTQLS 434
           S+ + + +   YS S H        P+Q              +  + PS+ L   GT   
Sbjct: 366 SYQMQHDDSGLYSASSHT-----TSPQQQQQQQLQQSQRGVGSNVSAPSSSLTSTGTDQQ 420

Query: 433 ASSEDIYYGFFCPQHAQSYHIADTENSHP-PHSKKKQVHFHKYRSEEQQSAD*LTQLLHV 257
           A      +     Q  Q +H      +HP PHS     H H + +  Q S++  T   + 
Sbjct: 421 AVHPSSCHQQQQQQQQQHHH------AHPHPHSHHHHHHHHHHETAHQHSSEVWTPASYT 474

Query: 256 YLQAYYTY 233
               Y+TY
Sbjct: 475 QYSQYFTY 482



>gb:AF050630_1236631 Drosophila melanogaster Ahr homolog spineless
            (ss) mRNA, complete cds.
          Length = 884

 Score = 33.9 bits (76), Expect = 5.2
 Identities = 29/128 (22%), Positives = 46/128 (35%), Gaps = 1/128 (0%)
 Frame = -1

Query: 613  SWLVSYSNRSFYSPSWHDHL*CYLKPEQXXXXXXXXXXXXXSAAAAPPSAQLYLPGTQLS 434
            S+ + + +   YS S H        P+Q              +  + PS+ L   GT   
Sbjct: 738  SYQMQHDDSGLYSASSHT-----TSPQQQQQQQLQQSQRGVGSNVSAPSSSLTSTGTDQQ 792

Query: 433  ASSEDIYYGFFCPQHAQSYHIADTENSHP-PHSKKKQVHFHKYRSEEQQSAD*LTQLLHV 257
            A      +     Q  Q +H      +HP PHS     H H + +  Q S++  T   + 
Sbjct: 793  AVHPSSCHQQQQQQQQQHHH------AHPHPHSHHHHHHHHHHETAHQHSSEVWTPASYT 846

Query: 256  YLQAYYTY 233
                Y+TY
Sbjct: 847  QYSQYFTY 854



>gb:AE014297_1139880 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003713_1221873 Drosophila melanogaster
            chromosome 3R, section 51 of 118 of the complete
            sequence.
          Length = 884

 Score = 33.9 bits (76), Expect = 5.2
 Identities = 29/128 (22%), Positives = 46/128 (35%), Gaps = 1/128 (0%)
 Frame = -1

Query: 613  SWLVSYSNRSFYSPSWHDHL*CYLKPEQXXXXXXXXXXXXXSAAAAPPSAQLYLPGTQLS 434
            S+ + + +   YS S H        P+Q              +  + PS+ L   GT   
Sbjct: 738  SYQMQHDDSGLYSASSHT-----TSPQQQQQQQLQQSQRGVGSNVSAPSSSLTSTGTDQQ 792

Query: 433  ASSEDIYYGFFCPQHAQSYHIADTENSHP-PHSKKKQVHFHKYRSEEQQSAD*LTQLLHV 257
            A      +     Q  Q +H      +HP PHS     H H + +  Q S++  T   + 
Sbjct: 793  AVHPSSCHQQQQQQQQQHHH------AHPHPHSHHHHHHHHHHETAHQHSSEVWTPASYT 846

Query: 256  YLQAYYTY 233
                Y+TY
Sbjct: 847  QYSQYFTY 854



>gb:AK030862_1162203 Mus musculus adult male thymus cDNA, RIKEN
           full-length enriched library, clone:5830434A16
           product:tripartite motif protein 23, full insert
           sequence.
          Length = 554

 Score = 33.5 bits (75), Expect = 6.8
 Identities = 26/94 (27%), Positives = 36/94 (38%), Gaps = 1/94 (1%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD  E+  A ++C      LC  C    H    LA +H RV LA+ P     C   +   
Sbjct: 107 CDEDEAHVASVYCTVCATHLCSDCSQVTHSTKTLA-KHRRVPLADKPHEKTMCCQHQVHA 165

Query: 328 AFFYCEVDGSSLC-LQCDMIVHVGGKRTHSRYLL 426
             F C  +G     L C +    G  + H   +L
Sbjct: 166 IEFVCLEEGCQTSPLMCCVCKEYGKHQGHKHSVL 199



>gb:AK030843_1162199 Mus musculus adult male thymus cDNA, RIKEN
           full-length enriched library, clone:5830424K19
           product:tripartite motif protein 23, full insert
           sequence.
          Length = 574

 Score = 33.5 bits (75), Expect = 6.8
 Identities = 26/94 (27%), Positives = 36/94 (38%), Gaps = 1/94 (1%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD  E+  A ++C      LC  C    H    LA +H RV LA+ P     C   +   
Sbjct: 127 CDEDEAHVASVYCTVCATHLCSDCSQVTHSTKTLA-KHRRVPLADKPHEKTMCCQHQVHA 185

Query: 328 AFFYCEVDGSSLC-LQCDMIVHVGGKRTHSRYLL 426
             F C  +G     L C +    G  + H   +L
Sbjct: 186 IEFVCLEEGCQTSPLMCCVCKEYGKHQGHKHSVL 219



>sp|Q8BGX0|ARD1_MOUSE GTP-binding protein ARD-1 (ADP-ribosylation
           factor domain protein 1) (Tripartite motif protein
           23).>gb:AK039280_1165349 Mus musculus adult male spinal
           cord cDNA, RIKEN full-length enriched library,
           clone:A330013P18 product:tripartite motif protein 23,
           full insert sequence.>gb:AK042070_1166198 Mus musculus 3
           days neonate thymus cDNA, RIKEN full-length enriched
           library, clone:A630056A06 product:tripartite motif
           protein 23, full insert sequence.>gb:BC056390_2102362
           Mus musculus tripartite motif protein 23, mRNA (cDNA
           clone MGC:73426 IMAGE:6854944), complete
           cds.>gb:BC059017_2103579 Mus musculus tripartite motif
           protein 23, mRNA (cDNA clone MGC:69677 IMAGE:6848690),
           complete cds.
          Length = 574

 Score = 33.5 bits (75), Expect = 6.8
 Identities = 26/94 (27%), Positives = 36/94 (38%), Gaps = 1/94 (1%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCRACDDKVHMCNKLASRHVRVGLANPPIVVPRCDICENAP 327
           CD  E+  A ++C      LC  C    H    LA +H RV LA+ P     C   +   
Sbjct: 127 CDEDEAHVASVYCTVCATHLCSDCSQVTHSTKTLA-KHRRVPLADKPHEKTMCCQHQVHA 185

Query: 328 AFFYCEVDGSSLC-LQCDMIVHVGGKRTHSRYLL 426
             F C  +G     L C +    G  + H   +L
Sbjct: 186 IEFVCLEEGCQTSPLMCCVCKEYGKHQGHKHSVL 219



>gb:AB062929_1868937 Macaca fascicularis brain cDNA
           clone:QccE-21536, full insert sequence.
          Length = 100

 Score = 33.1 bits (74), Expect = 8.8
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 2/45 (4%)
 Frame = -3

Query: 467 CPAL--SPGNSTLCLIRRYLLWVLLPPTCTIISHCRHRELPSTSQ 339
           CPAL  SPG    C   +    +L+   C I+ +CR  E PS+ +
Sbjct: 8   CPALDISPGEMKTCFHTKACTQMLIAAFCIIVPNCRQPECPSSGE 52



>pir|T27752|T27752 hypothetical protein ZK1320.6 - Caenorhabditis
           elegans
          Length = 557

 Score = 33.1 bits (74), Expect = 8.8
 Identities = 30/135 (22%), Positives = 53/135 (39%), Gaps = 26/135 (19%)
 Frame = +1

Query: 148 CDVCESAAAILFCAADEAALCR--------------ACDDKVHMCNKLASRHVRVGLANP 285
           CD      A+++C   ++ LC                C +  H  N L S+H R+ L   
Sbjct: 112 CDEDSEHVAVIYCTVCDSNLCERKINCPKNLTKLVSRCSESTHSTNVL-SKHRRIPLTEK 170

Query: 286 PIVVPRCDICENAPAFFY-----CEVDGSSLCLQCDMIVHVGGKRTHSRYLL------MR 432
           P  +  C +  +    F      C+ +   +C+ C      G  + HS  L+      +R
Sbjct: 171 PPPLVHCRLHSSYVVEFVCKELSCDTESPLMCMMCR---DYGRHKGHSHVLIEKEVEDLR 227

Query: 433 QRV-EFPGDKAGQTE 474
           ++V E  G+ + Q+E
Sbjct: 228 EKVREHLGELSKQSE 242


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 922,396,185
Number of Sequences: 1806583
Number of extensions: 18001692
Number of successful extensions: 46726
Number of sequences better than 10.0: 160
Number of HSP's better than 10.0 without gapping: 43914
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46451
length of database: 581,917,975
effective HSP length: 125
effective length of database: 356,095,100
effective search space used: 73711685700
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)