BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig6254
         (1244 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB020749_1514639 Arabidopsis thaliana genomic DNA, chromosome...   300   3e-80   
gb:AY088158_1573180 Arabidopsis thaliana clone 42155 mRNA, compl...   213   5e-54   
pir|T02911|T02911 hypothetical protein T13J8.210 - Arabidopsis t...   213   5e-54   Arabidopsis thaliana [mouse-ear cress]
gb:AP005195_1849228 Oryza sativa (japonica cultivar-group) genom...   186   9e-46   
gb:AP003983_1835899 Oryza sativa (japonica cultivar-group) genom...   164   5e-39   
gb:AP004688_1843418 Oryza sativa (japonica cultivar-group) genom...   131   3e-29   
gb:AF466203_1802276 Zea mays clone ZMBBb_0092E12, partial sequence.    39   0.29    
gb:TAU73214_1724765 Triticum aestivum cold acclimation protein W...    37   1.1     
pir|T06806|T06806 proline rich protein homolog WCOR518 - wheat (...    37   1.1     Triticum aestivum [Canadian hard winter wheat]
gb:CNS07EGC_1373246 chromosome V of strain GB-M1 of Encephalitoz...    30   1.4     
gb:CNS07EGA_1372914 chromosome III of strain GB-M1 of Encephalit...    30   1.5     
gb:CNS06C8G_1372602 chromosome I of strain GB-M1 of Encephalitoz...    30   1.5     
gb:AP005467_1852348 Oryza sativa (japonica cultivar-group) genom...    36   1.9     
gb:AF466203_1802274 Zea mays clone ZMBBb_0092E12, partial sequence.    36   1.9     
gb:AF466203_1802273 Zea mays clone ZMBBb_0092E12, partial sequence.    36   1.9     
gb:AB025624_1516458 Arabidopsis thaliana genomic DNA, chromosome...    35   2.4     
gb:AP005167_1848613 Oryza sativa (japonica cultivar-group) genom...    30   4.0     
gb:AY094978_1936376 Macaca mulatta CD1e gene, complete cds.>gb:A...    35   4.2     
gb:AY296060_2525449 Danio rerio Bcl9 mRNA, complete cds.               34   7.1     
gb:OSJN00255_1697484 Oryza sativa genomic DNA, chromosome 4, BAC...    34   7.1     
gb:AY069495_1294225 Drosophila melanogaster LD22235 full length ...    34   7.1     
gb:AY058705_1291859 Drosophila melanogaster LD42783 full length ...    34   7.1     
gb:AE014134_1129113 Drosophila melanogaster chromosome 2L, compl...    34   7.1     
gb:OSJN00076_1694417 Oryza sativa genomic DNA, chromosome 4, BAC...    33   9.3     
gb:OSA245900_1692400 Oryza sativa chromosome 4 BAC q3037-207F1 c...    33   9.3     


>gb:AB020749_1514639 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone: MRC8.>gb:AY054683_1563337 Arabidopsis thaliana
            Unknown protein (At3g18050; MRC8.3) mRNA, complete
            cds.>gb:BT000057_1634335 Arabidopsis thaliana Unknown
            protein (At3g18050) mRNA, complete cds.
          Length = 335

 Score =  300 bits (769), Expect = 3e-80
 Identities = 169/314 (53%), Positives = 202/314 (64%), Gaps = 26/314 (8%)
 Frame = +2

Query: 233  PEPVSFST----PSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTR 400
            PEPV+        S PATIPAFPEQS+ + CPLDL E+LF GIKSAC        LH+ +
Sbjct: 25   PEPVTVQPFRVKSSPPATIPAFPEQSDFSGCPLDLPEDLFHGIKSACSGKK----LHKGK 80

Query: 401  CCPVLAAWLYSAYSTTALQRATSKIPRTTTF----------DMPVLPDDSETCVDSLEKA 550
            CCPVL AWLYSAYSTTAL R+ S   R ++           DMP+LPDDSETCVD L K+
Sbjct: 81   CCPVLGAWLYSAYSTTALSRSISAAARNSSSSSAAVTTPEEDMPLLPDDSETCVDGLGKS 140

Query: 551  LGNKGIELVKPNQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRLETDCFXXX 730
            L  +GIEL +PN+TCDVVYCYCGIRLHPLSC EAF +N  G LVG + V RLETDC    
Sbjct: 141  LRQRGIELTRPNETCDVVYCYCGIRLHPLSCSEAFRVNDEGRLVGDERVDRLETDCLSGS 200

Query: 731  XXXXXXXX---XXXKCLNSLYLLS---KSETRSTSKSDET-GSKMRSRDCQLMGLTWLLN 889
                          KCLNSLY L+    S TR+ SK D    +KM ++DC LMGLTWLL 
Sbjct: 201  HNNADGFSPLLGCNKCLNSLYKLNPKKTSGTRNPSKEDRNRTAKMHNKDCVLMGLTWLLA 260

Query: 890  KNRARYIHTVSAVLRALMMSTNGSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQISHY- 1066
            KNR  Y  TV++VLRA+M++ +G  P SC L SDGMPLAVDSSEF    S  +LQ  H+ 
Sbjct: 261  KNRTAYFPTVTSVLRAVMLNHDGV-PRSCALGSDGMPLAVDSSEF-SNGSPTSLQYPHHL 318

Query: 1067 ----TYIIVPLLLL 1096
                 Y ++ L+L+
Sbjct: 319  VHFLLYSVITLVLI 332



>gb:AY088158_1573180 Arabidopsis thaliana clone 42155 mRNA, complete
            sequence.
          Length = 304

 Score =  213 bits (543), Expect = 5e-54
 Identities = 123/289 (42%), Positives = 172/289 (59%), Gaps = 7/289 (2%)
 Frame = +2

Query: 257  PSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSA 436
            P  P T+PAFP ++   +C LDL+ ELF G+  ACG N     L R+RCCPVLAAWL++A
Sbjct: 28   PVQPNTVPAFPVETQAQSCRLDLSNELFGGVNEACGRN-----LDRSRCCPVLAAWLFAA 82

Query: 437  YSTTALQR-ATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCY 613
            ++ +ALQ  A +  P ++  D P+ PDDS+ CV++L+ AL  K I++ +PN +CD + C+
Sbjct: 83   HARSALQLPAPAPTPESSDPDEPMKPDDSQKCVNTLQSALLTKQIKIPQPNSSCDAILCF 142

Query: 614  CGIRLHP---LSCPEAFSMNS-HGELVGHQSVKRLETDCFXXXXXXXXXXXXXXKCLNSL 781
            CGIRLH    LSCP AF+++S         +VK LE +C                C   L
Sbjct: 143  CGIRLHQISSLSCPAAFNVSSGFKNATPTAAVKNLEKEC---------RNSSYSGCTRCL 193

Query: 782  YLLSKSETRSTSK--SDETGSKMRSRDCQLMGLTWLLNKNRARYIHTVSAVLRALMMSTN 955
              L K + R  +K  + E G+KM S+DCQLMGLTWLL +N+  YI TVSAVLRA+M S +
Sbjct: 194  GALQKLKVRGGNKKTTTERGTKMMSKDCQLMGLTWLLARNKTAYIPTVSAVLRAIMYSPH 253

Query: 956  GSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQISHYTYIIVPLLLLYI 1102
                  C+ + + MPLAVDS +F    SS     S + + ++P L L +
Sbjct: 254  PPHLNKCSPDQENMPLAVDSLQFQKSFSS-----SSHLFGVLPFLPLVL 297



>pir|T02911|T02911 hypothetical protein T13J8.210 - Arabidopsis
            thaliana>gb:ATCHRIV68_1546690 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 68.>gb:ATT13J8_1554415
            Arabidopsis thaliana DNA chromosome 4, BAC clone T13J8
            (ESSAII project).>gb:AK175274_1817262 Arabidopsis
            thaliana mRNA for predicted GPI-anchored protein,
            complete cds, clone: RAFL21-71-B18.>gb:AK175721_1817709
            Arabidopsis thaliana mRNA for predicted GPI-anchored
            protein, complete cds, clone: RAFL22-26-L16.
          Length = 304

 Score =  213 bits (543), Expect = 5e-54
 Identities = 123/289 (42%), Positives = 172/289 (59%), Gaps = 7/289 (2%)
 Frame = +2

Query: 257  PSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSA 436
            P  P T+PAFP ++   +C LDL+ ELF G+  ACG N     L R+RCCPVLAAWL++A
Sbjct: 28   PVQPNTVPAFPVETQAQSCRLDLSNELFGGVNEACGRN-----LDRSRCCPVLAAWLFAA 82

Query: 437  YSTTALQR-ATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKPNQTCDVVYCY 613
            ++ +ALQ  A +  P ++  D P+ PDDS+ CV++L+ AL  K I++ +PN +CD + C+
Sbjct: 83   HARSALQLPAPAPTPESSDPDEPMKPDDSQKCVNTLQSALLTKQIKIPQPNSSCDAILCF 142

Query: 614  CGIRLHP---LSCPEAFSMNS-HGELVGHQSVKRLETDCFXXXXXXXXXXXXXXKCLNSL 781
            CGIRLH    LSCP AF+++S         +VK LE +C                C   L
Sbjct: 143  CGIRLHQISSLSCPAAFNVSSGFKNATPTAAVKNLEKEC---------RNSSYSGCTRCL 193

Query: 782  YLLSKSETRSTSK--SDETGSKMRSRDCQLMGLTWLLNKNRARYIHTVSAVLRALMMSTN 955
              L K + R  +K  + E G+KM S+DCQLMGLTWLL +N+  YI TVSAVLRA+M S +
Sbjct: 194  GALQKLKVRGGNKKTTTERGTKMMSKDCQLMGLTWLLARNKTAYIPTVSAVLRAIMYSPH 253

Query: 956  GSDPLSCTLNSDGMPLAVDSSEFYDQSSSFTLQISHYTYIIVPLLLLYI 1102
                  C+ + + MPLAVDS +F    SS     S + + ++P L L +
Sbjct: 254  PPHLNKCSPDQENMPLAVDSLQFQKSFSS-----SSHLFGVLPFLPLVL 297



>gb:AP005195_1849228 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC clone:P0567H04.
          Length = 335

 Score =  186 bits (472), Expect = 9e-46
 Identities = 115/294 (39%), Positives = 157/294 (53%), Gaps = 32/294 (10%)
 Frame = +2

Query: 257  PSTPATIPAFP-----EQSNTAA-------CPLDLTEELFRGIKSACGSNDYSGPLHRTR 400
            PS    +P++P       +NT++       C LDL+ ELF G+ +ACG+    G L R R
Sbjct: 17   PSAATDVPSYPLSQAQSPANTSSGGSTSPPCHLDLSAELFGGVAAACGAGGGPGSLDRGR 76

Query: 401  CCPVLAAWLYSAYSTTALQ-----RATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKG 565
            CCPVLAAWL++A++ TAL       A +        D P++P D++ CVD+L  AL  +G
Sbjct: 77   CCPVLAAWLFAAHARTALSVPAPAPALAGEGLDGGEDEPMVPYDNQRCVDALGSALERRG 136

Query: 566  IELVKPNQTCDVVYCYCGIRLH---PLSCPEAFSMNSHGELVGHQ-----SVKRLETDCF 721
            + L +PN TCD V C+CGIRLH    L CP AF++   G           +VK LE  C 
Sbjct: 137  VALPRPNATCDTVLCFCGIRLHQIGSLRCPAAFAVGGGGAAAAKNATPTAAVKELEKSC- 195

Query: 722  XXXXXXXXXXXXXXKCLNSLYLLSKSETRSTSKSDETGSKMRSRDCQLMGLTWLLNKNRA 901
                          +C+ SL  L  + +R  +  D    +M  RDCQLMGLTWLL KN+ 
Sbjct: 196  -----RNASYAGCSRCVQSLQKLKGNVSREVAGGDR-ARRMLGRDCQLMGLTWLLAKNKT 249

Query: 902  RYIHTVSAVLRALMMSTN-------GSDPLSCTLNSDGMPLAVDSSEFYDQSSS 1042
             YI TVSAVLRA++ S         G  P  C+ + + MPLAVDS +F   S++
Sbjct: 250  VYIPTVSAVLRAMLYSARPTESAAAGGAPPRCSPDQENMPLAVDSLQFERASAT 303



>gb:AP003983_1835899 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC
            clone:OJ1038_A06.>gb:AP004161_1838420 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, BAC
            clone:OJ1311_H06.
          Length = 351

 Score =  164 bits (414), Expect = 5e-39
 Identities = 109/304 (35%), Positives = 150/304 (49%), Gaps = 35/304 (11%)
 Frame = +2

Query: 224  LPDPEPVS------FSTPSTP--ATIPAFPEQSNTAA-----CPLDLTEELFRGIKSACG 364
            LPDP P+        +TP+ P  ATIPAFPEQS+ A+     CPL  +  L   + S+C 
Sbjct: 30   LPDPAPLDPALIFPSATPAQPGSATIPAFPEQSDAASGTSSTCPLTPSPSLLPAVTSSCV 89

Query: 365  SNDYSGPLH-RTRCCPVLAAWLYSAYSTTALQRATSKIPRTTTFDMPVLPDDSETCVDSL 541
              D  G L  R RCCP LAAWL++AY+  AL +  +K       DMPV PDDSE C  + 
Sbjct: 90   --DGGGALTTRLRCCPPLAAWLFAAYAPAALAQRPAKSAAAAAVDMPVPPDDSEACAGAA 147

Query: 542  EKALGNKGIELVKP---NQTCDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRLET 712
            ++AL  +G  L +P   N TCDV +CYCG+RL  L+C    +           + +RLE 
Sbjct: 148  DRALRAEGAALPRPPGANGTCDVAFCYCGVRLRRLTCGPPPAEGGQW-APADAAARRLEK 206

Query: 713  DCFXXXXXXXXXXXXXXKCLNSLYLLSKSETRSTSKSDETGSKMR---------SRDCQL 865
            DC               KCL +L  +      + + +     K +          R+CQL
Sbjct: 207  DC------AEPGVPGCSKCLRALTTIKAGSGGAAAAAAAAAKKKQQQGGAGVTGERECQL 260

Query: 866  MGLTWLLNKNRARYIHTVSAVLRALMMSTNGS---------DPLSCTLNSDGMPLAVDSS 1018
            MG+ WLL +N  RY    +AV++ALM +   S          P +C+L  D MPLA + +
Sbjct: 261  MGIMWLLQRNATRYGAAATAVIQALMAADEASAAGVAAAADGPAACSLPVDDMPLAAEYA 320

Query: 1019 EFYD 1030
             F D
Sbjct: 321  RFSD 324



>gb:AP004688_1843418 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, PAC clone:P0036C11.
          Length = 404

 Score =  131 bits (329), Expect = 3e-29
 Identities = 107/362 (29%), Positives = 154/362 (42%), Gaps = 80/362 (22%)
 Frame = +2

Query: 197  IPVSIANPDLPDPE--------PVSFSTPSTPA---------TIPAFPEQSNTAA----C 313
            +P + + P +P+P         P S    S PA         TIPAFPEQS  AA    C
Sbjct: 21   LPPAASLPAMPNPASLEPSLLFPSSSGASSQPAQPGPGAASSTIPAFPEQSEAAAATSVC 80

Query: 314  PLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTAL------------- 454
             L  +  L   + ++C +   + P  R RCCP LAAW+Y+AY+ TAL             
Sbjct: 81   QLAPSPPLLPAVLASCNAGGGALP-PRLRCCPALAAWMYAAYAPTALLAAAAGGGGGVPG 139

Query: 455  ---QRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGIELVKP--------NQT--- 592
                 A++        D+PVLPDD+E C  + E+AL   G  L  P        N T   
Sbjct: 140  AAHSTASAAEAVAAVVDLPVLPDDAEECAGAAERALLAAGASLPPPPPPSQVGANGTTAA 199

Query: 593  --CDVVYCYCGIRLHPLSCPEAFSMNSHGELVGHQSVKRLETDC----------FXXXXX 736
              CDV +CYC +RL   +C               ++ +RLE  C                
Sbjct: 200  AACDVPFCYCRVRLRRPACAAP----------AGRAARRLEKACSRPGLAGCSRCLRALN 249

Query: 737  XXXXXXXXXKCLNSLYL-------------------LSKSETRSTSKSDETGSKMRSRDC 859
                      C N++ +                    +K+   S   +     + R RDC
Sbjct: 250  QTASTMVIFFCANAIVIRHASHEVGEFREIDLNGGNATKAANASHGGAQAQQQQQRQRDC 309

Query: 860  QLMGLTWLLNKNRARYIHTVSAVLRALMMSTNGSD-PLSCTLNSDGMPLAVDSSEFYDQS 1036
            QLMGLTWLL++N  R+    +AV++ALM + + +  P  C+L SD +P+AV SSE    +
Sbjct: 310  QLMGLTWLLHRNATRHGAAATAVIQALMAADDATGRPAPCSLPSDDLPVAVASSEINGAA 369

Query: 1037 SS 1042
            +S
Sbjct: 370  AS 371



>gb:AF466203_1802276 Zea mays clone ZMBBb_0092E12, partial sequence.
          Length = 1850

 Score = 38.5 bits (88), Expect = 0.29
 Identities = 29/76 (38%), Positives = 38/76 (50%), Gaps = 3/76 (3%)
 Frame = -2

Query: 466 GGPLEGSC*IGGVEPGREYRAAP-GPVERTRIII-RPAGGFDPAEELLREVQ-RAGGGVG 296
           GGP EG+  +G  E G   R  P   + R   ++  PAGG+DP  E +RE Q R   G G
Sbjct: 281 GGPSEGNH-LGMPEDGDLPRPVPRADIPRELAVVPAPAGGYDPQLEQVREAQARLNEGTG 339

Query: 295 LLRERRNRCGR*WGGK 248
            L   R   G+ W G+
Sbjct: 340 ALEPIRRDVGQAWVGQ 355



>gb:TAU73214_1724765 Triticum aestivum cold acclimation protein
           WCOR518 (Wcor518) mRNA, parial cds.
          Length = 315

 Score = 36.6 bits (83), Expect = 1.1
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 2/70 (2%)
 Frame = +2

Query: 215 NPDLPDPEPVSFSTPSTPATIPAFPEQS-NTAACPLDLTEELFRGIKSACG-SNDYSGPL 388
           +P  P P PVS  +P  P+ +PA P  S +T  CP+D T +L   +    G  +   G  
Sbjct: 198 SPTPPSPAPVSPPSPVVPSPVPATPPPSPSTGQCPID-TLKLLGCVDGLNGLVHAVIGSS 256

Query: 389 HRTRCCPVLA 418
               CCP+L+
Sbjct: 257 ASDSCCPLLS 266



>pir|T06806|T06806 proline rich protein homolog WCOR518 - wheat
           (fragment)
          Length = 315

 Score = 36.6 bits (83), Expect = 1.1
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 2/70 (2%)
 Frame = +2

Query: 215 NPDLPDPEPVSFSTPSTPATIPAFPEQS-NTAACPLDLTEELFRGIKSACG-SNDYSGPL 388
           +P  P P PVS  +P  P+ +PA P  S +T  CP+D T +L   +    G  +   G  
Sbjct: 198 SPTPPSPAPVSPPSPVVPSPVPATPPPSPSTGQCPID-TLKLLGCVDGLNGLVHAVIGSS 256

Query: 389 HRTRCCPVLA 418
               CCP+L+
Sbjct: 257 ASDSCCPLLS 266



>gb:CNS07EGC_1373246 chromosome V of strain GB-M1 of Encephalitozoon
           cuniculi (Microspora).>gb:CNS07EGG_1374174 chromosome X
           of strain GB-M1 of Encephalitozoon cuniculi
           (Microspora).
          Length = 489

 Score = 30.0 bits (66), Expect(2) = 1.4
 Identities = 16/46 (34%), Positives = 20/46 (43%), Gaps = 2/46 (4%)
 Frame = +3

Query: 396 PGAARYSRPGSTPPIQQLPSKGPPPRSLERRRLT--CRCSRMTPRP 527
           P  A  SRP    P  Q P+KG PP   +++  T  C      P P
Sbjct: 74  PSVAATSRPKPGNPFLQPPTKGTPPPKKKKKNHTEGCHTHEANPEP 119



 Score = 25.0 bits (53), Expect(2) = 1.4
 Identities = 13/38 (34%), Positives = 17/38 (44%)
 Frame = +2

Query: 200 PVSIANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAAC 313
           P  +A+P  P P P S   P  P+  P F  +S    C
Sbjct: 23  PAPLASPTAPMPRPASHLAP-MPSDHPDFRSKSARLRC 59



>gb:CNS07EGA_1372914 chromosome III of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 276

 Score = 30.0 bits (66), Expect(2) = 1.5
 Identities = 16/46 (34%), Positives = 20/46 (43%), Gaps = 2/46 (4%)
 Frame = +3

Query: 396 PGAARYSRPGSTPPIQQLPSKGPPPRSLERRRLT--CRCSRMTPRP 527
           P  A  SRP    P  Q P+KG PP   +++  T  C      P P
Sbjct: 74  PSVAATSRPKPGNPFLQPPTKGTPPPKKKKKNHTEGCHTHEANPEP 119



 Score = 25.0 bits (53), Expect(2) = 1.5
 Identities = 13/38 (34%), Positives = 17/38 (44%)
 Frame = +2

Query: 200 PVSIANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAAC 313
           P  +A+P  P P P S   P  P+  P F  +S    C
Sbjct: 23  PAPLASPTAPMPRPASHLAP-MPSDHPDFRSKSARLRC 59



>gb:CNS06C8G_1372602 chromosome I of strain GB-M1 of Encephalitozoon
           cuniculi (Microspora).>gb:CNS06C8G_1372752 chromosome I
           of strain GB-M1 of Encephalitozoon cuniculi
           (Microspora).>gb:CNS07EGE_1373588 chromosome VII of
           strain GB-M1 of Encephalitozoon cuniculi (Microspora).
          Length = 238

 Score = 30.0 bits (66), Expect(2) = 1.5
 Identities = 16/46 (34%), Positives = 20/46 (43%), Gaps = 2/46 (4%)
 Frame = +3

Query: 396 PGAARYSRPGSTPPIQQLPSKGPPPRSLERRRLT--CRCSRMTPRP 527
           P  A  SRP    P  Q P+KG PP   +++  T  C      P P
Sbjct: 74  PSVAATSRPKPGNPFLQPPTKGTPPPKKKKKNHTEGCHTHEANPEP 119



 Score = 25.0 bits (53), Expect(2) = 1.5
 Identities = 13/38 (34%), Positives = 17/38 (44%)
 Frame = +2

Query: 200 PVSIANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAAC 313
           P  +A+P  P P P S   P  P+  P F  +S    C
Sbjct: 23  PAPLASPTAPMPRPASHLAP-MPSDHPDFRSKSARLRC 59



>gb:AP005467_1852348 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1349_D05.
          Length = 467

 Score = 35.8 bits (81), Expect = 1.9
 Identities = 22/48 (45%), Positives = 24/48 (50%), Gaps = 5/48 (10%)
 Frame = +3

Query: 399 GAARYSRPGSTPPIQQLPS-----KGPPPRSLERRRLTCRCSRMTPRP 527
           GAA  SRP +  P    P       GPPPR L R  L  RC R+ PRP
Sbjct: 95  GAAFASRPRAVSPASVWPHLDGPPAGPPPRVLRRATLCARCPRL-PRP 141



>gb:AF466203_1802274 Zea mays clone ZMBBb_0092E12, partial sequence.
          Length = 1854

 Score = 35.8 bits (81), Expect = 1.9
 Identities = 28/76 (36%), Positives = 37/76 (48%), Gaps = 3/76 (3%)
 Frame = -2

Query: 466 GGPLEGSC*IGGVEPGREYRAAP-GPVERTRIII-RPAGGFDPAEELLREVQ-RAGGGVG 296
           G P EG+  +G  E G   R  P   + R   ++  PAGG+DP  E +RE Q R   G G
Sbjct: 281 GDPSEGNH-LGMPEDGDLPRPVPRADIPRELAVVPAPAGGYDPQLEQVREAQARLNEGTG 339

Query: 295 LLRERRNRCGR*WGGK 248
            L   R   G+ W G+
Sbjct: 340 ALEPIRRDVGQAWVGQ 355



>gb:AF466203_1802273 Zea mays clone ZMBBb_0092E12, partial sequence.
          Length = 1066

 Score = 35.8 bits (81), Expect = 1.9
 Identities = 28/76 (36%), Positives = 37/76 (48%), Gaps = 3/76 (3%)
 Frame = -2

Query: 466 GGPLEGSC*IGGVEPGREYRAAP-GPVERTRIII-RPAGGFDPAEELLREVQ-RAGGGVG 296
           G P EG+  +G  E G   R  P   + R   ++  PAGG+DP  E +RE Q R   G G
Sbjct: 133 GDPSEGNH-LGMPEDGDLPRPVPRADIPRELAVVPAPAGGYDPQLEQVREAQARLNEGTG 191

Query: 295 LLRERRNRCGR*WGGK 248
            L   R   G+ W G+
Sbjct: 192 ALEPIRRDVGQAWVGQ 207



>gb:AB025624_1516458 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MLD14.>gb:BT015817_1642435 Arabidopsis
           thaliana At3g19300 gene, complete
           cds.>gb:BT020204_1642599 Arabidopsis thaliana At3g19300
           mRNA, complete cds.
          Length = 663

 Score = 35.4 bits (80), Expect = 2.4
 Identities = 23/88 (26%), Positives = 38/88 (43%)
 Frame = +2

Query: 305 AACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAYSTTALQRATSKIPRT 484
           A CPLD T   F  + S C +N       R +CC  + A++  + +  A           
Sbjct: 28  AGCPLDFTSSNFTLVASVCSNN-----TERAKCCRYMNAFVAISVARYA----------N 72

Query: 485 TTFDMPVLPDDSETCVDSLEKALGNKGI 568
            T D+ V  D +E C+ ++ + +   GI
Sbjct: 73  YTADLGVTSDLTEICITTISRTMELYGI 100



>gb:AP005167_1848613 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBa0060O17.
          Length = 463

 Score = 30.4 bits (67), Expect(2) = 4.0
 Identities = 13/33 (39%), Positives = 17/33 (51%)
 Frame = +2

Query: 194 CIPVSIANPDLPDPEPVSFSTPSTPATIPAFPE 292
           C PVS A P  P P+P     P++P   P  P+
Sbjct: 45  CYPVSSAAPTAPPPKPSPTPPPASPPPAPTPPQ 77



 Score = 23.1 bits (48), Expect(2) = 4.0
 Identities = 10/19 (52%), Positives = 11/19 (57%)
 Frame = +3

Query: 414 SRPGSTPPIQQLPSKGPPP 470
           +RP S PP QQ P    PP
Sbjct: 78  TRPPSPPPQQQQPRPVSPP 96



>gb:AY094978_1936376 Macaca mulatta CD1e gene, complete
           cds.>gb:AY094979_1936377 Macaca mulatta CD1e mRNA,
           complete cds.
          Length = 387

 Score = 34.7 bits (78), Expect = 4.2
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = +3

Query: 453 SKGPPPRSLERRRLTCRCSRMTPRPAWILWRR 548
           S+GP P    RR+L C  S   P+P W++W R
Sbjct: 216 SRGPSPGP-GRRQLVCHVSGFYPKPVWVMWMR 246



>gb:AY296060_2525449 Danio rerio Bcl9 mRNA, complete cds.
          Length = 1474

 Score = 33.9 bits (76), Expect = 7.1
 Identities = 20/62 (32%), Positives = 28/62 (45%)
 Frame = +2

Query: 200  PVSIANPDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYS 379
            PV + +P LP P P   S+P  P   P  P+ +N    PL +T     G  +  G+   S
Sbjct: 959  PVHMKSPSLPAPSPGWTSSPKPPMQSPGIPQNTNP---PLSMTSPNMMGGVAQGGNVPPS 1015

Query: 380  GP 385
             P
Sbjct: 1016 AP 1017



>gb:OSJN00255_1697484 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0070C17, complete sequence.
          Length = 202

 Score = 33.9 bits (76), Expect = 7.1
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 1/68 (1%)
 Frame = +2

Query: 218 PDLPDPEPVSFSTPSTPATIPAFPEQSNTAACPLDLTEELFRGIKSACG-SNDYSGPLHR 394
           P  P P P + +TP+TP T PA    + T  CP+D T +L   + +  G  +   G    
Sbjct: 82  PATPPPTPATPATPTTPPT-PAPAPSTPTGKCPVD-TLKLLACVDALNGLVHAVVGATAG 139

Query: 395 TRCCPVLA 418
             CCP+L+
Sbjct: 140 DTCCPLLS 147



>gb:AY069495_1294225 Drosophila melanogaster LD22235 full length
           cDNA.
          Length = 923

 Score = 33.9 bits (76), Expect = 7.1
 Identities = 14/36 (38%), Positives = 24/36 (66%)
 Frame = +2

Query: 785 LLSKSETRSTSKSDETGSKMRSRDCQLMGLTWLLNK 892
           ++ K   +S+S +DE  S+ +S+ C+LMG  WL N+
Sbjct: 704 VIEKLNLQSSSGADEERSEAKSKKCELMGKLWLQNE 739



>gb:AY058705_1291859 Drosophila melanogaster LD42783 full length
           cDNA.
          Length = 463

 Score = 33.9 bits (76), Expect = 7.1
 Identities = 14/36 (38%), Positives = 24/36 (66%)
 Frame = +2

Query: 785 LLSKSETRSTSKSDETGSKMRSRDCQLMGLTWLLNK 892
           ++ K   +S+S +DE  S+ +S+ C+LMG  WL N+
Sbjct: 244 VIEKLNLQSSSGADEERSEAKSKKCELMGKLWLQNE 279



>gb:AE014134_1129113 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE014134_1129114 Drosophila melanogaster
            chromosome 2L, complete sequence.>gb:AE003641_1219220
            Drosophila melanogaster chromosome 2L, section 50 of 83
            of the complete sequence.>gb:AE003641_1219221 Drosophila
            melanogaster chromosome 2L, section 50 of 83 of the
            complete sequence.>gb:DME556817_1379407 Drosophila
            melanogaster mRNA for SMG5 protein.>gb:DROSADH02_1382713
            Drosophila melanogaster, chromosome 2L, region 34C4-36A7
            (Adh region), section 2 of 10 of the complete sequence.
          Length = 1177

 Score = 33.9 bits (76), Expect = 7.1
 Identities = 14/36 (38%), Positives = 24/36 (66%)
 Frame = +2

Query: 785  LLSKSETRSTSKSDETGSKMRSRDCQLMGLTWLLNK 892
            ++ K   +S+S +DE  S+ +S+ C+LMG  WL N+
Sbjct: 958  VIEKLNLQSSSGADEERSEAKSKKCELMGKLWLQNE 993



>gb:OSJN00076_1694417 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0039K24, complete sequence.
          Length = 673

 Score = 33.5 bits (75), Expect = 9.3
 Identities = 28/103 (27%), Positives = 42/103 (40%)
 Frame = +2

Query: 260 STPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAY 439
           ++P    A P  +    CPLD +   F    +AC     S P  R  CC  + A++  A 
Sbjct: 17  ASPFFFSANPAATAVGDCPLDFSWANFTLASAAC-----SDPTQRAACCRYINAFV--AI 69

Query: 440 STTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGI 568
           S      AT +        + V P  SE C+ S+ +    +GI
Sbjct: 70  SMARYANATGR--------LGVPPAFSEICLSSVSETFKLRGI 104



>gb:OSA245900_1692400 Oryza sativa chromosome 4 BAC q3037-207F1
           complete genome.
          Length = 835

 Score = 33.5 bits (75), Expect = 9.3
 Identities = 28/103 (27%), Positives = 42/103 (40%)
 Frame = +2

Query: 260 STPATIPAFPEQSNTAACPLDLTEELFRGIKSACGSNDYSGPLHRTRCCPVLAAWLYSAY 439
           ++P    A P  +    CPLD +   F    +AC     S P  R  CC  + A++  A 
Sbjct: 17  ASPFFFSANPAATAVGDCPLDFSWANFTLASAAC-----SDPTQRAACCRYINAFV--AI 69

Query: 440 STTALQRATSKIPRTTTFDMPVLPDDSETCVDSLEKALGNKGI 568
           S      AT +        + V P  SE C+ S+ +    +GI
Sbjct: 70  SMARYANATGR--------LGVPPAFSEICLSSVSETFKLRGI 104


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,266,032,241
Number of Sequences: 1806583
Number of extensions: 27551816
Number of successful extensions: 97213
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 88001
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 96915
length of database: 581,917,975
effective HSP length: 127
effective length of database: 352,481,934
effective search space used: 101162315058
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)