BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig6250
         (659 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T07901|T07901 acyl CoA oxidase homolog - cucurbit>gb:AF00201...   194   1e-48   
pir|T52120|T52120 acyl-CoA oxidase (EC 1.3.3.6), peroxisomal [va...   193   2e-48   Arabidopsis thaliana [mouse-ear cress]
gb:AF202987_1776546 Petroselinum crispum acyl-CoA oxidase (ACO) ...   192   4e-48   
gb:AB013395_1512157 Arabidopsis thaliana genomic DNA, chromosome...   190   2e-47   
gb:PSU66299_1702537 Phalaenopsis sp. 'True Lady' acyl-CoA oxidas...   168   7e-41   
gb:U77052S2_1726441 Phalaenopsis cv. 'True Lady' acyl-CoA oxidas...   167   1e-40   
gb:PSU77051_1702548 Phalaenopsis cv. 'True Lady' acyl-CoA oxidas...   107   2e-22   
gb:AP003574_1831122 Oryza sativa (japonica cultivar-group) genom...    43   0.005   
pir|H86198|H86198 hypothetical protein [imported] - Arabidopsis ...    38   0.18    Arabidopsis thaliana [mouse-ear cress]
gb:BC022268_1977753 Homo sapiens acyl-Coenzyme A oxidase-like, m...    37   0.30    
gb:AP006618_558875 Nocardia farcinica IFM 10152 DNA, complete ge...    37   0.30    
gb:AE017234_412806 Mycobacterium avium subsp. paratuberculosis s...    35   0.87    
gb:AF207994_1776991 Arabidopsis thaliana acyl-CoA oxidase ACX3 (...    35   1.5     
gb:F9P14_1678768 Sequence of BAC F9P14 from Arabidopsis thaliana...    35   1.5     
gb:AY099579_1576605 Arabidopsis thaliana acyl-CoA oxidase ACX3 (...    35   1.5     
gb:AK004775_1152585 Mus musculus adult male lung cDNA, RIKEN ful...    34   1.9     
gb:AC116979_1207074 Dictyostelium discoideum chromosome 2 map 64...    34   2.5     
gb:BA000016_674772 Clostridium perfringens str. 13 DNA, complete...    33   4.3     
pir|A86237|A86237 protein F14N23.15 [imported] - Arabidopsis tha...    33   4.3     Arabidopsis thaliana [mouse-ear cress]
gb:AF236663_1779597 Aspergillus nidulans SCF complex protein cul...    33   5.6     
pir|A72588|A72588 hypothetical protein APE1174 - Aeropyrum perni...    33   5.6     Aeropyrum pernix
gb:AE008692_241656 Zymomonas mobilis subsp. mobilis ZM4, complet...    32   7.4     
gb:AP003329_1827997 Oryza sativa (japonica cultivar-group) genom...    32   9.6     
gb:AE017283_431198 Propionibacterium acnes KPA171202, complete g...    32   9.6     


>pir|T07901|T07901 acyl CoA oxidase homolog -
           cucurbit>gb:AF002016_1760560 Cucurbita sp. cv. Kurokawa
           Amakuri acyl CoA oxidase homolog mRNA, complete cds.
          Length = 690

 Score =  194 bits (492), Expect = 1e-48
 Identities = 103/162 (63%), Positives = 128/162 (79%), Gaps = 2/162 (1%)
 Frame = +1

Query: 178 NRTAEDENREETQLINRRIRRLSMHLTPATFLDNSADSRLEMLTCAA-RAKV-LTVNTKE 351
           NRTAEDE+    Q   RRI RLS+HLTP    D+     +EM TCAA +AK  + V+   
Sbjct: 8   NRTAEDES----QAAARRIERLSLHLTPIPLDDSQG---VEMETCAAGKAKAKIEVDMGS 60

Query: 352 LSVYLRGEHRELQEKVYEYFSSRPGLQTPLDILKDEHRELCMRQLSGLVREAGVRPLRYV 531
           LS+Y+RG+HRE+QE+V+EYF+SRP LQTP+ I   +HRELCM+QL GLVREAG+RP R+V
Sbjct: 61  LSLYMRGKHREIQERVFEYFNSRPELQTPVGISMADHRELCMKQLVGLVREAGIRPFRFV 120

Query: 532 VEEPSKYFAIVEAVGAVDVSLAIKMGVQYSLWGGSVLNLGXK 657
            E+P+KYFAI+EAVG+VDVSLAIKMGVQ+SLWGGSV+NLG K
Sbjct: 121 NEDPAKYFAIMEAVGSVDVSLAIKMGVQFSLWGGSVINLGTK 162



>pir|T52120|T52120 acyl-CoA oxidase (EC 1.3.3.6), peroxisomal
           [validated] - Arabidopsis thaliana>gb:AF057043_1764769
           Arabidopsis thaliana acyl-CoA oxidase (ACX2) mRNA,
           complete cds.
          Length = 692

 Score =  193 bits (490), Expect = 2e-48
 Identities = 94/162 (58%), Positives = 125/162 (77%)
 Frame = +1

Query: 172 RLNRTAEDENREETQLINRRIRRLSMHLTPATFLDNSADSRLEMLTCAARAKVLTVNTKE 351
           R  +    E   +  +  RRI+RLS+HL+P+  L  S    ++  TC+AR+K L VN + 
Sbjct: 4   RREKNPMTEEESDGLIAARRIQRLSLHLSPSLTLSPSLPL-VQTETCSARSKKLDVNGEA 62

Query: 352 LSVYLRGEHRELQEKVYEYFSSRPGLQTPLDILKDEHRELCMRQLSGLVREAGVRPLRYV 531
           LS+Y+RG+H ++QEK++++F+SRP LQTP++I KD+HRELCM QL GLVREAGVRP RYV
Sbjct: 63  LSLYMRGKHIDIQEKIFDFFNSRPDLQTPIEISKDDHRELCMNQLIGLVREAGVRPFRYV 122

Query: 532 VEEPSKYFAIVEAVGAVDVSLAIKMGVQYSLWGGSVLNLGXK 657
            ++P KYFAI+EAVG+VD+SL IKMGVQYSLWGGSV+NLG K
Sbjct: 123 ADDPEKYFAIMEAVGSVDMSLGIKMGVQYSLWGGSVINLGTK 164



>gb:AF202987_1776546 Petroselinum crispum acyl-CoA oxidase (ACO)
           gene, complete cds.
          Length = 694

 Score =  192 bits (488), Expect = 4e-48
 Identities = 99/160 (61%), Positives = 127/160 (79%)
 Frame = +1

Query: 178 NRTAEDENREETQLINRRIRRLSMHLTPATFLDNSADSRLEMLTCAARAKVLTVNTKELS 357
           N TAE+++    Q   RRI+RLS+HL P T  DN+    +EM+TCAARAK L VNT +L+
Sbjct: 12  NPTAENDD----QTTARRIQRLSLHLNP-TLTDNTT---IEMVTCAARAK-LNVNTTQLT 62

Query: 358 VYLRGEHRELQEKVYEYFSSRPGLQTPLDILKDEHRELCMRQLSGLVREAGVRPLRYVVE 537
           +++RG+HR+LQEKVYE+F SRP LQTP++I  ++HRELCM+QL  LVREAG++P +YVV+
Sbjct: 63  LFMRGKHRDLQEKVYEFFRSRPDLQTPIEISTEKHRELCMKQLLALVREAGIKPFKYVVD 122

Query: 538 EPSKYFAIVEAVGAVDVSLAIKMGVQYSLWGGSVLNLGXK 657
           +P  YFAI EA G+VDVS  IK+GVQYSLWGGSVLNLG K
Sbjct: 123 DPFVYFAIGEAAGSVDVSFGIKLGVQYSLWGGSVLNLGTK 162



>gb:AB013395_1512157 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MQN23.
          Length = 692

 Score =  190 bits (483), Expect = 2e-47
 Identities = 93/162 (57%), Positives = 124/162 (76%)
 Frame = +1

Query: 172 RLNRTAEDENREETQLINRRIRRLSMHLTPATFLDNSADSRLEMLTCAARAKVLTVNTKE 351
           R  +    E   +  +  RRI+RLS+HL+P+     S    ++  TC+AR+K L VN + 
Sbjct: 4   RREKNPMTEEESDGLIAARRIQRLSLHLSPSLTPSPSLPL-VQTETCSARSKKLDVNGEA 62

Query: 352 LSVYLRGEHRELQEKVYEYFSSRPGLQTPLDILKDEHRELCMRQLSGLVREAGVRPLRYV 531
           LS+Y+RG+H ++QEK++++F+SRP LQTP++I KD+HRELCM QL GLVREAGVRP RYV
Sbjct: 63  LSLYMRGKHIDIQEKIFDFFNSRPDLQTPIEISKDDHRELCMNQLIGLVREAGVRPFRYV 122

Query: 532 VEEPSKYFAIVEAVGAVDVSLAIKMGVQYSLWGGSVLNLGXK 657
            ++P KYFAI+EAVG+VD+SL IKMGVQYSLWGGSV+NLG K
Sbjct: 123 ADDPEKYFAIMEAVGSVDMSLGIKMGVQYSLWGGSVINLGTK 164



>gb:PSU66299_1702537 Phalaenopsis sp. 'True Lady' acyl-CoA oxidase
           homolog mRNA, complete cds.
          Length = 699

 Score =  168 bits (426), Expect = 7e-41
 Identities = 85/159 (53%), Positives = 113/159 (71%), Gaps = 6/159 (3%)
 Frame = +1

Query: 199 NREETQLINRRIRRLSMHLT-PATFLDNSADSRLEML-----TCAARAKVLTVNTKELSV 360
           +  +TQ   RRI++LS+HL  P+ FLD  +      +     T      +L+V+  EL  
Sbjct: 12  SEHDTQQALRRIQKLSLHLLQPSPFLDPESSGDKNWIVPSPCTGGRGRPLLSVSRAELVE 71

Query: 361 YLRGEHRELQEKVYEYFSSRPGLQTPLDILKDEHRELCMRQLSGLVREAGVRPLRYVVEE 540
           Y++G HRE+QE+V+ +F SRP LQTP++I   +HR LCMRQL+ LVREAG+RP RY +E+
Sbjct: 72  YMKGRHREIQERVFNFFVSRPELQTPVEISTADHRVLCMRQLTALVREAGIRPFRYAIED 131

Query: 541 PSKYFAIVEAVGAVDVSLAIKMGVQYSLWGGSVLNLGXK 657
           PS YFAIVEAVG +D+SL IK+GVQYSLWGGSV+NLG K
Sbjct: 132 PSVYFAIVEAVGGIDISLGIKLGVQYSLWGGSVMNLGTK 170



>gb:U77052S2_1726441 Phalaenopsis cv. 'True Lady' acyl-CoA oxidase
           (PACO1) gene, exons 2 through 7 and complete cds.
          Length = 709

 Score =  167 bits (424), Expect = 1e-40
 Identities = 90/182 (49%), Positives = 121/182 (66%), Gaps = 6/182 (3%)
 Frame = +1

Query: 130 MHSAAMDHRKMTSQRLNRTAEDENREETQLINRRIRRLSMHLT-PATFLDNSADSRLEML 306
           M +  M+   MT +    +   E+  +TQ   RRI++LS+HL  P+ FLD  +      +
Sbjct: 1   MFTRPMEGGGMTKEAQMTSLASEH--DTQRALRRIQKLSLHLLQPSPFLDPESSGDKNWI 58

Query: 307 -----TCAARAKVLTVNTKELSVYLRGEHRELQEKVYEYFSSRPGLQTPLDILKDEHREL 471
                T      +L+V+  EL  Y+ G HRE+QE+V+ +F SRP LQTP++I   +HR L
Sbjct: 59  VPSPCTGGRGRPLLSVSRAELVEYMTGRHREIQERVFNFFVSRPELQTPVEISTADHRVL 118

Query: 472 CMRQLSGLVREAGVRPLRYVVEEPSKYFAIVEAVGAVDVSLAIKMGVQYSLWGGSVLNLG 651
           CMRQL+ LVREAG+RP RY +E+PS YFAIVEAVG +D+SL IK+GVQYSLWGGSV+NLG
Sbjct: 119 CMRQLTALVREAGIRPFRYAIEDPSVYFAIVEAVGGIDISLGIKLGVQYSLWGGSVMNLG 178

Query: 652 XK 657
            K
Sbjct: 179 TK 180



>gb:PSU77051_1702548 Phalaenopsis cv. 'True Lady' acyl-CoA oxidase
           mRNA, partial cds.
          Length = 142

 Score =  107 bits (266), Expect = 2e-22
 Identities = 59/144 (40%), Positives = 88/144 (61%), Gaps = 6/144 (4%)
 Frame = +1

Query: 130 MHSAAMDHRKMTSQRLNRTAEDENREETQLINRRIRRLSMHLT-PATFLDNSADSRLEML 306
           M +  M+   MT +    +   E+  +TQ   RRI++LS+HL  P+ FLD  +      +
Sbjct: 1   MFTRPMEGGGMTKEAQMTSLASEH--DTQRALRRIQKLSLHLLQPSPFLDPESSGGKNWM 58

Query: 307 -----TCAARAKVLTVNTKELSVYLRGEHRELQEKVYEYFSSRPGLQTPLDILKDEHREL 471
                T      +L+V+  EL  Y++G HRE+QE+++ +F SRP LQTP++I   +HR L
Sbjct: 59  VPSPCTFGRGRPLLSVSRAELVEYMKGRHREIQERIFNFFVSRPELQTPVEISTADHRVL 118

Query: 472 CMRQLSGLVREAGVRPLRYVVEEP 543
           CMRQL+ LVREAG+RP RY +E+P
Sbjct: 119 CMRQLTALVREAGIRPFRYAIEDP 142



>gb:AP003574_1831122 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0526E12.
          Length = 685

 Score = 42.7 bits (99), Expect = 0.005
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 5/74 (6%)
 Frame = +1

Query: 451 KDEHRELCMRQLSGLVREAGVRPLRYVVEEPS-----KYFAIVEAVGAVDVSLAIKMGVQ 615
           K+  RE  MR++  L R  GV   R  + EP      +  A++E +G  D SLAIK+GV 
Sbjct: 105 KEGQREATMRRVGYLARR-GV--FRGWLTEPGPDAELRKLALLECLGMYDHSLAIKIGVH 161

Query: 616 YSLWGGSVLNLGXK 657
           + LWG ++  LG K
Sbjct: 162 FFLWGSAIKFLGTK 175



>pir|H86198|H86198 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_889648 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:T2D23_1723936 Sequence of BAC T2D23 from
           Arabidopsis thaliana chromosome 1, complete sequence.
          Length = 675

 Score = 37.7 bits (86), Expect = 0.18
 Identities = 18/41 (43%), Positives = 23/41 (56%)
 Frame = +1

Query: 535 EEPSKYFAIVEAVGAVDVSLAIKMGVQYSLWGGSVLNLGXK 657
           E   K FA+ E  G  D SL+ K+GV + LWG +V   G K
Sbjct: 127 EAELKKFALYEVCGIYDYSLSAKLGVHFLLWGNAVKFFGTK 167



>gb:BC022268_1977753 Homo sapiens acyl-Coenzyme A oxidase-like, mRNA
           (cDNA clone IMAGE:4730078), partial cds.
          Length = 333

 Score = 37.0 bits (84), Expect = 0.30
 Identities = 26/95 (27%), Positives = 44/95 (46%), Gaps = 5/95 (5%)
 Frame = +1

Query: 382 ELQEKVYEYFSSRPGLQTPLDILKDEHRELCMRQLS-----GLVREAGVRPLRYVVEEPS 546
           E QE+       RP  +   D+  DE R L ++++       L++ AG           S
Sbjct: 29  EPQERAARTPRRRPLFRQRYDLSLDEMRALTVQRVKFAMDLPLLKRAGQDLAEKTKNFVS 88

Query: 547 KYFAIVEAVGAVDVSLAIKMGVQYSLWGGSVLNLG 651
           +   I E +   D++  +K G+ Y L+GG++ NLG
Sbjct: 89  RSLVIGEVLSMADMATGVKCGIIYWLFGGAIRNLG 123



>gb:AP006618_558875 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 643

 Score = 37.0 bits (84), Expect = 0.30
 Identities = 18/42 (42%), Positives = 26/42 (61%)
 Frame = +1

Query: 532 VEEPSKYFAIVEAVGAVDVSLAIKMGVQYSLWGGSVLNLGXK 657
           V +P      +E V   D+SL +K GVQ+ L+GG+V NLG +
Sbjct: 75  VGDPGGAVTALEMVAYADLSLWVKSGVQWGLFGGAVENLGTE 116



>gb:AE017234_412806 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 8 of 16 of the complete
           genome.>gb:AE016958_1056210 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 650

 Score = 35.4 bits (80), Expect = 0.87
 Identities = 15/33 (45%), Positives = 24/33 (72%)
 Frame = +1

Query: 559 IVEAVGAVDVSLAIKMGVQYSLWGGSVLNLGXK 657
           ++E +   D+SL +K GVQ+ L+GG+V NLG +
Sbjct: 84  MIEMLAMSDLSLMVKAGVQWGLFGGAVENLGTE 116



>gb:AF207994_1776991 Arabidopsis thaliana acyl-CoA oxidase ACX3
           (ACX3) mRNA, complete cds.
          Length = 675

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 16/41 (39%), Positives = 24/41 (58%)
 Frame = +1

Query: 535 EEPSKYFAIVEAVGAVDVSLAIKMGVQYSLWGGSVLNLGXK 657
           E   +  A++E  G  D S++IK+GV + LWG +V   G K
Sbjct: 127 EAELRKLALLEVCGIYDHSVSIKVGVHFFLWGNAVKFFGTK 167



>gb:F9P14_1678768 Sequence of BAC F9P14 from Arabidopsis thaliana
           chromosome 1, complete sequence.
          Length = 305

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 16/41 (39%), Positives = 24/41 (58%)
 Frame = +1

Query: 535 EEPSKYFAIVEAVGAVDVSLAIKMGVQYSLWGGSVLNLGXK 657
           E   +  A++E  G  D S++IK+GV + LWG +V   G K
Sbjct: 127 EAELRKLALLEVCGIYDHSVSIKVGVHFFLWGNAVKFFGTK 167



>gb:AY099579_1576605 Arabidopsis thaliana acyl-CoA oxidase ACX3
           (At1g06290) mRNA, complete cds.>gb:BT008413_1639630
           Arabidopsis thaliana At1g06290 gene, complete
           cds.>gb:AF253474_1781051 Arabidopsis thaliana acyl-CoA
           oxidase (ACX3) mRNA, complete cds.>gb:AK176257_1818245
           Arabidopsis thaliana mRNA for hypothetical protein,
           complete cds, clone: RAFL23-16-C12.
          Length = 675

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 16/41 (39%), Positives = 24/41 (58%)
 Frame = +1

Query: 535 EEPSKYFAIVEAVGAVDVSLAIKMGVQYSLWGGSVLNLGXK 657
           E   +  A++E  G  D S++IK+GV + LWG +V   G K
Sbjct: 127 EAELRKLALLEVCGIYDHSVSIKVGVHFFLWGNAVKFFGTK 167



>gb:AK004775_1152585 Mus musculus adult male lung cDNA, RIKEN
           full-length enriched library, clone:1200014P05
           product:hypothetical Acyl-CoA dehydrogenase containing
           protein, full insert sequence.
          Length = 632

 Score = 34.3 bits (77), Expect = 1.9
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 5/46 (10%)
 Frame = +1

Query: 529 VVEEPSKYFA-----IVEAVGAVDVSLAIKMGVQYSLWGGSVLNLG 651
           ++EE  K F      + E +  VDVS++IK G+ + L+GG++ NLG
Sbjct: 50  IMEEKRKSFISQILILGEVLCMVDVSMSIKCGILFLLFGGAISNLG 95



>gb:AC116979_1207074 Dictyostelium discoideum chromosome 2 map
           6445720-6776760 strain AX4, complete sequence.
          Length = 628

 Score = 33.9 bits (76), Expect = 2.5
 Identities = 18/64 (28%), Positives = 35/64 (54%)
 Frame = +1

Query: 460 HRELCMRQLSGLVREAGVRPLRYVVEEPSKYFAIVEAVGAVDVSLAIKMGVQYSLWGGSV 639
           +R+L + Q    V  +G+  L  +     +Y  +VE     + ++  K+GV Y+L+GG++
Sbjct: 82  YRQLVLEQCVA-VANSGLIHLTDIKNNLHRYAGVVEMFSLYNNNVCTKLGVHYTLFGGTI 140

Query: 640 LNLG 651
           + LG
Sbjct: 141 MFLG 144



>gb:BA000016_674772 Clostridium perfringens str. 13 DNA, complete
           genome.
          Length = 548

 Score = 33.1 bits (74), Expect = 4.3
 Identities = 21/69 (30%), Positives = 33/69 (47%)
 Frame = +1

Query: 439 LDILKDEHRELCMRQLSGLVREAGVRPLRYVVEEPSKYFAIVEAVGAVDVSLAIKMGVQY 618
           +D +++EHRE+    L G+  EA          E  KY  I  A+G    ++   +GV Y
Sbjct: 300 IDNMREEHREM----LEGMYEEAAETEESVAAGEFKKYAFISVAMGEGMKNIFKDLGVDY 355

Query: 619 SLWGGSVLN 645
            + GG  +N
Sbjct: 356 VIEGGQTMN 364



>pir|A86237|A86237 protein F14N23.15 [imported] - Arabidopsis
           thaliana>gb:AE005172_890031 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC005489_1532711 Genomic sequence for
           Arabidopsis thaliana BAC F14N23 from Chromosome 1,
           complete sequence.
          Length = 913

 Score = 33.1 bits (74), Expect = 4.3
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 1/71 (1%)
 Frame = -3

Query: 627 PETVLNTHFDGKRYVNGPNSLHNSEILTRL-LHHVPERPYPGLPDQTRELSHAQFPVLIL 451
           PET    + D ++Y N  N + N     ++  +H P  PYP +P +T   S A+      
Sbjct: 42  PETTTGNNQDSEKYPN-LNPIPNDPSQFQIPQNHTPPIPYPPIPHRTMAFSSAEEAAAER 100

Query: 450 QNIQRRLQARP 418
           +  +RRL+  P
Sbjct: 101 RRRKRRLRIEP 111



>gb:AF236663_1779597 Aspergillus nidulans SCF complex protein cul-1
           homolog (culA) gene, partial cds.
          Length = 771

 Score = 32.7 bits (73), Expect = 5.6
 Identities = 14/41 (34%), Positives = 25/41 (60%)
 Frame = +1

Query: 394 KVYEYFSSRPGLQTPLDILKDEHRELCMRQLSGLVREAGVR 516
           ++Y Y+  RP L+      +DE R+LC +Q  G +++A +R
Sbjct: 226 EIYRYYFQRPFLEATRIYYEDESRQLCGQQRCGDMKKAEIR 266



>pir|A72588|A72588 hypothetical protein APE1174 - Aeropyrum pernix
           (strain K1)>gb:BA000002_651903 Aeropyrum pernix K1 DNA,
           complete genome.
          Length = 106

 Score = 32.7 bits (73), Expect = 5.6
 Identities = 20/53 (37%), Positives = 24/53 (45%)
 Frame = -3

Query: 630 SPETVLNTHFDGKRYVNGPNSLHNSEILTRLLHHVPERPYPGLPDQTRELSHA 472
           +PE  LN H  G     GPN+LHN+   T  L H P +     P Q     HA
Sbjct: 40  NPENSLNPHTPGGGL--GPNTLHNTPQHTPRLKHAPAQQQHTPPPQLNTPGHA 90



>gb:AE008692_241656 Zymomonas mobilis subsp. mobilis ZM4, complete
           genome.
          Length = 421

 Score = 32.3 bits (72), Expect = 7.4
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 5/106 (4%)
 Frame = +1

Query: 322 AKVLTVNTKELSVYLRGEHRELQEKVYEYFSSRPGLQTPLDILKDEH--RELCMRQLSGL 495
           A +  + TKE  +YL  + REL + +  ++++  G   P    K E   RE+      G+
Sbjct: 26  APIPAIATKESRIYL-ADGRELIDGIASWWTACHGYNHPYIYKKAEEQLREMPHIMFGGI 84

Query: 496 VREAGVR---PLRYVVEEPSKYFAIVEAVGAVDVSLAIKMGVQYSL 624
           V E  +R    L  ++ +   +    ++ G+V V +A+KM +QY L
Sbjct: 85  VHEPALRLASRLAKILPDNLNHVFFSDS-GSVAVEVALKMAMQYWL 129



>gb:AP003329_1827997 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:B1045F02.>gb:AP003336_1828185 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1151H08.
          Length = 247

 Score = 32.0 bits (71), Expect = 9.6
 Identities = 23/69 (33%), Positives = 29/69 (42%), Gaps = 4/69 (5%)
 Frame = -2

Query: 340 SPSEPSP*RHTSASP----GGCPRSCPGTSPA*GALTAVGCGG*SVASPPDFRPPPCDSD 173
           SPSE  P R   + P     G P S P TS   G  +       S +S P FRPP   + 
Sbjct: 40  SPSELCPRRRPLSPPLPPSSGSPPSSPRTSSRFGIASIGFAASSSTSSAPPFRPPTAGAP 99

Query: 172 VATSSSDDP 146
            + S+   P
Sbjct: 100 PSPSTRTAP 108



>gb:AE017283_431198 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 205

 Score = 32.0 bits (71), Expect = 9.6
 Identities = 22/63 (34%), Positives = 27/63 (42%), Gaps = 4/63 (6%)
 Frame = +3

Query: 156 EDDVATSESHGGGRKSGGDATD*PPH-PTAVNAPHAGDVPGQ---LRGQPPGDADVCR*G 323
           +D  A  ++ G  +  G  +T  P H PT  NAP  G  P Q      Q P DA V   G
Sbjct: 116 QDHAARKQARGDSQTKGPRSTKTPDHNPTGNNAPTTGTAPSQGASKAQQTPTDAPVATSG 175

Query: 324 EGS 332
             S
Sbjct: 176 PAS 178


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 635,189,302
Number of Sequences: 1806583
Number of extensions: 13037308
Number of successful extensions: 51809
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 48407
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 51555
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 36147673485
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)