BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig6204
         (1261 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY100638_1576945 Prunus cerasus putative sorbitol transporter...   212   1e-53   
gb:AB125648_1528221 Malus x domestica MdSOT5 mRNA for sorbitol t...   211   3e-53   
gb:BVU64903_1643231 Beta vulgaris putative sugar transporter (Bv...   209   1e-52   
pir|T14606|T14606 probable sugar transport protein 205 - beet>gb...   209   1e-52   Beta vulgaris subsp. vulgaris [field beet]
gb:AB026654_1517315 Arabidopsis thaliana genomic DNA, chromosome...   208   2e-52   
pir|A84537|A84537 probable sugar transporter [imported] - Arabid...   205   2e-51   Arabidopsis thaliana [mouse-ear cress]
pir|H84536|H84536 probable sugar transporter [imported] - Arabid...   203   5e-51   Arabidopsis thaliana [mouse-ear cress]
gb:AB125646_1528219 Malus x domestica MdSOT3 mRNA for sorbitol t...   202   9e-51   
gb:AP004185_1838702 Oryza sativa (japonica cultivar-group) genom...   199   1e-49   
gb:AF416867_1797855 Oryza sativa putative sugar transporter mRNA...   199   1e-49   
gb:AF482011_1803939 Prunus cerasus sorbitol transporter mRNA, co...   197   3e-49   
gb:GMA563367_1680380 Glycine max mRNA for sorbitol-like transpor...   196   1e-48   
gb:AY237401_1592184 Malus x domestica sorbitol transporter (SOT2...   194   4e-48   
gb:AX353435_1466054 Sequence 1 from Patent WO0204647.>gb:AF21583...   192   2e-47   
gb:PMA532590_1700701 Plantago major macronuclear mRNA for polyol...   190   6e-47   
gb:AP004185_1838703 Oryza sativa (japonica cultivar-group) genom...   189   1e-46   
gb:PMA532589_1700700 Plantago major macronuclear mRNA for polyol...   186   9e-46   
pir|G84564|G84564 probable sugar transporter [imported] - Arabid...   182   1e-44   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00017_1693333 Oryza sativa genomic DNA, chromosome 4, BAC...   181   3e-44   
gb:AY136668_1581986 Orobanche ramosa putative mannitol transport...   181   3e-44   
gb:OSJN00017_1693334 Oryza sativa genomic DNA, chromosome 4, BAC...   179   1e-43   
pir|A85433|A85433 sugar transporter like protein [imported] - Ar...   176   1e-42   Arabidopsis thaliana [mouse-ear cress]
gb:AC083945_1733279 Oryza sativa strain Nipponbare chromosome X ...   175   2e-42   
gb:AE016959_1022105 Oryza sativa (japonica cultivar-group) chrom...   174   3e-42   
gb:AY592976_1616675 Malus x domestica sorbitol transporter (SOT1...   172   1e-41   
gb:AY237400_1592183 Malus x domestica sorbitol transporter (SOT1...   172   1e-41   
gb:OSJN00177_1696244 Oryza sativa genomic DNA, chromosome 4, BAC...   171   2e-41   
pir|C84593|C84593 probable sugar transporter [imported] - Arabid...   171   2e-41   Arabidopsis thaliana [mouse-ear cress]
gb:AB125647_1528220 Malus x domestica MdSOT4 mRNA for sorbitol t...   171   3e-41   
gb:AF480069_1803708 Apium graveolens var. dulce mannitol transpo...   148   3e-34   
gb:AP004365_1840828 Oryza sativa (japonica cultivar-group) genom...   147   6e-34   
gb:AY596296_631226 Haloarcula marismortui ATCC 43049 plasmid pNG...   117   5e-25   
gb:AL935262_552983 Lactobacillus plantarum strain WCFS1 complete...   114   3e-24   
gb:AE017333_449610 Bacillus licheniformis DSM 13, complete genom...   112   1e-23   
gb:AY233386_1591687 Mesembryanthemum crystallinum putative Na+/m...   112   2e-23   
pir|E70070|E70070 metabolite transport protein homolog ywtG - Ba...   111   3e-23   Bacillus subtilis
gb:CP000002_857720 Bacillus licheniformis ATCC 14580, complete g...   108   2e-22   
gb:AE017333_447917 Bacillus licheniformis DSM 13, complete genome.    108   2e-22   
gb:AE016744_321897 Staphylococcus epidermidis ATCC 12228, sectio...   108   3e-22   
gb:CP000029_82911 Staphylococcus epidermidis RP62A, complete gen...   107   5e-22   
gb:AB056798_1868459 Macaca fascicularis brain cDNA clone:QflA-11...   107   7e-22   
gb:AX481743_1469491 Sequence 1 from Patent WO02055701.>gb:AX4817...   105   1e-21   
gb:AY063901_1565848 Arabidopsis thaliana putative membrane trans...   105   3e-21   
gb:AB005554_840 Bacillus subtilis genomic DNA, 36 kb region betw...   104   3e-21   
pir|D86426|D86426 hypothetical protein F12P21.2 - Arabidopsis th...   104   3e-21   Arabidopsis thaliana [mouse-ear cress]
sp|P46333|CSBC_BACSU|CSBC_BACSU Probable metabolite transport protein csbC....   104   3e-21   Bacillus subtilis
gb:BC047507_1983888 Homo sapiens solute carrier family 2 (facili...   103   6e-21   
gb:OSJN00059_1694084 Oryza sativa genomic DNA, chromosome 4, BAC...   103   6e-21   
gb:AX076673_1460657 Sequence 7 from Patent WO0104145.                 103   6e-21   
gb:BA000028_697183 Oceanobacillus iheyensis HTE831 DNA, complete...   103   6e-21   
sp|Q96QE2|MYCT_HUMAN|MYCT_HUMAN Proton myo-inositol cotransporter (Hmit).>g...   103   6e-21   Homo sapiens [man]
pir|G86812|G86812 D-xylose proton-symporter [imported] - Lactoco...   103   7e-21   Lactococcus lactis subsp. lactis
sp|O52733|XYLT_LACBR|XYLT_LACBR D-xylose-proton symporter (D-xylose transpo...   103   1e-20   Lactobacillus brevis
gb:AY514443_1430740 Bos taurus facilitative glucose transporter ...   101   4e-20   
pir|F71431|F71431 hypothetical protein - Arabidopsis thaliana>gb...   101   4e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AX076675_1460658 Sequence 9 from Patent WO0104145.>gb:RNO3156...   100   8e-20   
gb:CP000009_862670 Gluconobacter oxydans 621H, complete genome.       100   8e-20   
gb:AK035972_1164307 Mus musculus 16 days neonate cerebellum cDNA...    99   1e-19   
gb:AK028970_1161263 Mus musculus 10 days neonate skin cDNA, RIKE...    99   1e-19   
pir|G84864|G84864 probable membrane transporter [imported] - Ara...    99   2e-19   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1023991 Oryza sativa (japonica cultivar-group) chrom...    99   2e-19   
gb:AF280431_1782884 Mesembryanthemum crystallinum putative Na+/m...    98   3e-19   
gb:AY871888_2150052 Synthetic construct hypothetical protein (FT...    98   4e-19   
gb:AJ749949_531931 Francisella tularensis subsp. tularensis comp...    98   4e-19   
gb:AP003214_1825326 Oryza sativa (japonica cultivar-group) genom...    96   1e-18   
gb:CEM01F1_1366129 Caenorhabditis elegans cosmid M01F1, complete...    96   2e-18   
gb:CP000009_862941 Gluconobacter oxydans 621H, complete genome.        96   2e-18   
gb:AP005756_1857300 Oryza sativa (japonica cultivar-group) genom...    95   3e-18   
gb:AY094465_1575762 Arabidopsis thaliana AT4g35300/F23E12_140 mR...    95   3e-18   
pir|T06127|T06127 probable sugar transport protein F23E12.140 - ...    95   3e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AP003704_1832135 Oryza sativa (japonica cultivar-group) genom...    94   4e-18   
gb:AE016766_327516 Escherichia coli CFT073 section 12 of 18 of t...    94   4e-18   
sp|P37021|GALP_ECOLI|GALP_ECOLI Galactose-proton symporter (Galactose trans...    94   4e-18   Escherichia coli [E. coli]
gb:AF215852_1777953 Nicotiana tabacum hexose transporter (pGlcT)...    94   8e-18   
gb:BT015128_1642098 Arabidopsis thaliana At5g17010 gene, complet...    94   8e-18   
pir|C91106|C91106 galactose-proton symport of transport system E...    94   8e-18   Escherichia coli O157:H7
pir|D84772|D84772 probable sugar transporter [imported] - Arabid...    94   8e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AY643749_1619165 Oryza sativa (japonica cultivar-group) monos...    93   1e-17   
gb:AY036055_1560031 Olea europaea hexose transporter pGlT mRNA, ...    93   1e-17   
gb:AX172681_1463062 Sequence 171 from Patent WO0144476.                93   1e-17   
gb:CP000009_863061 Gluconobacter oxydans 621H, complete genome.        93   1e-17   
gb:AF280432_1782885 Mesembryanthemum crystallinum putative Na+/m...    93   1e-17   
gb:AB016890_1513215 Arabidopsis thaliana genomic DNA, chromosome...    93   1e-17   
gb:BX248345_760721 Mycobacterium bovis subsp. bovis AF2122/97 co...    93   1e-17   
gb:AE017241_414539 Mycobacterium avium subsp. paratuberculosis s...    93   1e-17   
gb:AE016765_327425 Escherichia coli CFT073 section 11 of 18 of t...    93   1e-17   
gb:AE000516_23547 Mycobacterium tuberculosis CDC1551, complete g...    93   1e-17   
pir|B70845|B70845 probable sygar transport protein - Mycobacteri...    93   1e-17   Mycobacterium tuberculosis
pir|T27072|T27072 hypothetical protein Y51A2D.4 - Caenorhabditis...    93   1e-17   Caenorhabditis elegans [roundworm]
pir|AC0877|AC0877 galactose-proton symport (galactose transporte...    93   1e-17   Salmonella enterica subsp. enterica serovar Typhi
gb:AE017341_1753926 Cryptococcus neoformans var. neoformans JEC2...    92   2e-17   
gb:CR382129_1661574 Yarrowia lipolytica chromosome C of strain C...    92   2e-17   
gb:ECU29581_133935 Escherichia coli K-12 genome; approximately 6...    92   2e-17   
gb:AE005674_72433 Shigella flexneri 2a str. 301, complete genome...    92   2e-17   
sp|P87110|ITR2_SCHPO|ITR2_SCHPO Myo-inositol transporter 2.>pir|T38125|T381...    92   2e-17   Schizosaccharomyces pombe
sp|P45598|ARAE_KLEOX|ARAE_KLEOX Arabinose-proton symporter (Arabinose trans...    92   2e-17   Klebsiella oxytoca
sp|P09830|ARAE_ECOLI|ARAE_ECOLI Arabinose-proton symporter (Arabinose trans...    92   2e-17   Escherichia coli [E. coli]
gb:AX008640_1456283 Sequence 1 from Patent WO9966042.>gb:AF21585...    92   2e-17   
pir|T23658|T23658 hypothetical protein M01F1.5 - Caenorhabditis ...    92   2e-17   Caenorhabditis elegans [roundworm]
gb:AK052156_1169909 Mus musculus 13 days embryo heart cDNA, RIKE...    92   3e-17   
gb:AF215853_1777954 Solanum tuberosum hexose transporter (pGlcT)...    91   4e-17   
gb:AX008642_1456284 Sequence 3 from Patent WO9966042.                  91   4e-17   
gb:AE005674_72516 Shigella flexneri 2a str. 301, complete genome...    91   4e-17   
gb:AE017239_414154 Mycobacterium avium subsp. paratuberculosis s...    91   5e-17   
gb:AE008838_244664 Salmonella typhimurium LT2, section 142 of 22...    91   5e-17   
pir|AB0868|AB0868 L-arabinose isomerase [imported] - Salmonella ...    91   5e-17   Salmonella enterica subsp. enterica serovar Typhi
gb:AP000615_1820473 Oryza sativa (japonica cultivar-group) genom...    91   6e-17   
gb:AC099739_1737223 Oryza sativa (japonica cultivar-group) chrom...    91   6e-17   
gb:AY165599_1586172 Saccharum hybrid cultivar putative sugar tra...    91   6e-17   
gb:BA000036_717908 Corynebacterium glutamicum ATCC 13032 DNA, co...    91   6e-17   
gb:AE016822_340512 Leifsonia xyli subsp. xyli str. CTCB07, compl...    91   6e-17   
pir|T51556|T51556 sugar transporter-like protein - Arabidopsis t...    91   6e-17   Arabidopsis thaliana [mouse-ear cress]
pir|S69671|S69671 hypothetical protein YDR387c - yeast (Saccharo...    91   6e-17   Saccharomyces cerevisiae [brewer's yeast]
gb:AF215855_1777956 Arabidopsis thaliana hexose transporter (pGl...    90   8e-17   
gb:AY058152_1564290 Arabidopsis thaliana AT5g16150/T21H19_70 mRN...    90   8e-17   
pir|T27077|T27077 hypothetical protein Y51A2D.5 - Caenorhabditis...    90   8e-17   Caenorhabditis elegans [roundworm]
gb:AP003943_1835566 Oryza sativa (japonica cultivar-group) genom...    90   1e-16   
gb:AF286906_1783215 Mesembryanthemum crystallinum putative gluco...    90   1e-16   
gb:AX008644_1456285 Sequence 5 from Patent WO9966042.>gb:AF21585...    90   1e-16   
gb:BX294151_770701 Pirellula sp. strain 1 complete genome; segme...    89   1e-16   
gb:AE012277_281006 Xanthomonas campestris pv. campestris str. AT...    89   1e-16   
pir|H97064|H97064 probable sugar-proton symporter [imported] - C...    89   1e-16   Clostridium acetobutylicum
pir|F97065|F97065 D-xylose-proton symporter [imported] - Clostri...    89   1e-16   Clostridium acetobutylicum
gb:BC073721_2557540 Xenopus laevis MGC83667 protein, mRNA (cDNA ...    89   2e-16   
gb:AY822464_1628880 Oryza sativa (japonica cultivar-group) monos...    89   2e-16   
gb:HVU534445_1682803 Hordeum vulgare mRNA for hexose transporter...    89   2e-16   
gb:CR382132_1665942 Yarrowia lipolytica chromosome F of strain C...    89   2e-16   
gb:AE016959_1023657 Oryza sativa (japonica cultivar-group) chrom...    89   2e-16   
gb:AE013598_296610 Xanthomonas oryzae pv. oryzae KACC10331, comp...    89   2e-16   
sp|O95528|GT10_HUMAN|GT10_HUMAN Solute carrier family 2, facilitated glucos...    89   2e-16   Homo sapiens [man]
gb:NCB8B8_1690269 Neurospora crassa DNA linkage group II BAC clo...    88   3e-16   
gb:AE008692_240031 Zymomonas mobilis subsp. mobilis ZM4, complet...    88   4e-16   
gb:CR382132_1665226 Yarrowia lipolytica chromosome F of strain C...    87   6e-16   
gb:AB007648_1510203 Arabidopsis thaliana genomic DNA, chromosome...    87   6e-16   
gb:AF438553_1799915 Lycopersicon esculentum putative Na+/myo-ino...    87   7e-16   
gb:AC093018_1735832 Oryza sativa chromosome 3 BAC OSJNBb0081B07 ...    87   7e-16   
gb:AY683004_1622139 Zea mays monosaccharide transport protein 1 ...    87   7e-16   
gb:AB052885_1521256 Oryza sativa OsMST3 mRNA for monosaccharide ...    87   7e-16   
gb:AP006841_575043 Bacteroides fragilis YCH46 DNA, complete genome.    87   9e-16   
pir|C87350|C87350 major facilitator family transporter CC0814 [i...    87   9e-16   Caulobacter vibrioides
gb:BC056306_2551747 Danio rerio zgc:66027, mRNA (cDNA clone MGC:...    86   1e-15   
gb:AF159589_484340 Lactobacillus casei ptsHI operon, complete se...    86   1e-15   
gb:AE017283_430772 Propionibacterium acnes KPA171202, complete g...    86   2e-15   
gb:SYGLCP_195529 Synechocystis PCC 6803 glcP gene and ORF2.            86   2e-15   
sp|P15729|GLCP_SYNY3|GLCP_SYNY3 Glucose transport protein.>pir|S10014|S1001...    86   2e-15   Synechocystis sp.
gb:AE014295_312289 Bifidobacterium longum NCC2705, complete genome.    86   2e-15   
gb:AF492010_1804887 Olea europaea monosaccharide transporter (MS...    85   3e-15   
gb:CP000009_862826 Gluconobacter oxydans 621H, complete genome.        85   4e-15   
gb:CR382129_1661679 Yarrowia lipolytica chromosome C of strain C...    84   5e-15   
gb:CR382125_1657291 Kluyveromyces lactis strain NRRL Y-1140 chro...    84   5e-15   
gb:CP000009_863951 Gluconobacter oxydans 621H, complete genome.        84   5e-15   
pir|T45780|T45780 sugar transporter-like protein - Arabidopsis t...    84   5e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AE016818_1748107 Ashbya gossypii (= Eremothecium gossypii) AT...    84   6e-15   
gb:OSJN00261_1697581 Oryza sativa genomic DNA, chromosome 4, BAC...    84   6e-15   
gb:NCB17B1_1689411 Neurospora crassa DNA linkage group II BAC cl...    84   6e-15   
gb:AE011810_276712 Xanthomonas axonopodis pv. citri str. 306, se...    84   6e-15   
gb:AP004126_1837991 Oryza sativa (japonica cultivar-group) genom...    84   8e-15   
gb:CR382128_1660594 Yarrowia lipolytica chromosome B of strain C...    84   8e-15   
gb:AY872172_2150336 Synthetic construct hypothetical protein (FT...    83   1e-14   
gb:AY774484_2149197 Synthetic construct Francisella tularensis c...    83   1e-14   
gb:AP003878_1834723 Oryza sativa (japonica cultivar-group) genom...    83   1e-14   
gb:LES132224_1684465 Lycopersicon esculentum mRNA for hexose tra...    83   1e-14   
gb:AY140054_1582494 Arabidopsis thaliana unknown protein (At3g03...    83   1e-14   
gb:BSARARE_750256 B.subtilis araR and araE genes.                      83   1e-14   
pir|T01844|T01844 probable sugar transport protein F9D12.9 - Ara...    83   1e-14   Arabidopsis thaliana [mouse-ear cress]
sp|P96710|ARAE_BACSU|ARAE_BACSU Arabinose-proton symporter (Arabinose trans...    83   1e-14   Bacillus subtilis
gb:CR382135_1668233 Debaryomyces hansenii chromosome C of strain...    83   1e-14   
gb:AJ698934_1813466 Populus tremula x Populus tremuloides mRNA f...    82   2e-14   
gb:AF000952_1760507 Prunus armeniaca putative sugar transporter ...    82   2e-14   
gb:AE017343_1755565 Cryptococcus neoformans var. neoformans JEC2...    82   2e-14   
gb:CR380955_1651835 Candida glabrata strain CBS138 chromosome I ...    82   2e-14   
gb:BX842632_1644003 Neurospora crassa DNA linkage group I BAC co...    82   2e-14   
gb:AY738713_1626108 Botryotinia fuckeliana fructose transporter ...    82   2e-14   
pir|T51485|T51485 sugar transporter-like protein - Arabidopsis t...    82   2e-14   Arabidopsis thaliana [mouse-ear cress]
pir|T07379|T07379 hexose transport protein - tomato>gb:LES010942...    82   2e-14   Solanum lycopersicum
sp|Q92253|RCO3_NEUCR|RCO3_NEUCR Probable glucose transporter rco-3.>gb:NCU5...    82   2e-14   
sp|Q01440|GTR1_LEIDO|GTR1_LEIDO Membrane transporter D1.>pir|A48442|A48442 ...    82   2e-14   Leishmania donovani
gb:BC067616_2554788 Danio rerio cDNA clone MGC:85776 IMAGE:69607...    82   2e-14   
gb:AP004185_1838707 Oryza sativa (japonica cultivar-group) genom...    82   2e-14   
gb:AX813899_1475669 Sequence 139 from Patent WO03040292.               82   3e-14   
gb:YSCITR1_1729396 Saccharomyces cerevisiae ITR1 gene for myo-in...    81   4e-14   
pir|T12199|T12199 monosaccharid transport protein - fava bean>gb...    81   4e-14   Vicia faba [broad bean]
sp|P30605|ITR1_YEAST|ITR1_YEAST Myo-inositol transporter 1.>pir|S69555|S695...    81   4e-14   Saccharomyces cerevisiae [brewer's yeast]
gb:CR382131_1664419 Yarrowia lipolytica chromosome E of strain C...    81   5e-14   
gb:AY045591_1561182 Arabidopsis thaliana AT5g26340/F9D12_17 mRNA...    81   5e-14   
gb:AF212041_488748 Zymomonas mobilis fosmid clone 42D10, complet...    81   5e-14   
gb:CR378676_97308 Photobacterium profundum SS9 chromosome 2; seg...    81   5e-14   
pir|T01853|T01853 probable hexose transport protein F9D12.17 - A...    81   5e-14   Arabidopsis thaliana [mouse-ear cress]
sp|P30606|ITR2_YEAST|ITR2_YEAST Myo-inositol transporter 2.>pir|B40538|B405...    81   5e-14   Saccharomyces cerevisiae [brewer's yeast]
gb:CR380959_1653719 Candida glabrata strain CBS138 chromosome M ...    80   7e-14   
gb:AC069251_1540747 Genomic sequence for Arabidopsis thaliana BA...    80   7e-14   
pir|T51139|T51139 sugar transport protein [imported] - Arabidops...    80   7e-14   Arabidopsis thaliana [mouse-ear cress]
pir|H86340|H86340 Sugar transporter [imported] - Arabidopsis tha...    80   7e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AP004082_1837424 Oryza sativa (japonica cultivar-group) genom...    80   9e-14   
gb:BA000036_720785 Corynebacterium glutamicum ATCC 13032 DNA, co...    80   9e-14   
pir|S25009|S25009 monosaccharide transport protein STP4 - Arabid...    80   9e-14   Arabidopsis thaliana [mouse-ear cress]
pir|T14864|T14864 probable monosaccharide transport protein Mst-...    80   9e-14   Picea abies
gb:AE016941_362972 Bacteroides thetaiotaomicron VPI-5482, sectio...    80   1e-13   
gb:AE016927_359804 Bacteroides thetaiotaomicron VPI-5482, sectio...    80   1e-13   
gb:AY465112_1607949 Pichia angusta hexose transporter-like GCR1 ...    79   1e-13   
gb:AY081845_1569017 Aspergillus niger monosaccharide transporter...    79   1e-13   
gb:CR380947_1649020 Candida glabrata strain CBS138 chromosome A ...    79   2e-13   
gb:AY663846_1620592 Vitis vinifera hexose transporter HT2 mRNA, ...    79   2e-13   
gb:AE017353_1760188 Cryptococcus neoformans var. neoformans JEC2...    79   3e-13   
gb:BT015814_1642432 Arabidopsis thaliana At1g05030 gene, complet...    79   3e-13   
gb:AE017283_430272 Propionibacterium acnes KPA171202, complete g...    79   3e-13   
gb:OSJN00048_1693871 Oryza sativa genomic DNA, chromosome 4, BAC...    78   3e-13   
gb:CR382135_1668012 Debaryomyces hansenii chromosome C of strain...    78   3e-13   
gb:CR382133_1666850 Debaryomyces hansenii chromosome A of strain...    78   3e-13   
gb:AMMST1_1819236 A.muscaria mRNA for monosaccharide transporter...    78   4e-13   
gb:AJ698935_1813467 Populus tremula x Populus tremuloides mRNA f...    78   4e-13   
gb:AE017344_1755968 Cryptococcus neoformans var. neoformans JEC2...    78   4e-13   
gb:AX172635_1463039 Sequence 125 from Patent WO0144476.                78   4e-13   
gb:AL935262_553032 Lactobacillus plantarum strain WCFS1 complete...    78   4e-13   
pir|D96539|D96539 hypothetical protein F14I3.9 [imported] - Arab...    78   4e-13   Arabidopsis thaliana [mouse-ear cress]
gb:SPAC4F8_1717962 S.pombe chromosome I cosmid c4F8.                   77   6e-13   
gb:AY342321_1600826 Oryza sativa (japonica cultivar-group) monos...    77   6e-13   
gb:ATAC013454_1543521 Arabidopsis thaliana chromosome III BAC F2...    77   6e-13   
gb:AE016959_1023831 Oryza sativa (japonica cultivar-group) chrom...    77   6e-13   
gb:AL935262_553027 Lactobacillus plantarum strain WCFS1 complete...    77   6e-13   
sp|Q10286|ITR1_SCHPO|ITR1_SCHPO Myo-inositol transporter 1.>pir|T43400|T434...    77   6e-13   Schizosaccharomyces pombe
gb:AJ698937_1813469 Populus tremula x Populus tremuloides mRNA f...    77   7e-13   
gb:AE017342_1754926 Cryptococcus neoformans var. neoformans JEC2...    77   7e-13   
gb:CR382123_1656010 Kluyveromyces lactis strain NRRL Y-1140 chro...    77   7e-13   
gb:AE016860_350797 Pseudomonas syringae pv. tomato str. DC3000 s...    77   7e-13   
gb:AF061106_1765165 Petunia x hybrida putative monosaccharide tr...    77   1e-12   
gb:AE016819_1749178 Ashbya gossypii (= Eremothecium gossypii) AT...    77   1e-12   
gb:TACID1_196027 Thermoplasma acidophilum complete genome; segme...    77   1e-12   
gb:AP005195_1849246 Oryza sativa (japonica cultivar-group) genom...    76   1e-12   
gb:CR382121_1654402 Kluyveromyces lactis strain NRRL Y-1140 chro...    76   1e-12   
gb:AY347871_1601402 Debaryomyces hansenii Xylhp gene, partial cds.     76   1e-12   
gb:AY342322_1600827 Oryza sativa (japonica cultivar-group) monos...    76   1e-12   
sp|P32465|HXT1_YEAST|HXT1_YEAST Low-affinity glucose transporter HXT1.>pir|...    76   1e-12   Saccharomyces cerevisiae [brewer's yeast]
sp|P49374|HGT1_KLULA|HGT1_KLULA High-affinity glucose transporter.>gb:CR382...    76   1e-12   Kluyveromyces lactis
gb:AP005116_1848147 Oryza sativa (japonica cultivar-group) genom...    76   2e-12   
gb:CR382134_1667663 Debaryomyces hansenii chromosome B of strain...    75   2e-12   
gb:AY740034_1626167 Saccharomyces mikatae IFO 1815 SIC1 gene, pa...    75   2e-12   
gb:AC120986_1740003 Oryza sativa (japonica cultivar-group) chrom...    75   3e-12   
gb:CR382132_1665743 Yarrowia lipolytica chromosome F of strain C...    75   3e-12   
gb:CR380947_1649064 Candida glabrata strain CBS138 chromosome A ...    75   3e-12   
gb:ATH344335_1552512 Arabidopsis thaliana mRNA for STP5 protein....    75   3e-12   
gb:BA000011_665808 Thermoplasma volcanium GSS1 DNA, complete gen...    75   3e-12   
gb:AE017333_446514 Bacillus licheniformis DSM 13, complete genom...    75   3e-12   
gb:AE016822_340667 Leifsonia xyli subsp. xyli str. CTCB07, compl...    75   3e-12   
gb:AE008907_246011 Salmonella typhimurium LT2, section 211 of 22...    75   3e-12   
pir|G69789|G69789 sugar transporter homolog ydjK - Bacillus subt...    75   3e-12   Bacillus subtilis
pir|S46724|S46724 hexose transport protein HXT4 - yeast (Sacchar...    75   3e-12   Saccharomyces cerevisiae [brewer's yeast]
sp|P32467|HXT4_YEAST|HXT4_YEAST Low-affinity glucose transporter HXT4 (Low-...    75   3e-12   Saccharomyces cerevisiae [brewer's yeast]
sp|O74713|HGT1_CANAL|HGT1_CANAL High-affinity glucose transporter.>gb:CAHGT...    75   3e-12   Candida albicans
gb:MTU38651_1687689 Medicago truncatula sugar tranporter mRNA, c...    75   4e-12   
gb:GMA563366_1680379 Glycine max mRNA for monosaccharide transpo...    75   4e-12   
gb:CR382128_1660396 Yarrowia lipolytica chromosome B of strain C...    75   4e-12   
gb:AY087292_1572325 Arabidopsis thaliana clone 33727 mRNA, compl...    75   4e-12   
gb:AB052883_1521254 Oryza sativa OsMST1 mRNA for monosaccharide ...    75   4e-12   
pir|S12042|S12042 glucose transport protein STP1 - Arabidopsis t...    75   4e-12   Arabidopsis thaliana [mouse-ear cress]
sp|P23586|STP1_ARATH|STP1_ARATH Glucose transporter (Sugar carrier).>pir|E8...    75   4e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AP005699_1856276 Oryza sativa (japonica cultivar-group) genom...    74   5e-12   
gb:UFA310209_1726769 Uromyces fabae hxt1 gene for HXT1p, exons 1...    74   5e-12   
gb:AB052884_1521255 Oryza sativa OsMST2 mRNA for monosaccharide ...    74   5e-12   
gb:AB025631_1516570 Arabidopsis thaliana genomic DNA, chromosome...    74   5e-12   
gb:AP006841_571465 Bacteroides fragilis YCH46 DNA, complete genome.    74   5e-12   
gb:AP004011_1836338 Oryza sativa (japonica cultivar-group) genom...    74   6e-12   
gb:YSCHXT1A_1729371 Saccharomyces cerevisiae hexose transporter ...    74   6e-12   
gb:CR382137_1670454 Debaryomyces hansenii chromosome E of strain...    74   6e-12   
pir|T14545|T14545 probable sugar transporter protein - beet>gb:B...    74   6e-12   Beta vulgaris [beet]
sp|P32466|HXT3_YEAST|HXT3_YEAST Low-affinity glucose transporter HXT3.>pir|...    74   6e-12   Saccharomyces cerevisiae [brewer's yeast]
gb:AP005684_1855963 Oryza sativa (japonica cultivar-group) genom...    74   8e-12   
gb:YSCGAL2A_1728926 Saccharomyces cerevisiae galactose permease ...    74   8e-12   
pir|T52132|T52132 probable sugar transporter protein ERD6 [impor...    74   8e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AY774016_2148729 Synthetic construct Francisella tularensis c...    73   1e-11   
gb:AJ879935_1815140 Emericella nidulans mstF gene for putative m...    73   1e-11   
gb:AJ698936_1813468 Populus tremula x Populus tremuloides mRNA f...    73   1e-11   
gb:AF441395_1800109 Candida albicans putative glucose sensor pro...    73   1e-11   
gb:AC120988_1740034 Oryza sativa (japonica cultivar-group) chrom...    73   1e-11   
gb:OSJN00140_1695558 Oryza sativa genomic DNA, chromosome 4, BAC...    73   1e-11   
gb:AC007858_1536266 Oryza sativa (japonica cultivar-group) chrom...    73   1e-11   
gb:BA000023_693252 Sulfolobus tokodaii str. 7 DNA, complete genome.    73   1e-11   
gb:AE016961_367608 Coxiella burnetii strain RSA 493, section 2 o...    73   1e-11   
sp|P38695|HXT5_YEAST|HXT5_YEAST Probable glucose transporter HXT5.>pir|S437...    73   1e-11   Saccharomyces cerevisiae [brewer's yeast]
sp|P13181|GAL2_YEAST|GAL2_YEAST Galactose transporter (Galactose permease)....    73   1e-11   
gb:AE017356_1760217 Cryptococcus neoformans var. neoformans JEC2...    72   2e-11   
gb:AE017356_1760216 Cryptococcus neoformans var. neoformans JEC2...    72   2e-11   
gb:AE017351_1759535 Cryptococcus neoformans var. neoformans JEC2...    72   2e-11   
gb:AE017348_1758498 Cryptococcus neoformans var. neoformans JEC2...    72   2e-11   
gb:YSCGAL2_1728925 Saccharomyces cerevisiae galactose transporte...    72   2e-11   
gb:VVHEXTRAN_1727494 V.vinifera mRNA for hexose transporter.           72   2e-11   
gb:VVHEXOSET_1727493 Vitis vinifera hexose transporter gene.           72   2e-11   
gb:DGL459484_1675857 Datisca glomerata mRNA for monosaccharide-H...    72   2e-11   
sp|P40885|HXT9_YEAST|HXT9_YEAST Hexose transporter HXT9.>pir|S50708|S50708 ...    72   2e-11   
gb:NCQA_1690613 Neurospora crassa qa gene cluster.                     72   2e-11   
pir|S04254|G31277 quinate transport protein - Neurospora crassa ...    72   2e-11   
sp|Q41144|STC_RICCO|STC_RICCO Sugar carrier protein C.>pir|T10122|T10122 h...    72   2e-11   
sp|P11636|QAY_NEUCR|QAY_NEUCR Quinate permease (Quinate transporter).            72   2e-11   
gb:ANI251561_1819442 Aspergillus nidulans mstA gene for MSTA pro...    72   3e-11   
gb:AE017347_1757937 Cryptococcus neoformans var. neoformans JEC2...    72   3e-11   
gb:BMXYLRABT_749277 B.megaterium xylR gene.                            72   3e-11   
pir|T35662|T35662 probable sugar transporter - Streptomyces coel...    72   3e-11   
gb:AJ698938_1813470 Populus tremula x Populus tremuloides mRNA f...    71   4e-11   
gb:AE017354_458804 Legionella pneumophila subsp. pneumophila str...    71   4e-11   
gb:AE017283_430251 Propionibacterium acnes KPA171202, complete g...    71   4e-11   
gb:CR628337_113658 Legionella pneumophila str. Lens complete gen...    71   4e-11   
gb:CR628336_110600 Legionella pneumophila str. Paris complete ge...    71   4e-11   
pir|S25015|S25015 monosaccharide transport protein MST1 - common...    71   4e-11   
gb:AE016945_363763 Bacteroides thetaiotaomicron VPI-5482, sectio...    71   5e-11   
pir|T05156|T05156 probable glucose transport protein F18E5.100 -...    71   5e-11   
gb:AP000399_1819985 Oryza sativa (japonica cultivar-group) genom...    70   7e-11   
gb:CR382125_1657619 Kluyveromyces lactis strain NRRL Y-1140 chro...    70   7e-11   
gb:CKHUP1_1647706 Chlorella kessleri HUP1 mRNA for H(+)/hexose c...    70   7e-11   
gb:AY059848_1564692 Arabidopsis thaliana similar to integral mem...    70   7e-11   
gb:AE005172_890909 Arabidopsis thaliana chromosome 1, top arm co...    70   7e-11   
gb:BA000030_700543 Streptomyces avermitilis MA-4680 genomic DNA,...    70   7e-11   
gb:AE017354_460019 Legionella pneumophila subsp. pneumophila str...    70   7e-11   
gb:AE016961_367592 Coxiella burnetii strain RSA 493, section 2 o...    70   7e-11   
gb:CR628336_111740 Legionella pneumophila str. Paris complete ge...    70   7e-11   
pir|E96782|E96782 hypothetical protein F22H5.6 [imported] - Arab...    70   7e-11   
sp|P54862|HXTA_YEAST|HXTA_YEAST Hexose transporter HXT11 (Low-affinity gluc...    70   7e-11   
gb:OSJN00140_1695559 Oryza sativa genomic DNA, chromosome 4, BAC...    70   9e-11   
gb:CR380947_1649079 Candida glabrata strain CBS138 chromosome A ...    70   9e-11   
gb:BT005887_1638809 Arabidopsis thaliana At1g77210 gene, complet...    70   9e-11   
gb:AE008907_246012 Salmonella typhimurium LT2, section 211 of 22...    70   9e-11   
pir|T00450|T00450 probable monosaccharide transport protein T14N...    70   9e-11   
pir|S43185|S43185 hexose transport protein HXT6 - yeast (Sacchar...    70   9e-11   
sp|P39004|HXT7_YEAST|HXT7_YEAST High-affinity hexose transporter HXT6.>pir|...    70   9e-11   
sp|P39003|HXT6_YEAST|HXT6_YEAST High-affinity hexose transporter HXT6.>gb:Y...    70   9e-11   
gb:MTR459789_1687656 Medicago truncatula mRNA for putative monos...    70   1e-10   
gb:OSJN00140_1695578 Oryza sativa genomic DNA, chromosome 4, BAC...    69   2e-10   
gb:CR380955_1651528 Candida glabrata strain CBS138 chromosome I ...    69   2e-10   
gb:AE017271_423433 Bacillus cereus ATCC 10987, section 8 of 18 o...    69   2e-10   
sp|Q10710|STA_RICCO|STA_RICCO Sugar carrier protein A.>pir|T10150|T10150 s...    69   2e-10   
sp|Q39524|HUP2_CHLKE|HUP2_CHLKE H(+)/hexose cotransporter 2 (Galactose-H+ s...    69   2e-10   
gb:AP005829_1858633 Oryza sativa (japonica cultivar-group) genom...    69   2e-10   
gb:AP005829_1858632 Oryza sativa (japonica cultivar-group) genom...    69   2e-10   
gb:AF376000_1792984 Blumeria graminis glucose transporter (gltrn...    69   2e-10   
gb:CR380950_1649767 Candida glabrata strain CBS138 chromosome D ...    69   2e-10   
gb:AF173655_1774451 Beta vulgaris clone GTRTUNI glucose transpor...    69   3e-10   
gb:CR382138_1671392 Debaryomyces hansenii chromosome F of strain...    69   3e-10   
gb:CR382125_1657345 Kluyveromyces lactis strain NRRL Y-1140 chro...    69   3e-10   
gb:AP006841_574899 Bacteroides fragilis YCH46 DNA, complete genome.    69   3e-10   
gb:BC088553_2565683 Xenopus tropicalis hypothetical LOC496943, m...    68   3e-10   
gb:BC070704_2555675 Xenopus laevis hypothetical protein MGC83262...    68   3e-10   
gb:AE017352_1759675 Cryptococcus neoformans var. neoformans JEC2...    68   3e-10   
gb:AE017348_1758187 Cryptococcus neoformans var. neoformans JEC2...    68   3e-10   
gb:CR380947_1649080 Candida glabrata strain CBS138 chromosome A ...    68   3e-10   
gb:ATAF001535_1543851 Arabidopsis thaliana chromosome IV cosmid ...    68   3e-10   
gb:AE016962_367946 Coxiella burnetii strain RSA 493, section 3 o...    68   3e-10   
pir|T01506|T01506 probable hexose transport protein T10M13.6 - A...    68   3e-10   
sp|P15686|HUP1_CHLKE|HUP1_CHLKE H(+)/hexose cotransporter 1.>pir|S14144|S14...    68   3e-10   
gb:CNS07TIX_1648169 DNA centromeric region sequence from BAC DP1...    68   5e-10   
sp|P53387|KHT2_KLULA|KHT2_KLULA Hexose transporter 2.>pir|S51081|S51081 glu...    68   5e-10   
gb:NCB7K22_1690195 Neurospora crassa DNA linkage group II BAC cl...    67   6e-10   
gb:AY081847_1569019 Aspergillus niger monosaccharide transporter...    67   6e-10   
gb:BT003466_1356868 Drosophila melanogaster RH04286 full insert ...    67   6e-10   
gb:AE013599_1131306 Drosophila melanogaster chromosome 2R, compl...    67   6e-10   
gb:AE013599_1131305 Drosophila melanogaster chromosome 2R, compl...    67   6e-10   
gb:CR628337_114823 Legionella pneumophila str. Lens complete gen...    67   6e-10   
gb:AP004014_1836379 Oryza sativa (japonica cultivar-group) genom...    67   8e-10   
gb:AE017348_1758396 Cryptococcus neoformans var. neoformans JEC2...    67   8e-10   
gb:AE017344_1755972 Cryptococcus neoformans var. neoformans JEC2...    67   8e-10   
gb:AE016819_1748634 Ashbya gossypii (= Eremothecium gossypii) AT...    67   8e-10   
gb:NC103E1_1688219 Neurospora crassa DNA linkage group V Cosmid ...    67   8e-10   
gb:AY208940_1427255 Bos taurus glucose transporter 8 (GLUT8) mRN...    67   8e-10   
gb:AE014297_1138094 Drosophila melanogaster chromosome 3R, compl...    67   8e-10   
sp|Q07423|HEX6_RICCO|HEX6_RICCO Hexose carrier protein HEX6.>pir|T10124|T10...    67   8e-10   
gb:AP005636_1855209 Oryza sativa (japonica cultivar-group) genom...    67   1e-09   
gb:AY026255_1559018 Arabidopsis thaliana sugar-porter family pro...    67   1e-09   
gb:AB012239_1511661 Arabidopsis thaliana genomic DNA, chromosome...    67   1e-09   
gb:OAR315928_1441701 Ovis aries mRNA for glucose transporter 5 (...    67   1e-09   
sp|P18631|RAG1_KLULA|RAG1_KLULA Low-affinity glucose transporter.>pir|S1129...    67   1e-09   
gb:AL445222_1927432 Human DNA sequence from clone RP11-356B19 on...    66   1e-09   
gb:AL445222_1927431 Human DNA sequence from clone RP11-356B19 on...    66   1e-09   
gb:SCFGLUTRAB_1708322 Saccharum hybrid cultivar H65-7052 glucose...    66   1e-09   
gb:CR382137_1669569 Debaryomyces hansenii chromosome E of strain...    66   1e-09   
gb:AX191507_1463693 Sequence 29 from Patent WO0149728.                 66   1e-09   
gb:AX076667_1460654 Sequence 1 from Patent WO0104145.>gb:HSA2459...    66   1e-09   
sp|P43581|HXT0_YEAST|HXT0_YEAST Hexose transporter HXT10.>pir|S48313|S48313...    66   1e-09   
sp|Q9NY64|GTR8_HUMAN|GTR8_HUMAN Solute carrier family 2, facilitated glucos...    66   1e-09   
gb:AE017350_1759265 Cryptococcus neoformans var. neoformans JEC2...    66   2e-09   
gb:AE017342_1755183 Cryptococcus neoformans var. neoformans JEC2...    66   2e-09   
gb:AE016819_1748802 Ashbya gossypii (= Eremothecium gossypii) AT...    66   2e-09   
gb:OSJN00140_1695556 Oryza sativa genomic DNA, chromosome 4, BAC...    66   2e-09   
gb:NC13E11_1688317 Neurospora crassa DNA linkage group V Cosmid ...    66   2e-09   
gb:CR380947_1649062 Candida glabrata strain CBS138 chromosome A ...    66   2e-09   
gb:BT008550_1639767 Arabidopsis thaliana clone U19677 putative h...    66   2e-09   
gb:AY081849_1569021 Aspergillus niger monosaccharide transporter...    66   2e-09   
gb:AJ749949_531930 Francisella tularensis subsp. tularensis comp...    66   2e-09   
pir|G85059|G85059 probable sugar transporter [imported] - Arabid...    66   2e-09   
gb:AY645944_2541480 Gadus morhua glucose transporter 3 (GLUT3) m...    65   2e-09   
gb:AE017348_1758452 Cryptococcus neoformans var. neoformans JEC2...    65   2e-09   
gb:CR382136_1668654 Debaryomyces hansenii chromosome D of strain...    65   2e-09   
gb:CR380947_1649084 Candida glabrata strain CBS138 chromosome A ...    65   2e-09   
sp|Q90592|GTR2_CHICK|GTR2_CHICK Solute carrier family 2, facilitated glucos...    65   2e-09   
gb:AF083803_1767033 Arabidopsis thaliana clone sps940 unknown mRNA.    65   3e-09   
gb:AE017345_1756883 Cryptococcus neoformans var. neoformans JEC2...    65   3e-09   
gb:AE016819_1748631 Ashbya gossypii (= Eremothecium gossypii) AT...    65   3e-09   
gb:SPA250992_1716132 Saccharomyces pastorianus FSY1 gene for fru...    65   3e-09   
gb:CR382134_1667654 Debaryomyces hansenii chromosome B of strain...    65   3e-09   
gb:CR380947_1649063 Candida glabrata strain CBS138 chromosome A ...    65   3e-09   
gb:ECA555215_1439713 Equus caballus mRNA for GLUT5 fructose tran...    65   3e-09   
sp|P23585|HXT2_YEAST|HXT2_YEAST High-affinity glucose transporter HXT2.>pir...    65   3e-09   
gb:AE017348_1758190 Cryptococcus neoformans var. neoformans JEC2...    65   4e-09   
gb:CR382137_1669579 Debaryomyces hansenii chromosome E of strain...    65   4e-09   
gb:CR382133_1666833 Debaryomyces hansenii chromosome A of strain...    65   4e-09   
gb:AC115612_1205967 Dictyostelium discoideum chromosome 2 map 62...    65   4e-09   
gb:AB009593_1426 Tetragenococcus halophilus rbsC, rbsB, xylR, xy...    65   4e-09   
gb:AY647268_1619872 Sclerotinia sclerotiorum hexose transporter ...    64   5e-09   
pir|I53268|I53268 glut 5 protein - rat>gb:RATGLUT5_2132344 Rattu...    64   5e-09   
sp|P15325|QUTD_EMENI|QUTD_EMENI Quinate permease (Quinate transporter).>pir...    64   5e-09   
sp|P43427|GTR5_RAT|GTR5_RAT Solute carrier family 2, facilitated glucose ...    64   5e-09   
gb:BX649605_1643280 Aspergillus fumigatus BAC pilot project supe...    64   7e-09   
gb:AK081806_1173389 Mus musculus 16 days embryo head cDNA, RIKEN...    64   7e-09   
pir|F96696|F96696 protein F1N21.12 [imported] - Arabidopsis thal...    64   7e-09   
sp|P42833|HXTD_YEAST|HXTD_YEAST Hexose transporter HXT14.>pir|S63299|S63299...    64   7e-09   
sp|Q9JJZ1|GTR8_RAT|GTR8_RAT Solute carrier family 2, facilitated glucose ...    64   7e-09   
sp|Q92339|GHT3_SCHPO|GHT3_SCHPO High-affinity gluconate transporter ght3 (H...    64   7e-09   
gb:AB083371_2463704 Gallus gallus GLUT8 mRNA for glucose transpo...    64   9e-09   
gb:RATGLUTV_2132346 Rattus norvegicus fructose transporter (GLUT...    64   9e-09   
gb:AE017348_1758456 Cryptococcus neoformans var. neoformans JEC2...    64   9e-09   
pir|H90423|H90423 sugar transport protein SSO2516 [imported] - S...    64   9e-09   
sp|Q9JIF3|GTR8_MOUSE|GTR8_MOUSE Solute carrier family 2, facilitated glucos...    64   9e-09   
gb:AE016819_1748633 Ashbya gossypii (= Eremothecium gossypii) AT...    63   1e-08   
gb:AE016817_1747475 Ashbya gossypii (= Eremothecium gossypii) AT...    63   1e-08   
gb:AX076671_1460656 Sequence 5 from Patent WO0104145.>gb:MMU2459...    63   1e-08   
gb:CR857429_1181668 Pongo pygmaeus mRNA; cDNA DKFZp469D0317 (fro...    63   1e-08   
pir|G02864|G02864 fructose transporter - human>gb:HUGLUT6_202877...    63   1e-08   
sp|P40441|YIR0_YEAST|YIR0_YEAST Hypothetical 50.8 kDa protein in SDL1 5'reg...    63   1e-08   
sp|P22732|GTR5_HUMAN|GTR5_HUMAN Solute carrier family 2, facilitated glucos...    63   1e-08   
sp|O74969|GHT2_SCHPO|GHT2_SCHPO High-affinity glucose transporter ght2 (Hex...    63   1e-08   
gb:AB033418_2044870 Rattus norvegicus glut8 mRNA for glucose tra...    63   1e-08   
gb:ATAC009177_1542853 Arabidopsis thaliana chromosome III BAC T1...    63   1e-08   
gb:AF531753_1422215 Equus caballus glucose transporter type 4 (G...    63   1e-08   
pir|C86184|C86184 hypothetical protein [imported] - Arabidopsis ...    63   1e-08   
sp|P40886|HXT8_YEAST|HXT8_YEAST Hexose transporter HXT8.>pir|S50771|S50771 ...    63   1e-08   
gb:AE017356_1760426 Cryptococcus neoformans var. neoformans JEC2...    62   2e-08   
gb:AE017348_1758493 Cryptococcus neoformans var. neoformans JEC2...    62   2e-08   
gb:AE017348_1758447 Cryptococcus neoformans var. neoformans JEC2...    62   2e-08   
gb:AE017348_1758446 Cryptococcus neoformans var. neoformans JEC2...    62   2e-08   
gb:AF518411_1278823 Toxoplasma gondii facilitative glucose trans...    62   2e-08   
gb:AP006841_572787 Bacteroides fragilis YCH46 DNA, complete genome.    62   3e-08   
gb:AE016929_360162 Bacteroides thetaiotaomicron VPI-5482, sectio...    62   3e-08   
pir|T48766|T48766 probable sugar transporter [imported] - Neuros...    62   3e-08   
pir|H85059|H85059 probable sugar transporter [imported] - Arabid...    62   3e-08   
sp|P11168|GTR2_HUMAN|GTR2_HUMAN Solute carrier family 2, facilitated glucos...    62   3e-08   
gb:CR382138_1671552 Debaryomyces hansenii chromosome F of strain...    61   4e-08   
gb:CR382138_1670681 Debaryomyces hansenii chromosome F of strain...    61   4e-08   
gb:AK029720_1161625 Mus musculus adult male testis cDNA, RIKEN f...    61   4e-08   
gb:BA000023_691507 Sulfolobus tokodaii str. 7 DNA, complete genome.    61   4e-08   
pir|C53153|C53153 glucose transport protein SGTP4 - fluke (Schis...    61   4e-08   
gb:AE017348_1758197 Cryptococcus neoformans var. neoformans JEC2...    61   6e-08   
gb:AE017343_1755599 Cryptococcus neoformans var. neoformans JEC2...    61   6e-08   
gb:CR382137_1669720 Debaryomyces hansenii chromosome E of strain...    61   6e-08   
gb:CR382128_1661222 Yarrowia lipolytica chromosome B of strain C...    61   6e-08   
gb:AY058056_1564195 Arabidopsis thaliana AT3g05160/T12H1_13 mRNA...    61   6e-08   
gb:ATAC009177_1542854 Arabidopsis thaliana chromosome III BAC T1...    61   6e-08   
pir|D96589|D96589 hypothetical protein T22H22.15 [imported] - Ar...    61   6e-08   
sp|P53631|HXTG_YEAST|HXTG_YEAST Hexose transporter HXT17.>pir|S63405|S63405...    61   6e-08   
sp|P39924|HXTC_YEAST|HXTC_YEAST Hexose transporter HXT13.>pir|S50520|S50520...    61   6e-08   
gb:AE017345_1756903 Cryptococcus neoformans var. neoformans JEC2...    60   7e-08   
gb:THA269534_1725061 Trichoderma harzianum mRNA for glucose tran...    60   7e-08   
gb:CR382134_1667504 Debaryomyces hansenii chromosome B of strain...    60   7e-08   
gb:CR382121_1654464 Kluyveromyces lactis strain NRRL Y-1140 chro...    60   7e-08   
gb:BC082511_2562746 Xenopus tropicalis slc2a5-prov protein, mRNA...    60   9e-08   
gb:AY231475_2520962 Ctenopharyngodon idella glucose transporter ...    60   9e-08   
gb:AY571960_1957014 Homo sapiens intestinal facilitative glucose...    60   9e-08   
gb:AY444343_1606402 Hypocrea jecorina strain QM 9414 glucose tra...    60   9e-08   
gb:AY166798_1586230 Citrus unshiu sugar transporter (Sut) mRNA, ...    60   9e-08   
gb:AY093035_1574989 Arabidopsis thaliana putative sugar transpor...    60   9e-08   
gb:AB027770_1517536 Schizosaccharomyces pombe gene for Myo-inosi...    60   9e-08   
gb:MMGLUTRA_2115062 Mouse mRNA for liver-type glucose transporte...    60   1e-07   
gb:BC078875_2107028 Rattus norvegicus solute carrier family 2 (f...    60   1e-07   
gb:AE017347_1757780 Cryptococcus neoformans var. neoformans JEC2...    60   1e-07   
gb:CR382139_1672172 Debaryomyces hansenii chromosome G of strain...    60   1e-07   
gb:CR382136_1669470 Debaryomyces hansenii chromosome D of strain...    60   1e-07   
gb:CR382135_1667991 Debaryomyces hansenii chromosome C of strain...    60   1e-07   
gb:D63150_1439121 Bos taurus mRNA for glucose transporter type4,...    60   1e-07   
gb:AE017204_404735 Lactobacillus johnsonii NCC 533, section 5 of...    60   1e-07   
gb:AE016999_375394 Bacillus cereus ATCC 14579 section 2 of 18 of...    60   1e-07   
gb:TACID3_196536 Thermoplasma acidophilum complete genome; segme...    60   1e-07   
sp|P14672|GTR4_HUMAN|GTR4_HUMAN Solute carrier family 2, facilitated glucos...    60   1e-07   
sp|P12336|GTR2_RAT|GTR2_RAT Solute carrier family 2, facilitated glucose ...    60   1e-07   
sp|P14246|GTR2_MOUSE|GTR2_MOUSE Solute carrier family 2, facilitated glucos...    60   1e-07   
sp|O59932|GHT4_SCHPO|GHT4_SCHPO High-affinity hexose transporter ght4 (Hexo...    60   1e-07   
gb:AE017350_1759263 Cryptococcus neoformans var. neoformans JEC2...    59   2e-07   
gb:AY084684_1569772 Arabidopsis thaliana clone 114959 mRNA, comp...    59   2e-07   
gb:AC006072_1533411 Arabidopsis thaliana chromosome 2 clone T9J2...    59   2e-07   
gb:AY505108_1430664 Equus caballus glucose transporter (GLUT4) m...    59   2e-07   
gb:AE013599_1131307 Drosophila melanogaster chromosome 2R, compl...    59   2e-07   
gb:BA000023_690605 Sulfolobus tokodaii str. 7 DNA, complete genome.    59   2e-07   
gb:TACID2_196108 Thermoplasma acidophilum complete genome; segme...    59   2e-07   
sp|Q39525|HUP3_CHLKE|HUP3_CHLKE H(+)/hexose cotransporter 3.>pir|S38435|S38...    59   2e-07   
sp|Q9WV38|GTR5_MOUSE|GTR5_MOUSE Solute carrier family 2, facilitated glucos...    59   2e-07   
gb:ANI278285_1819453 Aspergillus nidulans mstB gene for putative...    59   2e-07   
gb:AE016820_1750029 Ashbya gossypii (= Eremothecium gossypii) AT...    59   2e-07   
gb:CR382135_1667990 Debaryomyces hansenii chromosome C of strain...    59   2e-07   
gb:BA000011_664878 Thermoplasma volcanium GSS1 DNA, complete gen...    59   2e-07   
gb:TACID5_197141 Thermoplasma acidophilum complete genome; segme...    59   2e-07   
pir|G90422|G90422 sugar transport protein SSO2505 [imported] - S...    59   2e-07   
pir|S06920|S06920 glucose transport protein, hepatic - mouse>gb:...    59   2e-07   
pir|T43533|T43533 hexose transport protein Ght2 - fission yeast ...    59   2e-07   
sp|Q9P3U6|GHT1_SCHPO|GHT1_SCHPO High-affinity glucose transporter ght1 (Hex...    59   2e-07   
gb:AP005904_1859852 Oryza sativa (japonica cultivar-group) genom...    59   3e-07   


>gb:AY100638_1576945 Prunus cerasus putative sorbitol transporter
            (SorT2) mRNA, complete cds.
          Length = 538

 Score =  212 bits (539), Expect = 1e-53
 Identities = 106/174 (60%), Positives = 128/174 (73%)
 Frame = +3

Query: 732  PPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXX 911
            P K + NK+AF CA+ AS  SILLGYD+GVMSGAV++IK+  K+S V+ E          
Sbjct: 26   PGKPKRNKYAFACAILASMTSILLGYDIGVMSGAVIYIKKDLKVSDVEIEVLVGILNLYS 85

Query: 912  XXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMI 1091
                 A+G+TSD IGRRYTIVLA A F  GALLMG AP Y +L+ GR VAGIGVGY+LMI
Sbjct: 86   LIGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMFGRFVAGIGVGYALMI 145

Query: 1092 APVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            APVYT+E+SPA +RGFL+S PEVFIN GIL G+VSN   S LP ++ WRLMLG+
Sbjct: 146  APVYTAEVSPASSRGFLTSFPEVFINAGILFGYVSNYGFSKLPTHLGWRLMLGV 199



>gb:AB125648_1528221 Malus x domestica MdSOT5 mRNA for sorbitol
            transporter, complete cds.
          Length = 535

 Score =  211 bits (537), Expect = 3e-53
 Identities = 106/176 (60%), Positives = 129/176 (73%)
 Frame = +3

Query: 726  PHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXX 905
            P  PKR  NK+AF CA+ AS  SILLGYD+GVMSGA ++IK+  KIS V+ E        
Sbjct: 25   PQKPKR--NKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDLKISDVEVEVLLGILNL 82

Query: 906  XXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSL 1085
                   A+G+TSD +GRRYTIVLA A F +GALLMG A  Y +L+ GR VAGIGVGY+L
Sbjct: 83   YSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYSFLMFGRFVAGIGVGYAL 142

Query: 1086 MIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            MIAPVYT+E+SPA +RGFL+S PEVFIN GIL+G+VSN   S LP ++ WRLMLG+
Sbjct: 143  MIAPVYTAEVSPASSRGFLTSFPEVFINSGILLGYVSNYAFSKLPTHLGWRLMLGV 198



>gb:BVU64903_1643231 Beta vulgaris putative sugar transporter
            (BvcDNA-397) mRNA, complete cds.
          Length = 545

 Score =  209 bits (531), Expect = 1e-52
 Identities = 103/174 (59%), Positives = 127/174 (72%)
 Frame = +3

Query: 732  PPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXX 911
            PPKR  NKFAF CA  AS  S+LLGYD+GVMSGA++++KE + IS  Q            
Sbjct: 30   PPKR--NKFAFACATLASMTSVLLGYDIGVMSGAIIYLKEDWHISDTQIGVLVGILNIYC 87

Query: 912  XXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMI 1091
                 A+G+TSD IGRRYTIVLA A F +GALLMG A  Y +L+ GR V GIGVGY+LMI
Sbjct: 88   LFGSFAAGRTSDWIGRRYTIVLAGAIFFVGALLMGFATNYAFLMVGRFVTGIGVGYALMI 147

Query: 1092 APVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            APVYT+E+SPA +RGFL+S PEVFIN GIL+G++SN+  S LP ++SWR MLG+
Sbjct: 148  APVYTAEVSPASSRGFLTSFPEVFINAGILLGYISNLAFSSLPTHLSWRFMLGI 201



>pir|T14606|T14606 probable sugar transport protein 205 -
            beet>gb:BVU64902_1643230 Beta vulgaris putative sugar
            transporter (BvcDNA-205) mRNA, complete cds.
          Length = 549

 Score =  209 bits (531), Expect = 1e-52
 Identities = 103/174 (59%), Positives = 127/174 (72%)
 Frame = +3

Query: 732  PPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXX 911
            PPKR  NKFAF CA  AS  S+LLGYD+GVMSGA++++KE + IS  Q            
Sbjct: 30   PPKR--NKFAFACATLASMTSVLLGYDIGVMSGAIIYLKEDWHISDTQIGVLVGILNIYC 87

Query: 912  XXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMI 1091
                 A+G+TSD IGRRYTIVLA A F +GALLMG A  Y +L+ GR V GIGVGY+LMI
Sbjct: 88   LFGSFAAGRTSDWIGRRYTIVLAGAIFFVGALLMGFATNYAFLMVGRFVTGIGVGYALMI 147

Query: 1092 APVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            APVYT+E+SPA +RGFL+S PEVFIN GIL+G++SN+  S LP ++SWR MLG+
Sbjct: 148  APVYTAEVSPASSRGFLTSFPEVFINAGILLGYISNLAFSSLPTHLSWRFMLGI 201



>gb:AB026654_1517315 Arabidopsis thaliana genomic DNA, chromosome 3,
            P1 clone: MVE11.
          Length = 539

 Score =  208 bits (530), Expect = 2e-52
 Identities = 102/174 (58%), Positives = 128/174 (73%)
 Frame = +3

Query: 732  PPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXX 911
            PPKR  N +AF CA+ AS  SILLGYD+GVMSGA+++IK   KI+ +Q            
Sbjct: 29   PPKR--NNYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKINDLQIGILAGSLNIYS 86

Query: 912  XXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMI 1091
                 A+G+TSD IGRRYTIVLA A F  GA+LMGL+P Y +L+ GR +AGIGVGY+LMI
Sbjct: 87   LIGSCAAGRTSDWIGRRYTIVLAGAIFFAGAILMGLSPNYAFLMFGRFIAGIGVGYALMI 146

Query: 1092 APVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            APVYT+E+SPA +RGFL+S PEVFIN GI++G+VSN+  S LP  + WRLMLG+
Sbjct: 147  APVYTAEVSPASSRGFLNSFPEVFINAGIMLGYVSNLAFSNLPLKVGWRLMLGI 200



>pir|A84537|A84537 probable sugar transporter [imported] - Arabidopsis
            thaliana>gb:AC007134_1535299 Arabidopsis thaliana
            chromosome 2 clone F7H1 map mi398, complete sequence.
          Length = 511

 Score =  205 bits (521), Expect = 2e-51
 Identities = 99/174 (56%), Positives = 126/174 (72%)
 Frame = +3

Query: 732  PPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXX 911
            PP+   ++FAF CA+ AS  SI+LGYD+GVMSGA +FIK+  K+S VQ E          
Sbjct: 17   PPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEILMGILNIYS 76

Query: 912  XXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMI 1091
                 A+G+TSD IGRRYTIVLA   F  GALLMG A  Y +++ GR VAGIGVGY++MI
Sbjct: 77   LIGSGAAGRTSDWIGRRYTIVLAGFFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMI 136

Query: 1092 APVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            APVYT+E++PA +RGFLSS PE+FIN+GIL+G+VSN   + LP +I WR MLG+
Sbjct: 137  APVYTTEVAPASSRGFLSSFPEIFINIGILLGYVSNYFFAKLPEHIGWRFMLGI 190



>pir|H84536|H84536 probable sugar transporter [imported] - Arabidopsis
            thaliana>gb:AC007134_1535298 Arabidopsis thaliana
            chromosome 2 clone F7H1 map mi398, complete sequence.
          Length = 511

 Score =  203 bits (517), Expect = 5e-51
 Identities = 97/174 (55%), Positives = 127/174 (72%)
 Frame = +3

Query: 732  PPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXX 911
            PP+   +++AF CA+ AS  SI+LGYD+GVMSGA +FIK+  K+S VQ E          
Sbjct: 17   PPRGNRSRYAFACAILASMTSIILGYDIGVMSGASIFIKDDLKLSDVQLEILMGILNIYS 76

Query: 912  XXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMI 1091
                 A+G+TSD +GRRYTIVLA A F  GALLMG A  Y +++ GR VAGIGVGY++MI
Sbjct: 77   LVGSGAAGRTSDWLGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMI 136

Query: 1092 APVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            APVYT+E++PA +RGFL+S PE+FIN+GIL+G+VSN   S LP ++ WR MLG+
Sbjct: 137  APVYTAEVAPASSRGFLTSFPEIFINIGILLGYVSNYFFSKLPEHLGWRFMLGV 190



>gb:AB125646_1528219 Malus x domestica MdSOT3 mRNA for sorbitol
            transporter, complete cds.
          Length = 526

 Score =  202 bits (515), Expect = 9e-51
 Identities = 97/176 (55%), Positives = 125/176 (71%)
 Frame = +3

Query: 732  PPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXX 911
            P K + +KFA  CA+ A T S+LLGYD+GVMSGA L+I++  KIS VQ E          
Sbjct: 26   PMKPKTSKFAIACALLACTTSVLLGYDIGVMSGASLYIQKNLKISDVQVEVLAGTLNIYS 85

Query: 912  XXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMI 1091
                  +G+TSD IGR+YTIVLA   F++GALLMG A  Y +L+ GR VAG+GVGY +MI
Sbjct: 86   LLGSAFAGRTSDWIGRKYTIVLAGVIFLVGALLMGFATNYAFLMVGRFVAGVGVGYGMMI 145

Query: 1092 APVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLSG 1259
            APVYT+E+SPA  RGFL+S PEVF+NVGIL+G+++N   S LP ++ WR MLG+ G
Sbjct: 146  APVYTAEISPASFRGFLTSFPEVFVNVGILLGYIANYAFSKLPLHLGWRFMLGVGG 201



>gb:AP004185_1838702 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OJ1301_C12.
          Length = 510

 Score =  199 bits (505), Expect = 1e-49
 Identities = 103/174 (59%), Positives = 123/174 (70%), Gaps = 1/174 (0%)
 Frame = +3

Query: 735  PKRRLN-KFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXX 911
            PK++ N +FAF CA+ AS  SILLGYD+GVMSGA L+IK+ F IS  + E          
Sbjct: 12   PKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIKKDFNISDGKVEVLMGILNLYS 71

Query: 912  XXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMI 1091
                 A+G+TSD IGRRYTIV AA  F  GA LMG A  Y  L+ GR VAGIGVGY+LMI
Sbjct: 72   LIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYAMLMFGRFVAGIGVGYALMI 131

Query: 1092 APVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            APVYT+E+SPA  RGFL+S PEVFIN GIL+G+VSN   S LP N+ WR+MLG+
Sbjct: 132  APVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSRLPLNLGWRIMLGI 185



>gb:AF416867_1797855 Oryza sativa putative sugar transporter mRNA,
            complete cds.
          Length = 577

 Score =  199 bits (505), Expect = 1e-49
 Identities = 103/174 (59%), Positives = 123/174 (70%), Gaps = 1/174 (0%)
 Frame = +3

Query: 735  PKRRLN-KFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXX 911
            PK++ N +FAF CA+ AS  SILLGYD+GVMSGA L+IK+ F IS  + E          
Sbjct: 79   PKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIKKDFNISDGKVEVLMGILNLYS 138

Query: 912  XXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMI 1091
                 A+G+TSD IGRRYTIV AA  F  GA LMG A  Y  L+ GR VAGIGVGY+LMI
Sbjct: 139  LIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYAMLMFGRFVAGIGVGYALMI 198

Query: 1092 APVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            APVYT+E+SPA  RGFL+S PEVFIN GIL+G+VSN   S LP N+ WR+MLG+
Sbjct: 199  APVYTAEVSPASARGFLTSFPEVFINFGILLGYVSNYAFSRLPLNLGWRIMLGI 252



>gb:AF482011_1803939 Prunus cerasus sorbitol transporter mRNA,
            complete cds.
          Length = 509

 Score =  197 bits (502), Expect = 3e-49
 Identities = 100/173 (57%), Positives = 125/173 (72%)
 Frame = +3

Query: 735  PKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXX 914
            PKR L  +A  CA+ AS  SILLGYD+GVMSGA ++I++  KIS V+ E           
Sbjct: 21   PKRNL--YAIGCAILASMTSILLGYDIGVMSGASIYIQKDLKISDVEVEILIGILNLYSL 78

Query: 915  XXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIA 1094
                A+G+TSD IGRRYTIV A A F  GALLMGLA  Y +L+ GR VAGIGVGY+LMIA
Sbjct: 79   IGSAAAGRTSDWIGRRYTIVFAGAIFFTGALLMGLATNYAFLMVGRFVAGIGVGYALMIA 138

Query: 1095 PVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            PVY +E+SPA +RG L+S PEVF+N+GIL+G+V+N   SGLP ++ WRLMLG+
Sbjct: 139  PVYNAEVSPASSRGALTSFPEVFVNIGILLGYVANYAFSGLPIDLGWRLMLGV 191



>gb:GMA563367_1680380 Glycine max mRNA for sorbitol-like transporter
            (stp gene).
          Length = 523

 Score =  196 bits (497), Expect = 1e-48
 Identities = 96/174 (55%), Positives = 122/174 (70%)
 Frame = +3

Query: 732  PPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXX 911
            P KR+ NK+AF CA+ AS  SILLGYD+GVMSGA ++IK   K+S  Q E          
Sbjct: 22   PKKRKRNKYAFACAMLASMTSILLGYDIGVMSGAAIYIKRDLKVSDEQIEILLGIINLYS 81

Query: 912  XXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMI 1091
                  +G+TSD IGRRYTI L  A F++G+ LMG  P Y +L+ GR VAGIG+GY+LMI
Sbjct: 82   LIGSCLAGRTSDWIGRRYTIGLGGAIFLVGSTLMGFYPHYSFLMCGRFVAGIGIGYALMI 141

Query: 1092 APVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            APVYT+E+SPA +RGFL+S PEVFIN GIL+G++SN   S L   + WR+MLG+
Sbjct: 142  APVYTAEVSPASSRGFLTSFPEVFINGGILLGYISNYGFSKLTLKVGWRMMLGV 195



>gb:AY237401_1592184 Malus x domestica sorbitol transporter (SOT2)
            mRNA, complete cds.
          Length = 481

 Score =  194 bits (492), Expect = 4e-48
 Identities = 96/154 (62%), Positives = 115/154 (74%)
 Frame = +3

Query: 792  SILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTI 971
            SILLGYD+GVMSGA LFIKE  KIS VQ E                +G+TSD IGRRYTI
Sbjct: 3    SILLGYDIGVMSGASLFIKENLKISDVQVEIMNGTLNLYSLIGSALAGRTSDWIGRRYTI 62

Query: 972  VLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSL 1151
            VLA   F IGALLMG AP Y +L+ GR VAG+GVGY+LMIAPVYT+E+SPA  RGFL+S 
Sbjct: 63   VLAGTIFFIGALLMGFAPNYAFLMFGRFVAGVGVGYALMIAPVYTAEISPASFRGFLTSF 122

Query: 1152 PEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            PEVF+N+GIL+G+VSN   S LP +++WR+MLG+
Sbjct: 123  PEVFVNIGILLGYVSNYAFSKLPIHLNWRIMLGV 156



>gb:AX353435_1466054 Sequence 1 from Patent
            WO0204647.>gb:AF215837_1777951 Apium graveolens var.
            dulce mannitol transporter (Mat1) mRNA, complete cds.
          Length = 513

 Score =  192 bits (487), Expect = 2e-47
 Identities = 93/173 (53%), Positives = 122/173 (70%)
 Frame = +3

Query: 735  PKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXX 914
            PK + NK+AF CA+ AS NSILLGYD GV+SGA ++IKE    S VQ E           
Sbjct: 16   PKPKRNKYAFACALLASMNSILLGYDTGVLSGASIYIKEDLHFSDVQIEIIIGIINIYSL 75

Query: 915  XXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIA 1094
                 +G+TSD IGRRYT+VLA   F +GA+ MGLA  + +L+ GR VAGIGVGY++MIA
Sbjct: 76   LGSAIAGRTSDWIGRRYTMVLAGIIFFLGAIFMGLATNFAFLMFGRFVAGIGVGYAMMIA 135

Query: 1095 PVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            PVYT+E++P+ +RGFL+S PEVFIN G+L+G+VSN   +  P  + WR+MLG+
Sbjct: 136  PVYTAEVAPSSSRGFLTSFPEVFINSGVLLGYVSNFAFAKCPLWLGWRIMLGI 188



>gb:PMA532590_1700701 Plantago major macronuclear mRNA for polyol
            transporter (plt2 gene).
          Length = 530

 Score =  190 bits (482), Expect = 6e-47
 Identities = 94/176 (53%), Positives = 120/176 (68%)
 Frame = +3

Query: 726  PHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXX 905
            P  P  R NK+A   ++ AS  S+LLGYD GVMSGA L+IK+  KIS VQ E        
Sbjct: 34   PKKPVTR-NKYALAISILASMTSVLLGYDTGVMSGATLYIKDDLKISDVQVELLVGTINI 92

Query: 906  XXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSL 1085
                    +G+TSD +GRRYT V A+  F +GA+LMG+A  Y +L+AGR VAGIGVGY+L
Sbjct: 93   YSLVGSAVAGRTSDWVGRRYTTVFASVVFFVGAILMGIATNYVFLMAGRFVAGIGVGYAL 152

Query: 1086 MIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            MIAPVY +E++PA  RGFL+S PEVFIN G+L+GFVSN   +  P  + WR+MLG+
Sbjct: 153  MIAPVYAAEVAPASCRGFLTSFPEVFINFGVLLGFVSNYAFAKFPLKLGWRMMLGV 208



>gb:AP004185_1838703 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OJ1301_C12.
          Length = 511

 Score =  189 bits (479), Expect = 1e-46
 Identities = 93/173 (53%), Positives = 124/173 (71%)
 Frame = +3

Query: 735  PKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXX 914
            PK++   +AF CA+ AS  SI+LGYD+GVMSGA L+IK+  KI+ VQ E           
Sbjct: 14   PKKKNASYAFTCAILASMASIILGYDIGVMSGASLYIKKDLKITDVQVEILMGILNIYSL 73

Query: 915  XXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIA 1094
                A+G+T+D IGRR+T+V AAA F   ALLMG +  Y  L+ GR VAG+GVGY++MIA
Sbjct: 74   VGSFAAGRTADWIGRRFTVVFAAAFFFARALLMGFSGDYATLMVGRFVAGVGVGYAIMIA 133

Query: 1095 PVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            PVYT+E+SPA +RGFL+S PEV IN+GIL+G+VSN   + LP ++ WR+MLG+
Sbjct: 134  PVYTAEISPASSRGFLTSFPEVSINLGILLGYVSNYAFARLPLSLGWRVMLGV 186



>gb:PMA532589_1700700 Plantago major macronuclear mRNA for polyol
            transporter (plt1 gene).
          Length = 529

 Score =  186 bits (472), Expect = 9e-46
 Identities = 92/176 (52%), Positives = 119/176 (67%)
 Frame = +3

Query: 726  PHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXX 905
            P  P +R NK+A   ++ AS  S+LLGYD GVMSGA  FI+E   I+ VQ E        
Sbjct: 33   PKKPLKR-NKYALAISILASMTSVLLGYDCGVMSGATQFIQEDLIITDVQVELLVGTINI 91

Query: 906  XXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSL 1085
                    +G+TSD +GRRYTIV A+  F +GA+LMG A  Y +L+ GR VAGIGVGY+L
Sbjct: 92   YSLVGSAVAGRTSDWVGRRYTIVFASTIFFLGAILMGFATNYAFLMVGRFVAGIGVGYAL 151

Query: 1086 MIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            MIAPVY +E++PA  RGFL+S PEVFIN G+L+G+VSN   + LP  + WR+MLG+
Sbjct: 152  MIAPVYAAEVAPASCRGFLTSFPEVFINFGVLLGYVSNFAFAKLPLTLGWRMMLGV 207



>pir|G84564|G84564 probable sugar transporter [imported] - Arabidopsis
            thaliana>gb:AC006135_1533488 Arabidopsis thaliana
            chromosome 2 clone F24H14 map CIC06E08, complete
            sequence.>gb:AC006439_1534280 Arabidopsis thaliana
            chromosome 2 clone T30D6 map mi39, complete sequence.
          Length = 508

 Score =  182 bits (463), Expect = 1e-44
 Identities = 89/174 (51%), Positives = 120/174 (68%)
 Frame = +3

Query: 735  PKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXX 914
            P   +NKFAF CA+ AS  SI+ GYD GVMSGA +FI++  KI+  Q E           
Sbjct: 14   PNPHMNKFAFGCAIVASIISIIFGYDTGVMSGAQIFIRDDLKINDTQIEVLAGILNLCAL 73

Query: 915  XXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIA 1094
                 +GKTSD+IGRRYTI L+A  F++G++LMG  P Y  L+ GR +AG+GVG++LMIA
Sbjct: 74   VGSLTAGKTSDVIGRRYTIALSAVIFLVGSVLMGYGPNYPVLMVGRCIAGVGVGFALMIA 133

Query: 1095 PVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            PVY++E+S A  RGFL+SLPE+ I++GIL+G+VSN     L   + WRLMLG++
Sbjct: 134  PVYSAEISSASHRGFLTSLPELCISLGILLGYVSNYCFGKLTLKLGWRLMLGIA 187



>gb:OSJN00017_1693333 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0017I01, complete sequence.
          Length = 538

 Score =  181 bits (459), Expect = 3e-44
 Identities = 87/182 (47%), Positives = 122/182 (67%)
 Frame = +3

Query: 708  GGAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXX 887
            GG  G          ++ F C+VFAS NS+LLGYD+GVMSG +LFI+    I+ VQ E  
Sbjct: 44   GGGGGVRVRRSHSSRRYVFACSVFASLNSVLLGYDVGVMSGCILFIQRDLHINEVQQEVL 103

Query: 888  XXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGI 1067
                         A G+TSD +GR++TI LAA  F  GA +M LAP++  L+ GR++AG+
Sbjct: 104  VGCLSFISLLGSLAGGRTSDAVGRKWTIGLAAIVFQAGAAVMTLAPSFEVLMVGRLLAGV 163

Query: 1068 GVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLML 1247
            G+G+ +MIAPVY +E+SPA +RG  +S PE+FIN+GIL+G++SN   SGLP ++SWR+ML
Sbjct: 164  GIGFGVMIAPVYIAEISPAASRGSFTSFPEIFINLGILLGYISNYAFSGLPDHVSWRVML 223

Query: 1248 GL 1253
             +
Sbjct: 224  AV 225



>gb:AY136668_1581986 Orobanche ramosa putative mannitol transporter
            (MaT1) mRNA, complete cds.
          Length = 519

 Score =  181 bits (459), Expect = 3e-44
 Identities = 94/195 (48%), Positives = 124/195 (63%)
 Frame = +3

Query: 669  TEPMEITMVESRPGGAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIK 848
            TE +       R GG+       K + N +A L +V AS  SILLGYD GVMSGA L+IK
Sbjct: 2    TEQLGAAAKFRRSGGSPTKALINKPKKNMYALLISVMASMTSILLGYDTGVMSGATLYIK 61

Query: 849  ETFKISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPT 1028
            +  KI+ VQ E                +G+TSD +GRR TIV+A+  F +GA +MGLA  
Sbjct: 62   KDLKITDVQVEILVGLINIYSLIGSAVAGRTSDYLGRRITIVIASVIFFVGAAVMGLANN 121

Query: 1029 YGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILL 1208
            Y  L+ GR VAG+GVGY+LMIAPVY +E++PA +RGFL+S PEVFIN G+L+G++SN   
Sbjct: 122  YAVLMVGRFVAGLGVGYALMIAPVYAAEVAPASSRGFLTSFPEVFINFGVLLGYLSNYAF 181

Query: 1209 SGLPANISWRLMLGL 1253
            +     + WRLMLG+
Sbjct: 182  AKFSLKLGWRLMLGV 196



>gb:OSJN00017_1693334 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBb0017I01, complete sequence.
          Length = 535

 Score =  179 bits (453), Expect = 1e-43
 Identities = 89/186 (47%), Positives = 125/186 (67%)
 Frame = +3

Query: 690  MVESRPGGAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISS 869
            +V  R GG  G          ++ F C+VFAS N +LLGYD+GVMSG ++FI++   IS 
Sbjct: 49   VVRVRGGGGSG----------RYVFACSVFASLNHVLLGYDVGVMSGCIIFIQKDLHISE 98

Query: 870  VQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAG 1049
            VQ E               A+G+TSD +GR++TI LAAA F  GA +M LAP++  L+ G
Sbjct: 99   VQQEVLVGCLSFISLLGSLAAGRTSDAVGRKWTIGLAAAVFQAGAAVMTLAPSFAVLMMG 158

Query: 1050 RVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANI 1229
            R++AGIG+G  +M+APVY SE++PA  RG  +S PE+FI++GIL+G+VSN+  SGLP +I
Sbjct: 159  RLLAGIGIGIGIMVAPVYISEITPATLRGSYASFPEIFISLGILLGYVSNLAFSGLPDHI 218

Query: 1230 SWRLML 1247
            +WR+ML
Sbjct: 219  NWRVML 224



>pir|A85433|A85433 sugar transporter like protein [imported] -
            Arabidopsis thaliana>gb:ATAP22_1544030 Arabidopsis
            thaliana DNA chromosome 4, ESSA I AP2 contig fragment No.
            2.>gb:ATCHRIV85_1547622 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 85.
          Length = 493

 Score =  176 bits (445), Expect = 1e-42
 Identities = 85/170 (50%), Positives = 120/170 (70%)
 Frame = +3

Query: 747  LNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXX 926
            +N+FA  CA+ AS  SI+ GYD GVMSGA++FI+E  K + VQ E               
Sbjct: 13   VNRFALQCAIVASIVSIIFGYDTGVMSGAMVFIEEDLKTNDVQIEVLTGILNLCALVGSL 72

Query: 927  ASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYT 1106
             +G+TSD+IGRRYTIVLA+  F++G++LMG  P Y  LL+GR  AG+GVG++LM+APVY+
Sbjct: 73   LAGRTSDIIGRRYTIVLASILFMLGSILMGWGPNYPVLLSGRCTAGLGVGFALMVAPVYS 132

Query: 1107 SELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            +E++ A  RG L+SLP + I++GIL+G++ N   S LP +I WRLMLG++
Sbjct: 133  AEIATASHRGLLASLPHLCISIGILLGYIVNYFFSKLPMHIGWRLMLGIA 182



>gb:AC083945_1733279 Oryza sativa strain Nipponbare chromosome X clone
            OSJNBa0058E19, complete sequence.
          Length = 574

 Score =  175 bits (444), Expect = 2e-42
 Identities = 91/180 (50%), Positives = 118/180 (65%)
 Frame = +3

Query: 714  AHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXX 893
            A G       R NK+A  C++  S  S+L+GYD GVMSGA+LFIKE  K +  Q +    
Sbjct: 68   AMGEEKQNDERKNKYAVGCSIIGSIISVLMGYDTGVMSGAMLFIKEDLKTNDTQVQVLAG 127

Query: 894  XXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGV 1073
                        +G+ SD +GRR TI LAA  F++G++LMGLAP +  LLAGR VAG+GV
Sbjct: 128  ILNVCALVGSLTAGRVSDCVGRRLTISLAACIFLVGSVLMGLAPNFATLLAGRCVAGVGV 187

Query: 1074 GYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            GY+LMIAPVY +E++ A  RG L+SLPE+ I+ GILIG+V+N LL+ LP    WR MLGL
Sbjct: 188  GYALMIAPVYAAEIASADIRGSLTSLPEICISFGILIGYVANYLLAKLPLVYGWRAMLGL 247



>gb:AE016959_1022105 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC093093_1735878 Oryza sativa
            chromosome 10 BAC OSJNBb0076H04 genomic sequence,
            complete sequence.>gb:AE017082_1751924 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 36 of 77
            of the complete sequence.
          Length = 506

 Score =  174 bits (442), Expect = 3e-42
 Identities = 89/170 (52%), Positives = 116/170 (68%)
 Frame = +3

Query: 744  RLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXX 923
            R NK+A  C++  S  S+L+GYD GVMSGA+LFIKE  K +  Q +              
Sbjct: 10   RKNKYAVGCSIIGSIISVLMGYDTGVMSGAMLFIKEDLKTNDTQVQVLAGILNVCALVGS 69

Query: 924  XASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVY 1103
              +G+ SD +GRR TI LAA  F++G++LMGLAP +  LLAGR VAG+GVGY+LMIAPVY
Sbjct: 70   LTAGRVSDCVGRRLTISLAACIFLVGSVLMGLAPNFATLLAGRCVAGVGVGYALMIAPVY 129

Query: 1104 TSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
             +E++ A  RG L+SLPE+ I+ GILIG+V+N LL+ LP    WR MLGL
Sbjct: 130  AAEIASADIRGSLTSLPEICISFGILIGYVANYLLAKLPLVYGWRAMLGL 179



>gb:AY592976_1616675 Malus x domestica sorbitol transporter (SOT1)
            mRNA, complete cds.
          Length = 491

 Score =  172 bits (436), Expect = 1e-41
 Identities = 81/154 (52%), Positives = 111/154 (72%)
 Frame = +3

Query: 792  SILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTI 971
            SIL+GYD+GVMSGA ++I++  K++  Q E                +GKTSD +GRRYTI
Sbjct: 3    SILMGYDIGVMSGASIYIEKDLKVTDTQIEIMIGVIEIYSLIGSAMAGKTSDWVGRRYTI 62

Query: 972  VLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSL 1151
            V++ A F IGA+LMG +  Y +L+ GR VAGIGVGY+L IAPVY++E+SP  +RGFL+S 
Sbjct: 63   VISGAIFFIGAILMGFSTNYTFLMCGRFVAGIGVGYALTIAPVYSAEVSPTSSRGFLTSF 122

Query: 1152 PEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            PEVF+N+GIL+G++SN   S  P ++ WRLMLG+
Sbjct: 123  PEVFVNIGILLGYLSNYAFSFCPLDLGWRLMLGV 156



>gb:AY237400_1592183 Malus x domestica sorbitol transporter (SOT1)
            mRNA, complete cds.
          Length = 491

 Score =  172 bits (436), Expect = 1e-41
 Identities = 81/154 (52%), Positives = 111/154 (72%)
 Frame = +3

Query: 792  SILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTI 971
            SIL+GYD+GVMSGA ++I++  K++  Q E                +GKTSD +GRRYTI
Sbjct: 3    SILMGYDIGVMSGASIYIEKDLKVTDTQIEIMIGVIEIYSLIGSAMAGKTSDWVGRRYTI 62

Query: 972  VLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSL 1151
            V++ A F IGA+LMG +  Y +L+ GR VAGIGVGY+L IAPVY++E+SP  +RGFL+S 
Sbjct: 63   VISGAIFFIGAILMGFSTNYTFLMCGRFVAGIGVGYALTIAPVYSAEVSPTSSRGFLTSF 122

Query: 1152 PEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            PEVF+N+GIL+G++SN   S  P ++ WRLMLG+
Sbjct: 123  PEVFVNIGILLGYLSNYAFSFCPLDLGWRLMLGV 156



>gb:OSJN00177_1696244 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0074L08, complete
            sequence.>gb:OSJN00183_1696328 Oryza sativa genomic DNA,
            chromosome 4, BAC clone: OSJNBa0081C01, complete
            sequence.
          Length = 523

 Score =  171 bits (434), Expect = 2e-41
 Identities = 85/204 (41%), Positives = 128/204 (62%)
 Frame = +3

Query: 642  SGIDSAKGRTEPMEITMVESRPGGAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGV 821
            +G ++A GR +   +      P G        +R   +F   CA+FAS N+ILLGYD+GV
Sbjct: 2    AGAEAANGRNK-YAVLDPSDEPEGRRRPSAWERRSKERFVLACAIFASLNAILLGYDVGV 60

Query: 822  MSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIG 1001
            MSGA+++I++   I+  Q E               + G+TSD IGR++T+ L A  F  G
Sbjct: 61   MSGAIIYIQKDLHITEFQEEILVGCLSVVSLLGSLSGGRTSDAIGRKWTMALGAIVFQAG 120

Query: 1002 ALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGIL 1181
            A +M  AP++  L+ GR++AG+G+G+  M++ VY +E+SPA  RG L+SLPE+ IN+GIL
Sbjct: 121  AAIMTFAPSFTVLMIGRLLAGVGIGFGAMVSAVYIAEISPAAARGTLTSLPEICINLGIL 180

Query: 1182 IGFVSNILLSGLPANISWRLMLGL 1253
            +G+VSN   SGL  +I+WR+MLG+
Sbjct: 181  LGYVSNYAFSGLSEHINWRIMLGV 204



>pir|C84593|C84593 probable sugar transporter [imported] - Arabidopsis
            thaliana>gb:AC006234_1533820 Arabidopsis thaliana
            chromosome 2 clone F5H14 map mi148, complete sequence.
          Length = 547

 Score =  171 bits (434), Expect = 2e-41
 Identities = 93/223 (41%), Positives = 129/223 (57%), Gaps = 21/223 (9%)
 Frame = +3

Query: 648  IDSAKGRTEPMEITMVESRPGGAHGSPHPPKRRLNKFAFLCAVFASTNSILLGY------ 809
            + + K + + M+    ES+    H        R  K+   CA FAS N++LLGY      
Sbjct: 21   VGNKKNKYQRMDSDAEESQN---HREAEARNSRTRKYVMACAFFASLNNVLLGYGRFYLY 77

Query: 810  ---------------DLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTS 944
                           D+GVMSGAVLFI++  KI+ VQ E               A G+TS
Sbjct: 78   NRILLLLLYFVDLQKDVGVMSGAVLFIQQDLKITEVQTEVLIGSLSIISLFGSLAGGRTS 137

Query: 945  DMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPA 1124
            D IGR++T+ LAA  F  GA +M +AP++  L+ GR +AGIG+G  +MIAPVY +E+SP 
Sbjct: 138  DSIGRKWTMALAALVFQTGAAVMAVAPSFEVLMIGRTLAGIGIGLGVMIAPVYIAEISPT 197

Query: 1125 MTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            + RGF +S PE+FIN+GIL+G+VSN   SGL  +ISWR+ML +
Sbjct: 198  VARGFFTSFPEIFINLGILLGYVSNYAFSGLSVHISWRIMLAV 240



>gb:AB125647_1528220 Malus x domestica MdSOT4 mRNA for sorbitol
            transporter, complete cds.
          Length = 491

 Score =  171 bits (433), Expect = 3e-41
 Identities = 81/154 (52%), Positives = 110/154 (71%)
 Frame = +3

Query: 792  SILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTI 971
            SILLGYD+GVMSGA ++I++  K++  Q E                +G+TSD +GRRYTI
Sbjct: 3    SILLGYDIGVMSGAAIYIEKDLKVTDTQIEILLGILNLYSLIGSAMAGRTSDWVGRRYTI 62

Query: 972  VLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSL 1151
            V++ A F  GA+LMGL+  Y +L+ GR VAG+GVGY+L IAPVY +E+SPA +RGFL+S 
Sbjct: 63   VISGAIFFTGAILMGLSTNYTFLMCGRFVAGLGVGYALTIAPVYAAEVSPASSRGFLTSF 122

Query: 1152 PEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            PEVF+NVGIL+G++SN   S    ++ WRLMLG+
Sbjct: 123  PEVFVNVGILLGYISNYAFSFCALDVGWRLMLGV 156



>gb:AF480069_1803708 Apium graveolens var. dulce mannitol transporter
            (MaT2) mRNA, complete cds.
          Length = 523

 Score =  148 bits (373), Expect = 3e-34
 Identities = 82/180 (45%), Positives = 108/180 (60%), Gaps = 7/180 (3%)
 Frame = +3

Query: 735  PKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXX 914
            PKR  NK+AF CA+ AS  S+LLGYD+GVMSGA ++IK+   +S V+ E           
Sbjct: 30   PKR--NKYAFGCAILASMTSVLLGYDIGVMSGAAIYIKDQLHVSDVKLEIVVGIINFFSL 87

Query: 915  XXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIA 1094
                 +G+TSD IGRRYT+VLA A F +GA+LMG A  Y +L+ GR VAGI        +
Sbjct: 88   VGSALAGRTSDWIGRRYTMVLAGAIFFVGAILMGFATNYSFLMFGRFVAGIR-------S 140

Query: 1095 PVYTSELSPAMTRGFLS-------SLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
             +   + S    RGF S        +P  FIN+G+L+G+VSN   S LPAN+ WR MLG+
Sbjct: 141  RLCPHDCSGVHGRGFFSIISWISYFIPGSFINIGVLLGYVSNYAFSKLPANLGWRFMLGI 200



>gb:AP004365_1840828 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC clone:P0458E05.
          Length = 479

 Score =  147 bits (370), Expect = 6e-34
 Identities = 74/132 (56%), Positives = 93/132 (70%)
 Frame = +3

Query: 858  KISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGY 1037
            KI+ V+ E               A+G+TSD IGRR TI+LAA  F +GA++MGL+  Y  
Sbjct: 2    KITDVEVEILLGILNLYSLVGSFAAGRTSDWIGRRLTIILAAVIFFVGAIMMGLSVNYPM 61

Query: 1038 LLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGL 1217
            L+AGR VAGIGVGY+ MIAPVYT+E+SPA +RGFL+S PEVFIN GIL+G+VSN   S L
Sbjct: 62   LMAGRFVAGIGVGYAFMIAPVYTAEVSPASSRGFLTSFPEVFINFGILLGYVSNYAFSRL 121

Query: 1218 PANISWRLMLGL 1253
               + WRLMLG+
Sbjct: 122  RLQLGWRLMLGV 133



>gb:AY596296_631226 Haloarcula marismortui ATCC 43049 plasmid pNG700,
            complete sequence.
          Length = 459

 Score =  117 bits (293), Expect = 5e-25
 Identities = 55/167 (32%), Positives = 97/167 (58%)
 Frame = +3

Query: 750  NKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXA 929
            ++F ++ +  A+ N +L G+D G++SGA LFI+++F +S +                   
Sbjct: 15   DRFVYIVSALAALNGLLFGFDTGIISGAFLFIQDSFVMSPLVEGIIVSGAMAGAAAGAAV 74

Query: 930  SGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTS 1109
             G+ +D +GRR  I++AA  F +G+  M +APT   L+AGR++ G+ +G++ ++ P+Y S
Sbjct: 75   GGQLADRLGRRRLILIAAIVFFVGSFTMAVAPTVPVLVAGRLIDGVAIGFASIVGPLYIS 134

Query: 1110 ELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLG 1250
            E++P   RG L+SL ++ +  GIL+ +  N   +   A   WR MLG
Sbjct: 135  EIAPPEIRGGLTSLNQLMVTTGILLSYFVNYAFADAGA---WRWMLG 178



>gb:AL935262_552983 Lactobacillus plantarum strain WCFS1 complete
            genome; segment 11/11.
          Length = 466

 Score =  114 bits (286), Expect = 3e-24
 Identities = 64/176 (36%), Positives = 101/176 (57%), Gaps = 3/176 (1%)
 Frame = +3

Query: 738  KRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXX 917
            K+  +KF F    F S   IL GYD+GVM+GA+ F+K  + +++                
Sbjct: 5    KKVSSKFIFF---FGSFGGILFGYDIGVMTGALPFLKTDWALTNATLVGWVTSAVMFGAI 61

Query: 918  XXXA-SGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYG--YLLAGRVVAGIGVGYSLM 1088
               A +G+ +D +GRR  I++++  F IG++L G +P  G  YL+  R+  G+ VG +  
Sbjct: 62   FGAAIAGQLADRLGRRRMILMSSLIFAIGSILCGFSPNNGTYYLIGMRIFLGLAVGAASA 121

Query: 1089 IAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            + P Y SE++PA  RG LS + +  I  G+LI ++ + +L  LP N+SWRLMLGL+
Sbjct: 122  LVPAYMSEMAPARLRGSLSGINQTMIVSGMLISYIVDYILKDLPENMSWRLMLGLA 177



>gb:AE017333_449610 Bacillus licheniformis DSM 13, complete
            genome.>gb:CP000002_859398 Bacillus licheniformis ATCC
            14580, complete genome.
          Length = 477

 Score =  112 bits (281), Expect = 1e-23
 Identities = 62/160 (38%), Positives = 90/160 (56%)
 Frame = +3

Query: 777  FASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTSDMIG 956
            F +   +L GYD GV+SGA+LF+K+   +++                    SG+ +D  G
Sbjct: 13   FGALGGVLYGYDTGVISGAILFMKDELGLNAFTEGLVVSAILIGAIFGSGLSGRLTDRFG 72

Query: 957  RRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRG 1136
            RR  I+ AA  + IG L   LAP+  Y++A R+V G+ VG S  I P+Y SEL+P  +RG
Sbjct: 73   RRRAIMSAAVLYCIGGLGTALAPSTEYMVAFRIVLGLAVGCSTTIVPLYLSELAPKESRG 132

Query: 1137 FLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
             LSSL ++ I +GIL+ ++ N   S   A   WR MLGL+
Sbjct: 133  ALSSLNQLMITIGILLSYLINYAFSDAGA---WRWMLGLA 169



>gb:AY233386_1591687 Mesembryanthemum crystallinum putative
            Na+/myo-inositol symporter (Itr3) mRNA, complete cds.
          Length = 498

 Score =  112 bits (280), Expect = 2e-23
 Identities = 70/196 (35%), Positives = 101/196 (51%), Gaps = 7/196 (3%)
 Frame = +3

Query: 693  VESRPGGAHGSPHPPKRRL----NKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETF- 857
            ++S PG +      P+RR+    NKF     V A    +L GYD GV+SGA+L+IK+ F 
Sbjct: 3    LDSIPGSSGYLDSYPERRITYFGNKFVLALTVTAGIGGLLFGYDTGVISGALLYIKDEFP 62

Query: 858  --KISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTY 1031
              K SS   E                +G  +D+ GR+   +LA   F IGA++M  AP  
Sbjct: 63   AVKNSSFLQETIVSMALVGAMIGSATAGWINDVYGRKKATLLADFIFAIGAVVMAAAPDP 122

Query: 1032 GYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLS 1211
              L+ GR + G+GVG + + APVY +E SP   RG L S   + I  G  + +  N+  +
Sbjct: 123  YILIVGRFLVGLGVGLASVCAPVYIAEASPTEVRGGLVSTNVLMITFGQFVSYCVNLAFT 182

Query: 1212 GLPANISWRLMLGLSG 1259
             +P   +WR MLG+SG
Sbjct: 183  EVPG--TWRWMLGVSG 196



>pir|E70070|E70070 metabolite transport protein homolog ywtG -
            Bacillus subtilis>gb:BSUB0019_755548 Bacillus subtilis
            complete genome (section 19 of 21): from 3608981 to
            3809670.>gb:BSZ92954_756595 B.subtilis yws[A,B,C,D,E,F,G]
            and gerBC genes.
          Length = 457

 Score =  111 bits (278), Expect = 3e-23
 Identities = 61/160 (38%), Positives = 89/160 (55%)
 Frame = +3

Query: 777  FASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTSDMIG 956
            F +    L GYD GV+SGA+LF+K+   +++                   A+GK +D  G
Sbjct: 12   FGALGGALYGYDTGVISGAILFMKKELGLNAFTEGLVVSSLLVGAILGSGAAGKLTDRFG 71

Query: 957  RRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRG 1136
            R+  I+ AA  F IG L + LAP  G ++  R++ G+ VG S  I P+Y SEL+P   RG
Sbjct: 72   RKKAIMAAALLFCIGGLGVALAPNTGVMVLFRIILGLAVGTSTTIVPLYLSELAPKHKRG 131

Query: 1137 FLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
             LSSL ++ I VGIL+ ++ N + +   A   WR MLGL+
Sbjct: 132  ALSSLNQLMITVGILLSYIVNYIFADAEA---WRWMLGLA 168



>gb:CP000002_857720 Bacillus licheniformis ATCC 14580, complete
            genome.
          Length = 464

 Score =  108 bits (270), Expect = 2e-22
 Identities = 57/164 (34%), Positives = 94/164 (57%), Gaps = 4/164 (2%)
 Frame = +3

Query: 777  FASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXX--XXXXXXXXXXXXXASGKTSDM 950
            F +   IL GYD+GVM+GA+ F++  + +                        +G+ SD 
Sbjct: 15   FGAFAGILFGYDIGVMTGALPFLQNDWNLQDNAGVIGWITSSVMLGAIFGGALAGQLSDR 74

Query: 951  IGRRYTIVLAAATFIIGALLMGLAPTYG--YLLAGRVVAGIGVGYSLMIAPVYTSELSPA 1124
            +GRR  I+++A  F++G++L G+AP  G  +L+  RV+ G+ VG +  + P Y SE++PA
Sbjct: 75   LGRRKMILISAIIFVVGSILSGIAPHNGILFLIVSRVLLGLAVGAASALVPAYMSEMAPA 134

Query: 1125 MTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
              RG LS + +  I  G+L+ ++ + LL  LP  ++WRLMLGL+
Sbjct: 135  RLRGRLSGINQTMICSGMLLSYIVDFLLKDLPETMAWRLMLGLA 178



>gb:AE017333_447917 Bacillus licheniformis DSM 13, complete genome.
          Length = 464

 Score =  108 bits (270), Expect = 2e-22
 Identities = 57/164 (34%), Positives = 94/164 (57%), Gaps = 4/164 (2%)
 Frame = +3

Query: 777  FASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXX--XXXXXXXXXXXXXASGKTSDM 950
            F +   IL GYD+GVM+GA+ F++  + +                        +G+ SD 
Sbjct: 15   FGAFAGILFGYDIGVMTGALPFLQNDWNLQDNAGVIGWITSSVMLGAIFGGALAGQLSDR 74

Query: 951  IGRRYTIVLAAATFIIGALLMGLAPTYG--YLLAGRVVAGIGVGYSLMIAPVYTSELSPA 1124
            +GRR  I+++A  F++G++L G+AP  G  +L+  RV+ G+ VG +  + P Y SE++PA
Sbjct: 75   LGRRKMILISAIIFVVGSILSGIAPHNGILFLIVSRVLLGLAVGAASALVPAYMSEMAPA 134

Query: 1125 MTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
              RG LS + +  I  G+L+ ++ + LL  LP  ++WRLMLGL+
Sbjct: 135  RLRGRLSGINQTMICSGMLLSYIVDFLLKDLPETMAWRLMLGLA 178



>gb:AE016744_321897 Staphylococcus epidermidis ATCC 12228, section 1
            of 9 of the complete genome.>gb:AE015929_1146566
            Staphylococcus epidermidis ATCC 12228, complete genome.
          Length = 467

 Score =  108 bits (269), Expect = 3e-22
 Identities = 58/171 (33%), Positives = 91/171 (53%)
 Frame = +3

Query: 744  RLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXX 923
            R+    +L  +  +   +L GYD GV+SGA+LFI +   ++S                  
Sbjct: 21   RMKANKYLIFILGALGGLLYGYDNGVISGALLFIHKDIPLNSTTEGIVVSSMLIGAIVGA 80

Query: 924  XASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVY 1103
             +SG  +D +GRR  ++L A  FIIGAL++  +     L+ GR++ G+ VG S+   PVY
Sbjct: 81   GSSGPLADKLGRRRLVMLIAIVFIIGALILAASTNLALLIIGRLIIGLAVGGSMSTVPVY 140

Query: 1104 TSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
             SE++P   RG L SL ++ I +GIL  ++ N   + +     WR MLGL+
Sbjct: 141  LSEMAPTEYRGSLGSLNQLMITIGILAAYLVNYAFADIE---GWRWMLGLA 188



>gb:CP000029_82911 Staphylococcus epidermidis RP62A, complete genome.
          Length = 446

 Score =  107 bits (267), Expect = 5e-22
 Identities = 57/165 (34%), Positives = 89/165 (53%)
 Frame = +3

Query: 762  FLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKT 941
            +L  +  +   +L GYD GV+SGA+LFI +   ++S                   +SG  
Sbjct: 6    YLIFILGALGGLLYGYDNGVISGALLFIHKDIPLNSTTEGIVVSSMLIGAIVGAGSSGPL 65

Query: 942  SDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSP 1121
            +D +GRR  ++L A  FIIGAL++  +     L+ GR++ G+ VG S+   PVY SE++P
Sbjct: 66   ADKLGRRRLVMLIAIVFIIGALILAASTNLALLIIGRLIIGLAVGGSMSTVPVYLSEMAP 125

Query: 1122 AMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
               RG L SL ++ I +GIL  ++ N   + +     WR MLGL+
Sbjct: 126  TEYRGSLGSLNQLMITIGILAAYLVNYAFADIE---GWRWMLGLA 167



>gb:AB056798_1868459 Macaca fascicularis brain cDNA clone:QflA-11110,
            full insert sequence.
          Length = 621

 Score =  107 bits (266), Expect = 7e-22
 Identities = 63/183 (34%), Positives = 97/183 (53%), Gaps = 3/183 (1%)
 Frame = +3

Query: 714  AHGSPHPP-KRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXX 890
            A GS HPP  R    F FL +V A+ + +L+GY+LG++SGA+L IK    +S  + E   
Sbjct: 28   ASGSRHPPWARGCGMFTFLSSVTAAVSGLLVGYELGIISGALLQIKTLLTLSCHEQEMVV 87

Query: 891  XXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIG 1070
                          G   D  GRR  I+L++    +G+L++ L+ +Y  L+ GR+  G+ 
Sbjct: 88   SSLLIGALLASLTGGVLIDRYGRRTAIILSSCLLGLGSLVLILSLSYTVLIVGRIAIGVS 147

Query: 1071 VGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANI--SWRLM 1244
            +  S +   VY +E++P   RG L SL E+ I +GIL  ++SN       AN+   W+ M
Sbjct: 148  ISLSSIATCVYIAEIAPQHRRGLLVSLNELMIVIGILSAYISNYAF----ANVFHGWKYM 203

Query: 1245 LGL 1253
             GL
Sbjct: 204  FGL 206



>gb:AX481743_1469491 Sequence 1 from Patent
            WO02055701.>gb:AX481745_1469492 Sequence 3 from Patent
            WO02055701.>gb:AL449363_1927829 Human DNA sequence from
            clone CTA-444M12 on chromosome 6 Contains the 5' part of
            the SLC2A12 gene for solute carrier family 2 (facilitated
            glucose transporter) member 12 and a high-mobility group
            (nonhistone chromosomal) protein variants I and Y (HMGIY)
            pseudogene, complete sequence.>gb:AY046419_1935112 Homo
            sapiens glucose transporter protein 12 (SLC2A12) mRNA,
            complete cds.>gb:BC070149_1988460 Homo sapiens solute
            carrier family 2 (facilitated glucose transporter),
            member 12, mRNA (cDNA clone MGC:88129 IMAGE:30371087),
            complete cds.>gb:HS73H22_1999399 Human DNA sequence from
            clone RP1-73H22 on chromosome 6q23 Contains the TBPL1
            gene for TBP-like 1, the 3' part of the SLC2A12 gene for
            solute carrier family 2 (facilitated glucose transporter)
            member 12 and one CpG island, complete sequence.
          Length = 617

 Score =  105 bits (263), Expect = 1e-21
 Identities = 62/181 (34%), Positives = 96/181 (53%), Gaps = 3/181 (1%)
 Frame = +3

Query: 720  GSPHPP-KRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXX 896
            GS HPP  R    F FL +V A+ + +L+GY+LG++SGA+L IK    +S  + E     
Sbjct: 26   GSRHPPWARGCGMFTFLSSVTAAVSGLLVGYELGIISGALLQIKTLLALSCHEQEMVVSS 85

Query: 897  XXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVG 1076
                        G   D  GRR  I+L++    +G+L++ L+ +Y  L+ GR+  G+ + 
Sbjct: 86   LVIGALLASLTGGVLIDRYGRRTAIILSSCLLGLGSLVLILSLSYTVLIVGRIAIGVSIS 145

Query: 1077 YSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANI--SWRLMLG 1250
             S +   VY +E++P   RG L SL E+ I +GIL  ++SN       AN+   W+ M G
Sbjct: 146  LSSIATCVYIAEIAPQHRRGLLVSLNELMIVIGILSAYISNYAF----ANVFHGWKYMFG 201

Query: 1251 L 1253
            L
Sbjct: 202  L 202



>gb:AY063901_1565848 Arabidopsis thaliana putative membrane
            transporter protein (At2g43330) mRNA, complete
            cds.>gb:AY096505_1576047 Arabidopsis thaliana putative
            membrane transporter protein (At2g43330) mRNA, complete
            cds.
          Length = 509

 Score =  105 bits (261), Expect = 3e-21
 Identities = 65/196 (33%), Positives = 100/196 (51%), Gaps = 7/196 (3%)
 Frame = +3

Query: 693  VESRPGGAHGSPHPPKRRL----NKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFK 860
            + + PG +      P+RR+    N +     V A    +L GYD GV+SGA+L+IK+ F+
Sbjct: 5    IPNAPGSSGYLDMFPERRMSYFGNSYILGLTVTAGIGGLLFGYDTGVISGALLYIKDDFE 64

Query: 861  I---SSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTY 1031
            +   SS   E               A G  +D  GR+   + A   F  GA++M  AP  
Sbjct: 65   VVKQSSFLQETIVSMALVGAMIGAAAGGWINDYYGRKKATLFADVVFAAGAIVMAAAPDP 124

Query: 1032 GYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLS 1211
              L++GR++ G+GVG + + APVY +E SP+  RG L S   + I  G  + ++ N   +
Sbjct: 125  YVLISGRLLVGLGVGVASVTAPVYIAEASPSEVRGGLVSTNVLMITGGQFLSYLVNSAFT 184

Query: 1212 GLPANISWRLMLGLSG 1259
             +P   +WR MLG+SG
Sbjct: 185  QVPG--TWRWMLGVSG 198



>gb:AB005554_840 Bacillus subtilis genomic DNA, 36 kb region between
            gnt and iol operons.
          Length = 461

 Score =  104 bits (260), Expect = 3e-21
 Identities = 57/165 (34%), Positives = 86/165 (52%)
 Frame = +3

Query: 762  FLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKT 941
            ++   F +   +L GYD GV+SGA+LFI     ++++                   SG  
Sbjct: 8    YMIYFFGALGGLLYGYDTGVISGALLFINNDIPLTTLTEGLVVSMLLLGAIFGSALSGTC 67

Query: 942  SDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSP 1121
            SD  GRR  + + +  FIIGAL    + T G L+A RV+ G+ VG S  + PVY SE++P
Sbjct: 68   SDRWGRRKVVFVLSIIFIIGALACAFSQTIGMLIASRVILGLAVGGSTALVPVYLSEMAP 127

Query: 1122 AMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
               RG L ++  + I  GIL+ ++ N L +   A   WR M+GL+
Sbjct: 128  TKIRGTLGTMNNLMIVTGILLAYIVNYLFTPFEA---WRWMVGLA 169



>pir|D86426|D86426 hypothetical protein F12P21.2 - Arabidopsis
            thaliana>gb:AE005172_891868 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC073506_1541071 Arabidopsis thaliana
            chromosome 1 BAC F12P21 genomic sequence, complete
            sequence.>gb:AY074333_1567490 Arabidopsis thaliana
            unknown protein (At1g30220) mRNA, complete
            cds.>gb:AY123031_1579909 Arabidopsis thaliana unknown
            protein (At1g30220) mRNA, complete cds.
          Length = 580

 Score =  104 bits (260), Expect = 3e-21
 Identities = 60/173 (34%), Positives = 90/173 (52%), Gaps = 3/173 (1%)
 Frame = +3

Query: 750  NKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKI---SSVQHEXXXXXXXXXXXXX 920
            N +    A  A    +L GYD GV+SGA+L+I++ FK    ++   E             
Sbjct: 25   NPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFKSVDRNTWLQEMIVSMAVAGAIVG 84

Query: 921  XXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPV 1100
                G  +D +GRR  I++A   F++GA++M  AP    L+ GRV  G+GVG + M AP+
Sbjct: 85   AAIGGWANDKLGRRSAILMADFLFLLGAIIMAAAPNPSLLVVGRVFVGLGVGMASMTAPL 144

Query: 1101 YTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLSG 1259
            Y SE SPA  RG L S     I  G  + ++ N+  + +    +WR MLG++G
Sbjct: 145  YISEASPAKIRGALVSTNGFLITGGQFLSYLINLAFTDVTG--TWRWMLGIAG 195



>sp|P46333|CSBC_BACSU Probable metabolite transport protein
            csbC.>pir|D70073|D70073 metabolite transport protein
            homolog yxcC - Bacillus subtilis>gb:BSUB0021_755946
            Bacillus subtilis complete genome (section 21 of 21):
            from 4010730 to 4214630.
          Length = 461

 Score =  104 bits (260), Expect = 3e-21
 Identities = 57/165 (34%), Positives = 86/165 (52%)
 Frame = +3

Query: 762  FLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKT 941
            ++   F +   +L GYD GV+SGA+LFI     ++++                   SG  
Sbjct: 8    YMIYFFGALGGLLYGYDTGVISGALLFINNDIPLTTLTEGLVVSMLLLGAIFGSALSGTC 67

Query: 942  SDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSP 1121
            SD  GRR  + + +  FIIGAL    + T G L+A RV+ G+ VG S  + PVY SE++P
Sbjct: 68   SDRWGRRKVVFVLSIIFIIGALACAFSQTIGMLIASRVILGLAVGGSTALVPVYLSEMAP 127

Query: 1122 AMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
               RG L ++  + I  GIL+ ++ N L +   A   WR M+GL+
Sbjct: 128  TKIRGTLGTMNNLMIVTGILLAYIVNYLFTPFEA---WRWMVGLA 169



>gb:BC047507_1983888 Homo sapiens solute carrier family 2 (facilitated
            glucose transporter), member 13, mRNA (cDNA clone
            MGC:48624 IMAGE:5272386), complete cds.
          Length = 338

 Score =  103 bits (258), Expect = 6e-21
 Identities = 59/167 (35%), Positives = 88/167 (52%)
 Frame = +3

Query: 756  FAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASG 935
            F ++ AVF++    L GYD GV+SGA+L +K    + ++  E               A G
Sbjct: 61   FVYVVAVFSALGGFLFGYDTGVVSGAMLLLKRQLSLDALWQELLVSSTVGAAAVSALAGG 120

Query: 936  KTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSEL 1115
              + + GRR  I+LA+A F  G+ ++  A     LLAGR+V G+G+G + M  PVY +E+
Sbjct: 121  ALNGVFGRRAAILLASALFTAGSAVLAAANNKETLLAGRLVVGLGIGIASMTVPVYIAEV 180

Query: 1116 SPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            SP   RG L ++  +FI  G     V +   S L  +  WR MLGL+
Sbjct: 181  SPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKD-GWRYMLGLA 226



>gb:OSJN00059_1694084 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0004N05, complete sequence.
          Length = 581

 Score =  103 bits (258), Expect = 6e-21
 Identities = 59/163 (36%), Positives = 90/163 (55%), Gaps = 3/163 (1%)
 Frame = +3

Query: 780  ASTNSILLGYDLGVMSGAVLFIKETFKI---SSVQHEXXXXXXXXXXXXXXXASGKTSDM 950
            A    +L GYD GV+SGA+L+I++ F     S+V  E                 G  +D 
Sbjct: 33   AGIGGLLFGYDTGVISGALLYIRDDFTAVEKSTVLRETIVSMAVAGAIVGAGFGGWMNDK 92

Query: 951  IGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMT 1130
             GR+ +I++A + F+ GAL+M LAPT   ++ GR+  G+GVG + M AP+Y SE SPA  
Sbjct: 93   FGRKPSILIADSLFLAGALIMALAPTPFVIIIGRIFVGLGVGMASMTAPLYISEASPARI 152

Query: 1131 RGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLSG 1259
            RG L S   + I  G  + ++ N+  + +    +WR MLG++G
Sbjct: 153  RGALVSTNGLLITGGQFMAYLINLAFTKVKG--TWRWMLGIAG 193



>gb:AX076673_1460657 Sequence 7 from Patent WO0104145.
          Length = 629

 Score =  103 bits (258), Expect = 6e-21
 Identities = 59/167 (35%), Positives = 88/167 (52%)
 Frame = +3

Query: 756  FAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASG 935
            F ++ AVF++    L GYD GV+SGA+L +K    + ++  E               A G
Sbjct: 61   FVYVVAVFSALGGFLFGYDTGVVSGAMLLLKRQLSLDALWQELLVSSTVGAAAVSALAGG 120

Query: 936  KTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSEL 1115
              + + GRR  I+LA+A F  G+ ++  A     LLAGR+V G+G+G + M  PVY +E+
Sbjct: 121  ALNGVFGRRAAILLASALFTAGSAVLAAANNKETLLAGRLVVGLGIGIASMTVPVYIAEV 180

Query: 1116 SPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            SP   RG L ++  +FI  G     V +   S L  +  WR MLGL+
Sbjct: 181  SPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKD-GWRYMLGLA 226



>gb:BA000028_697183 Oceanobacillus iheyensis HTE831 DNA, complete
            genome.
          Length = 463

 Score =  103 bits (258), Expect = 6e-21
 Identities = 56/177 (31%), Positives = 98/177 (55%), Gaps = 4/177 (2%)
 Frame = +3

Query: 738  KRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXX--XXXXXXXX 911
            K+  +KF +    F +   IL GYD+GVM+GA+ F++  + + +                
Sbjct: 5    KKISSKFIYF---FGAFGGILFGYDIGVMTGALPFLQSDWNLQNDPTAIGWITSSLMLGA 61

Query: 912  XXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYG--YLLAGRVVAGIGVGYSL 1085
                  SG+ SD IGRR  I++A+  F +G+++ G++P  G  +++  R++ G+ VG + 
Sbjct: 62   IFGGALSGQLSDRIGRRKMILIASIIFALGSIMAGISPHNGILFMIVSRIILGLAVGAAS 121

Query: 1086 MIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
             + P Y SE++PA  RG LS + +  I  G+L+ ++   +L  LP  ++WRLML L+
Sbjct: 122  ALVPAYMSEMAPARLRGRLSGINQTMIVSGMLLSYIVAFVLKDLPETMAWRLMLSLA 178



>sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter
            (Hmit).>gb:HSA315644_2003989 Homo sapiens mRNA for proton
            myo-inositol symporter (Hmit gene).
          Length = 629

 Score =  103 bits (258), Expect = 6e-21
 Identities = 59/167 (35%), Positives = 88/167 (52%)
 Frame = +3

Query: 756  FAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASG 935
            F ++ AVF++    L GYD GV+SGA+L +K    + ++  E               A G
Sbjct: 61   FVYVVAVFSALGGFLFGYDTGVVSGAMLLLKRQLSLDALWQELLVSSTVGAAAVSALAGG 120

Query: 936  KTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSEL 1115
              + + GRR  I+LA+A F  G+ ++  A     LLAGR+V G+G+G + M  PVY +E+
Sbjct: 121  ALNGVFGRRAAILLASALFTAGSAVLAAANNKETLLAGRLVVGLGIGIASMTVPVYIAEV 180

Query: 1116 SPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            SP   RG L ++  +FI  G     V +   S L  +  WR MLGL+
Sbjct: 181  SPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKD-GWRYMLGLA 226



>pir|G86812|G86812 D-xylose proton-symporter [imported] - Lactococcus
            lactis subsp. lactis (strain IL1403)>gb:AE006381_218405
            Lactococcus lactis subsp. lactis IL1403 section 143 of
            218 of the complete genome.>gb:AE005176_1095478
            Lactococcus lactis subsp. lactis IL1403, complete genome.
          Length = 433

 Score =  103 bits (257), Expect = 7e-21
 Identities = 62/163 (38%), Positives = 92/163 (56%), Gaps = 3/163 (1%)
 Frame = +3

Query: 777  FASTNSILLGYDLGVMSGAVLFI-KETFKISSVQHEXXXXXXXXXXXXXXXAS--GKTSD 947
            F +   +L GYD GV+SGA+LFI KE++++SS                   A   G  SD
Sbjct: 12   FGALGGLLFGYDTGVISGALLFIEKESWQVSSWAWMEGWITAAVLMGAVIGAVVIGPMSD 71

Query: 948  MIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAM 1127
              GR+  ++L+A  F +GAL  GL+ +   L+  RV+ G+ VG +  + P Y SELSPA 
Sbjct: 72   RFGRKRLLLLSAVIFFVGALGSGLSNSAELLIISRVILGMAVGSASALVPTYLSELSPAK 131

Query: 1128 TRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
             RG +S++ ++ I  GIL+ ++SN  L G+  N  W  MLGL+
Sbjct: 132  IRGGVSTMFQLMIMTGILLAYISNYALKGVSGN--WHWMLGLA 172



>sp|O52733|XYLT_LACBR D-xylose-proton symporter (D-xylose
            transporter).>gb:AF045552_472772 Lactobacillus brevis xyl
            operon and xylose isomerase (xylA), xylulokinase (xylB),
            and D-xylose proton-symporter (xylT) genes, complete cds.
          Length = 457

 Score =  103 bits (256), Expect = 1e-20
 Identities = 54/160 (33%), Positives = 86/160 (53%)
 Frame = +3

Query: 777  FASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTSDMIG 956
            F +   +L GYD GV+SGA+LFI++   + S Q                   G +SD  G
Sbjct: 12   FGALGGLLFGYDTGVISGAILFIQKQMNLGSWQQGWVVSAVLLGAILGAAIIGPSSDRFG 71

Query: 957  RRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRG 1136
            RR  ++L+A  F +GAL    +P +  L+  R++ G+ VG +  + P Y +EL+P+  RG
Sbjct: 72   RRKLLLLSAIIFFVGALGSAFSPEFWTLIISRIILGMAVGAASALIPTYLAELAPSDKRG 131

Query: 1137 FLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
             +SSL ++ +  GIL+ +++N   SG      WR MLG +
Sbjct: 132  TVSSLFQLMVMTGILLAYITNYSFSGF--YTGWRWMLGFA 169



>gb:AY514443_1430740 Bos taurus facilitative glucose transporter
            (GLUT12) mRNA, complete cds.
          Length = 621

 Score =  101 bits (251), Expect = 4e-20
 Identities = 60/183 (32%), Positives = 95/183 (51%), Gaps = 3/183 (1%)
 Frame = +3

Query: 714  AHGSPHPP-KRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXX 890
            A G PHPP  R    +  L +V A+ +  L+GY+LG++SGA+L I+    ++  + E   
Sbjct: 28   ASGGPHPPWARGCGMYTLLSSVTAAVSGFLVGYELGIISGALLQIRTLLVLTCHEQEMVV 87

Query: 891  XXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIG 1070
                          G   D  GRR  I+L++    +G+L++ ++ +Y  L+ GR+  G+ 
Sbjct: 88   SSLLIGALLASLIGGVLIDRYGRRAAIILSSCLLGLGSLVLIISLSYTTLIGGRIAIGVF 147

Query: 1071 VGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANIS--WRLM 1244
            +  S     VY +E++P   RG L SL E+ I +GIL  ++SN       ANIS  W+ M
Sbjct: 148  ISLSSTATCVYIAEIAPQHRRGLLVSLNELMIVIGILFAYISNYAF----ANISHGWKYM 203

Query: 1245 LGL 1253
             GL
Sbjct: 204  FGL 206



>pir|F71431|F71431 hypothetical protein - Arabidopsis
            thaliana>gb:ATCHRIV44_1545450 Arabidopsis thaliana DNA
            chromosome 4, contig fragment No. 44.>gb:ATFCA6_1551698
            Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
            fragment No. 6.>gb:BT004139_1637238 Arabidopsis thaliana
            clone RAFL15-36-B07 (R50004) putative membrane
            transporter (At4g16480) mRNA, complete
            cds.>gb:BT005707_1638647 Arabidopsis thaliana clone
            U50004 putative membrane transporter (At4g16480) mRNA,
            complete cds.
          Length = 582

 Score =  101 bits (251), Expect = 4e-20
 Identities = 59/166 (35%), Positives = 84/166 (50%), Gaps = 3/166 (1%)
 Frame = +3

Query: 771  AVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQ---HEXXXXXXXXXXXXXXXASGKT 941
            A+ A    +L GYD GV+SGA+LFIKE F     +                      G  
Sbjct: 31   ALSAGIGGLLFGYDTGVISGALLFIKEDFDEVDKKTWLQSTIVSMAVAGAIVGAAVGGWI 90

Query: 942  SDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSP 1121
            +D  GRR +I++A   F+IGA++M  AP    ++ GR+  G GVG + M +P+Y SE SP
Sbjct: 91   NDKFGRRMSILIADVLFLIGAIVMAFAPAPWVIIVGRIFVGFGVGMASMTSPLYISEASP 150

Query: 1122 AMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLSG 1259
            A  RG L S   + I  G    ++ N+     P   +WR MLG++G
Sbjct: 151  ARIRGALVSTNGLLITGGQFFSYLINLAFVHTPG--TWRWMLGVAG 194



>gb:AX076675_1460658 Sequence 9 from Patent
            WO0104145.>gb:RNO315643_2135902 Rattus norvegicus mRNA
            for proton myo-inositol symporter (Hmit gene).
          Length = 618

 Score =  100 bits (248), Expect = 8e-20
 Identities = 56/167 (33%), Positives = 87/167 (52%)
 Frame = +3

Query: 756  FAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASG 935
            F +  A F++    L GYD GV+SGA+L ++   ++ ++  E               A G
Sbjct: 50   FVYAAAAFSALGGFLFGYDTGVVSGAMLLLRRQMRLGAMWQELLVSGAVGAAAVAALAGG 109

Query: 936  KTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSEL 1115
              +  +GRR  I+LA+A   +G+ ++  A     LLAGR+V G+G+G + M  PVY +E+
Sbjct: 110  ALNGALGRRSAILLASALCTVGSAVLAAAANKETLLAGRLVVGLGIGIASMTVPVYIAEV 169

Query: 1116 SPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            SP   RG L ++  +FI  G     V +   S L  +  WR MLGL+
Sbjct: 170  SPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKD-GWRYMLGLA 215



>gb:CP000009_862670 Gluconobacter oxydans 621H, complete genome.
          Length = 472

 Score =  100 bits (248), Expect = 8e-20
 Identities = 54/158 (34%), Positives = 87/158 (55%)
 Frame = +3

Query: 780  ASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGR 959
            A+   ++ G D+GV+SGA+ FI++ F  S  +                  +G+ S   GR
Sbjct: 32   AAIAGLMFGLDVGVISGALGFIRDEFHASEFEQSWIVSSMMFGAAVGAVGAGRMSYAFGR 91

Query: 960  RYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGF 1139
            R +++ +A  F+ G L+  LA +   L+ GR + G+ +G    +AP+Y SE+S    RG 
Sbjct: 92   RRSLIFSAFLFVAGGLVCALASSVSELIIGRTMLGLAIGIGSFVAPLYISEVSDISRRGS 151

Query: 1140 LSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            L S+ ++ I +GIL+ FVSN +LS    + SWR MLG+
Sbjct: 152  LVSMYQLMITLGILLAFVSNAILS---YSGSWRWMLGI 186



>gb:AK035972_1164307 Mus musculus 16 days neonate cerebellum cDNA,
            RIKEN full-length enriched library, clone:9630022K19
            product:hypothetical Sugar transporters containing
            protein, full insert sequence.
          Length = 622

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 61/184 (33%), Positives = 96/184 (52%), Gaps = 3/184 (1%)
 Frame = +3

Query: 711  GAHGSPHPP-KRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXX 887
            GA G  HP      + F FL +V A+ + +L+GY+LG++SGA+L I+    ++  + E  
Sbjct: 27   GASGGGHPACAGGPSMFTFLTSVTAAISGLLVGYELGLISGALLQIRTLLALTCHEQEMV 86

Query: 888  XXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGI 1067
                           G   D  GRR  I+L++    +G+L++ ++ +Y  L+ GRV  G+
Sbjct: 87   VSSLLIGAFLASLTGGVLIDRYGRRLAIILSSCLLGLGSLVLIMSLSYTLLIMGRVAIGV 146

Query: 1068 GVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANIS--WRL 1241
             +  S +   VY +E++P   RG L SL E+ I  GIL  ++SN       ANIS  W+ 
Sbjct: 147  SISLSSIATCVYIAEIAPQHRRGLLVSLNELMIVTGILFAYISNYAF----ANISNGWKY 202

Query: 1242 MLGL 1253
            M GL
Sbjct: 203  MFGL 206



>gb:AK028970_1161263 Mus musculus 10 days neonate skin cDNA, RIKEN
            full-length enriched library, clone:4732475G08
            product:hypothetical Sugar transporters containing
            protein, full insert sequence.>gb:AK031659_1162540 Mus
            musculus 13 days embryo male testis cDNA, RIKEN
            full-length enriched library, clone:6030474C01
            product:hypothetical Sugar transporters containing
            protein, full insert sequence.>gb:AY230881_2080126 Mus
            musculus glucose transporter isoform 12 (Slc2a12) mRNA,
            complete cds.>gb:MMU549317_2122067 Mus musculus mRNA for
            solute carrier family 2 (facilitated glucose
            transporter), member 12 (Slc2a12 gene).
          Length = 622

 Score = 99.4 bits (246), Expect = 1e-19
 Identities = 61/184 (33%), Positives = 96/184 (52%), Gaps = 3/184 (1%)
 Frame = +3

Query: 711  GAHGSPHPP-KRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXX 887
            GA G  HP      + F FL +V A+ + +L+GY+LG++SGA+L I+    ++  + E  
Sbjct: 27   GASGGGHPACAGGPSMFTFLTSVTAAISGLLVGYELGLISGALLQIRTLLALTCHEQEMV 86

Query: 888  XXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGI 1067
                           G   D  GRR  I+L++    +G+L++ ++ +Y  L+ GRV  G+
Sbjct: 87   VSSLLIGAFLASLTGGVLIDRYGRRLAIILSSCLLGLGSLVLIMSLSYTLLIMGRVAIGV 146

Query: 1068 GVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANIS--WRL 1241
             +  S +   VY +E++P   RG L SL E+ I  GIL  ++SN       ANIS  W+ 
Sbjct: 147  SISLSSIATCVYIAEIAPQHRRGLLVSLNELMIVTGILFAYISNYAF----ANISNGWKY 202

Query: 1242 MLGL 1253
            M GL
Sbjct: 203  MFGL 206



>pir|G84864|G84864 probable membrane transporter [imported] -
            Arabidopsis thaliana>gb:AC002335_1530399 Arabidopsis
            thaliana chromosome 2 clone T1O24 map CIC10F02, complete
            sequence.
          Length = 521

 Score = 99.0 bits (245), Expect = 2e-19
 Identities = 64/208 (30%), Positives = 101/208 (48%), Gaps = 19/208 (9%)
 Frame = +3

Query: 693  VESRPGGAHGSPHPPKRRL----NKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFK 860
            + + PG +      P+RR+    N +     V A    +L GYD GV+SGA+L+IK+ F+
Sbjct: 5    IPNAPGSSGYLDMFPERRMSYFGNSYILGLTVTAGIGGLLFGYDTGVISGALLYIKDDFE 64

Query: 861  I---------------SSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFI 995
            +               +S + E               A G  +D  GR+   + A   F 
Sbjct: 65   VVKQSSFLQVYNVSSFTSSKLETIVSMALVGAMIGAAAGGWINDYYGRKKATLFADVVFA 124

Query: 996  IGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVG 1175
             GA++M  AP    L++GR++ G+GVG + + APVY +E SP+  RG L S   + I  G
Sbjct: 125  AGAIVMAAAPDPYVLISGRLLVGLGVGVASVTAPVYIAEASPSEVRGGLVSTNVLMITGG 184

Query: 1176 ILIGFVSNILLSGLPANISWRLMLGLSG 1259
              + ++ N   + +P   +WR MLG+SG
Sbjct: 185  QFLSYLVNSAFTQVPG--TWRWMLGVSG 210



>gb:AE016959_1023991 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC018727_1538372 Oryza sativa
            chromosome 10 BAC OSJNBa0056G17 genomic sequence,
            complete sequence.>gb:AE017122_1753810 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 76 of 77
            of the complete sequence.
          Length = 502

 Score = 98.6 bits (244), Expect = 2e-19
 Identities = 54/173 (31%), Positives = 92/173 (53%), Gaps = 7/173 (4%)
 Frame = +3

Query: 759  AFLCAVFASTNSILLGYDLGVMSGAVLFIKET-------FKISSVQHEXXXXXXXXXXXX 917
            A L  +F +   +L GYD+G  SGA + +K +       + +SS+Q              
Sbjct: 47   AILPFLFPALGGLLYGYDIGATSGATISLKSSTFSGTTWYNLSSLQTGLVVSGSLYGALI 106

Query: 918  XXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAP 1097
                +   +D +GRR  ++L++ +++IGALL   AP +  ++ GR   GIG+G ++  AP
Sbjct: 107  GSILAFNIADFLGRRRELILSSVSYLIGALLTAAAPNFPIMVVGRFFYGIGIGLAMHAAP 166

Query: 1098 VYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            +Y +E +P+  RG L SL E FI +G+L+G+++  L   + +   WR M   S
Sbjct: 167  MYIAETAPSQIRGMLISLKEFFIVLGMLLGYIAGSLFVEVVS--GWRYMYATS 217



>gb:AF280431_1782884 Mesembryanthemum crystallinum putative
            Na+/myo-inositol symporter (Itr1) mRNA, complete cds.
          Length = 581

 Score = 98.2 bits (243), Expect = 3e-19
 Identities = 56/165 (33%), Positives = 88/165 (53%), Gaps = 3/165 (1%)
 Frame = +3

Query: 771  AVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQ---HEXXXXXXXXXXXXXXXASGKT 941
            A  A    +L GYD GV+SGA+L+IKE FK  + +    E                 G  
Sbjct: 31   AFSAGIGGLLFGYDTGVISGALLYIKEDFKEVAQKTWLQETIVAMAVAGAIVGAGLGGFL 90

Query: 942  SDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSP 1121
            +D  GR+  +++A   F+ GA++M +AP    ++ GR+V G+GVG + M AP+Y SE SP
Sbjct: 91   NDKFGRKPAMIVADILFLTGAIIMSVAPAPWVIIIGRIVVGLGVGMASMTAPLYISETSP 150

Query: 1122 AMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            A  RG L +   + I  G  + ++ N+  + +    +WR MLG++
Sbjct: 151  AKIRGALGATNGLLITGGQFVSYLVNLGFTRVKG--TWRWMLGVA 193



>gb:AY871888_2150052 Synthetic construct hypothetical protein
            (FTT1474) gene, complete cds.
          Length = 495

 Score = 97.8 bits (242), Expect = 4e-19
 Identities = 57/172 (33%), Positives = 92/172 (53%)
 Frame = +3

Query: 738  KRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXX 917
            ++++N      A+ A+   +L G D+G ++G++ FI ETF +S  Q              
Sbjct: 30   EKKINFVVVHVAIIAALAGLLFGMDIGYVNGSLHFISETFGLSVEQSGHVSSVLLLGAAC 89

Query: 918  XXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAP 1097
                SG  S   GRR  +++AAA F I  ++  LAP Y   ++ R + GI VG +  IAP
Sbjct: 90   GALFSGFLSKRYGRRKVLLIAAAIFSIFTIVGILAPNYQIFISSRFILGIAVGIASFIAP 149

Query: 1098 VYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            +Y SE++P   RG L +L ++ I +G+ + F++N   S L    SWR+ML +
Sbjct: 150  LYLSEIAPKEFRGALIALYQLMITIGLFLVFLTN---SALERTGSWRVMLAV 198



>gb:AJ749949_531931 Francisella tularensis subsp. tularensis complete
            genome.
          Length = 460

 Score = 97.8 bits (242), Expect = 4e-19
 Identities = 57/172 (33%), Positives = 92/172 (53%)
 Frame = +3

Query: 738  KRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXX 917
            ++++N      A+ A+   +L G D+G ++G++ FI ETF +S  Q              
Sbjct: 4    EKKINFVVVHVAIIAALAGLLFGMDIGYVNGSLHFISETFGLSVEQSGHVSSVLLLGAAC 63

Query: 918  XXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAP 1097
                SG  S   GRR  +++AAA F I  ++  LAP Y   ++ R + GI VG +  IAP
Sbjct: 64   GALFSGFLSKRYGRRKVLLIAAAIFSIFTIVGILAPNYQIFISSRFILGIAVGIASFIAP 123

Query: 1098 VYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            +Y SE++P   RG L +L ++ I +G+ + F++N   S L    SWR+ML +
Sbjct: 124  LYLSEIAPKEFRGALIALYQLMITIGLFLVFLTN---SALERTGSWRVMLAV 172



>gb:AP003214_1825326 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, BAC clone:OSJNBa0083M16.
          Length = 513

 Score = 96.3 bits (238), Expect = 1e-18
 Identities = 57/161 (35%), Positives = 84/161 (52%), Gaps = 2/161 (1%)
 Frame = +3

Query: 780  ASTNSILLGYDLGVMSGAVLFIKETFKIS--SVQHEXXXXXXXXXXXXXXXASGKTSDMI 953
            A   +IL GY LGV++GA+ ++ +   IS  +V                    G  +D  
Sbjct: 79   ACLGAILFGYHLGVVNGALEYLAKDLGISENAVLQGWVVSTTLAGATAGSFTGGALADKF 138

Query: 954  GRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTR 1133
            GR  T +L A    +GA L   A     ++ GR++AGIG+G S  + P+Y SE+SP   R
Sbjct: 139  GRTRTFILDAIPLAVGAFLSATAHDVRTMIIGRLLAGIGIGISSALVPLYISEISPTEIR 198

Query: 1134 GFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            G L S+ ++FI +GIL   V+ + L+G PA   WR M G+S
Sbjct: 199  GALGSVNQLFICIGILAALVAGLPLAGNPA--WWRTMFGIS 237



>gb:CEM01F1_1366129 Caenorhabditis elegans cosmid M01F1, complete
            sequence.
          Length = 604

 Score = 95.9 bits (237), Expect = 2e-18
 Identities = 63/197 (31%), Positives = 95/197 (48%), Gaps = 8/197 (4%)
 Frame = +3

Query: 690  MVESRP---GGAHGSPHPPKR-RLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETF 857
            MV+  P   G   G   P    +   F ++ A  A     L GYD G++S A+L++    
Sbjct: 1    MVQVAPVAAGAGSGQTRPSSDPKTGWFVYMLAFSAVIGGFLFGYDTGIVSAAMLYVPNAS 60

Query: 858  KIS---SVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPT 1028
             I    SV  E                SG  SD +GR+  I+ A+ TF IGA++   A T
Sbjct: 61   GIKPLDSVWQEIIVSITPGVAAIGSLCSGPGSDFLGRKKIIIGASVTFTIGAIICAAAWT 120

Query: 1029 YGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILL 1208
               LL GR++ G+ +G++ MI P+Y SE SP+  RG L +  ++ I VG++I  +     
Sbjct: 121  KIILLIGRILLGLAIGFASMIVPIYVSEASPSHIRGKLVTGFQLMITVGLVIANIIGGAF 180

Query: 1209 SGL-PANISWRLMLGLS 1256
            S + P  + WRLM   +
Sbjct: 181  SYVDPDQVGWRLMFAFA 197



>gb:CP000009_862941 Gluconobacter oxydans 621H, complete genome.
          Length = 468

 Score = 95.5 bits (236), Expect = 2e-18
 Identities = 49/161 (30%), Positives = 86/161 (53%)
 Frame = +3

Query: 771  AVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTSDM 950
            A  ++T  +L GYD G++S A+L ++  F + ++  E                +G  SD 
Sbjct: 20   ATISATGGLLFGYDTGIISSALLQLRNQFHLDTLGAEIVTSAIILGALIGCLGAGSISDR 79

Query: 951  IGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMT 1130
            IGRR T+++AAA F++G +++  A +   L+  R++ G+ +G +  I P+Y +E+SP   
Sbjct: 80   IGRRRTVMIAAALFLLGTVVVSSAQSVAVLIIARLILGLAIGAASQIVPIYIAEVSPPER 139

Query: 1131 RGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            RG L     V   + ++ G  S+ +   L  + SWRLM G+
Sbjct: 140  RGRL----VVGFQLAVVFGITSSFVTGYLLRDSSWRLMFGI 176



>gb:AP005756_1857300 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OSJNBb0035N08.
          Length = 746

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 54/167 (32%), Positives = 92/167 (55%), Gaps = 2/167 (1%)
 Frame = +3

Query: 759  AFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISS--VQHEXXXXXXXXXXXXXXXAS 932
            A L A+ AS  ++L G+D   ++GAVL+IK+ FK+ S                      S
Sbjct: 4    AALVAIAASIGNLLQGWDNATIAGAVLYIKKEFKLESEPTVEGLIVAMSLIGATIITTFS 63

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
            G  SD IGRR  ++L++  + + +L+M  +P    LL  R++ G G+G ++ + P+Y SE
Sbjct: 64   GPVSDWIGRRPMLILSSILYFLSSLIMLWSPNVYVLLLARLIDGFGIGLAVTLVPLYISE 123

Query: 1113 LSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
             +P+  RG L++LP+   + G+ + +     +S LP+   WR+MLG+
Sbjct: 124  TAPSEIRGLLNTLPQFSGSGGMFLSYCMVFGMSLLPSP-DWRIMLGV 169



>gb:AY094465_1575762 Arabidopsis thaliana AT4g35300/F23E12_140 mRNA,
            complete cds.
          Length = 739

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 54/167 (32%), Positives = 92/167 (55%), Gaps = 2/167 (1%)
 Frame = +3

Query: 759  AFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQ--HEXXXXXXXXXXXXXXXAS 932
            A L A+ A+  ++L G+D   ++GAVL+IK+ F + S                      S
Sbjct: 4    AVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLITTCS 63

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
            G  +D +GRR  ++L++  + +G+L+M  +P    LL GR++ G GVG  + + P+Y SE
Sbjct: 64   GGVADWLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIYISE 123

Query: 1113 LSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
             +P   RG L++LP+   + G+ + +     +S +P+  SWRLMLG+
Sbjct: 124  TAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMPSP-SWRLMLGV 169



>pir|T06127|T06127 probable sugar transport protein F23E12.140 -
            Arabidopsis thaliana>gb:ATCHRIV83_1547491 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            83.>gb:ATF23E12_1549731 Arabidopsis thaliana DNA
            chromosome 4, BAC clone F23E12 (ESSA
            project).>gb:ATH532570_1552864 Arabidopsis thaliana mRNA
            for monosaccharide sensing protein 2 (mssp2 gene).
          Length = 729

 Score = 94.7 bits (234), Expect = 3e-18
 Identities = 54/167 (32%), Positives = 92/167 (55%), Gaps = 2/167 (1%)
 Frame = +3

Query: 759  AFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQ--HEXXXXXXXXXXXXXXXAS 932
            A L A+ A+  ++L G+D   ++GAVL+IK+ F + S                      S
Sbjct: 4    AVLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAMSLIGATLITTCS 63

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
            G  +D +GRR  ++L++  + +G+L+M  +P    LL GR++ G GVG  + + P+Y SE
Sbjct: 64   GGVADWLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIYISE 123

Query: 1113 LSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
             +P   RG L++LP+   + G+ + +     +S +P+  SWRLMLG+
Sbjct: 124  TAPPEIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMPSP-SWRLMLGV 169



>gb:AP003704_1832135 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC
            clone:OJ1048_C10.>gb:AP006163_1861149 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:B1364A02.
          Length = 596

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 58/172 (33%), Positives = 86/172 (50%), Gaps = 3/172 (1%)
 Frame = +3

Query: 750  NKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKI---SSVQHEXXXXXXXXXXXXX 920
            N +    A  A    +L GYD GV+SGA+L+I++ F     ++   E             
Sbjct: 23   NPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFPSVDKNTWLQEMIVSMAVAGAIIG 82

Query: 921  XXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPV 1100
                G  +D  GRR +I++A A F  GA +M  A     L+ GRV  G+GVG + M +P+
Sbjct: 83   AAIGGWANDRYGRRTSILVADALFFAGAAVMASATGPAQLVVGRVFVGLGVGTASMTSPL 142

Query: 1101 YTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            Y SE SPA  RG L S   + I  G  + ++ N+  +  P   +WR MLG++
Sbjct: 143  YISEASPARIRGALVSTNGLLITGGQFLSYLINLAFTKAPG--TWRWMLGVA 192



>gb:AE016766_327516 Escherichia coli CFT073 section 12 of 18 of the
            complete genome.>gb:AE014075_958100 Escherichia coli
            CFT073 complete genome.
          Length = 468

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 56/171 (32%), Positives = 89/171 (52%), Gaps = 1/171 (0%)
 Frame = +3

Query: 744  RLNK-FAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXX 920
            R NK   F     A+   +L G D+GV++GA+ FI + F+I+S   E             
Sbjct: 13   RSNKAMTFFVCFLAALAGLLFGLDIGVIAGALPFIADEFQITSHTQEWVVSSMMFGAAVG 72

Query: 921  XXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPV 1100
               SG  S  +GR+ ++++ A  F+ G+L    AP    L+  RV+ G+ VG +   AP+
Sbjct: 73   AVGSGWLSFKLGRKKSLMIGAILFVAGSLFSAAAPNVEVLILSRVLLGLAVGVASYTAPL 132

Query: 1101 YTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            Y SE++P   RG + S+ ++ I +GIL  ++S+   S   A   WR MLG+
Sbjct: 133  YLSEIAPEKIRGSMISMYQLMITIGILGAYLSDTAFSYTGA---WRWMLGV 180



>sp|P37021|GALP_ECOLI Galactose-proton symporter (Galactose
            transporter).>pir|F65079|F65079 galactose-proton symport
            (galactose transporter) - Escherichia coli (strain
            K-12)>gb:ECU28377_133679 Escherichia coli K-12 genome;
            approximately 65 to 68 minutes.>gb:U00096_201961
            Escherichia coli K-12 MG1655 complete
            genome.>gb:CQ891160_1454960 Sequence 3 from Patent
            WO2004087937.
          Length = 464

 Score = 94.4 bits (233), Expect = 4e-18
 Identities = 56/171 (32%), Positives = 89/171 (52%), Gaps = 1/171 (0%)
 Frame = +3

Query: 744  RLNK-FAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXX 920
            R NK   F     A+   +L G D+GV++GA+ FI + F+I+S   E             
Sbjct: 9    RSNKAMTFFVCFLAALAGLLFGLDIGVIAGALPFIADEFQITSHTQEWVVSSMMFGAAVG 68

Query: 921  XXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPV 1100
               SG  S  +GR+ ++++ A  F+ G+L    AP    L+  RV+ G+ VG +   AP+
Sbjct: 69   AVGSGWLSFKLGRKKSLMIGAILFVAGSLFSAAAPNVEVLILSRVLLGLAVGVASYTAPL 128

Query: 1101 YTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            Y SE++P   RG + S+ ++ I +GIL  ++S+   S   A   WR MLG+
Sbjct: 129  YLSEIAPEKIRGSMISMYQLMITIGILGAYLSDTAFSYTGA---WRWMLGV 176



>gb:AF215852_1777953 Nicotiana tabacum hexose transporter (pGlcT)
            mRNA, partial cds; nuclear gene for chloroplast product.
          Length = 534

 Score = 93.6 bits (231), Expect = 8e-18
 Identities = 55/161 (34%), Positives = 85/161 (52%), Gaps = 2/161 (1%)
 Frame = +3

Query: 780  ASTNSILLGYDLGVMSGAVLFIKETFKI--SSVQHEXXXXXXXXXXXXXXXASGKTSDMI 953
            A   +IL GY LGV++GA+ ++ +   I  ++V                    G  +D  
Sbjct: 100  ACLGAILFGYHLGVVNGALEYLAKDLGIVENTVIQGWIVSSVLAGATVGSFTGGALADKF 159

Query: 954  GRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTR 1133
            GR  T VL A    +GA L   A +   ++ GR++ GIG+G S  I P+Y SE+SP   R
Sbjct: 160  GRTKTFVLDAIPLAVGAFLCTTAQSVQAMIIGRLLTGIGIGISSAIVPLYISEISPTEIR 219

Query: 1134 GFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            G L ++ ++FI +GIL+  V+ + LSG P  + WR M G++
Sbjct: 220  GTLGTVNQLFICIGILVALVAGLPLSGNP--LWWRTMFGIA 258



>gb:BT015128_1642098 Arabidopsis thaliana At5g17010 gene, complete
            cds.
          Length = 503

 Score = 93.6 bits (231), Expect = 8e-18
 Identities = 63/227 (27%), Positives = 103/227 (45%), Gaps = 9/227 (3%)
 Frame = +3

Query: 603  VDPNQDLDS*NMDSGIDSAKGRTEPMEITMVESRPGGAHGSPHPPKRRLNKFAFLCAVFA 782
            +DP Q     ++      + G   P    +++          H P+      A L  +F 
Sbjct: 3    LDPEQQQPISSVSREFGKSSGEISPEREPLIKEN--------HVPENYSVVAAILPFLFP 54

Query: 783  STNSILLGYDLGVMSGAVLFIKET-------FKISSVQHEXXXXXXXXXXXXXXXASGKT 941
            +   +L GY++G  S A + ++         + +SSV                   +   
Sbjct: 55   ALGGLLYGYEIGATSCATISLQSPSLSGISWYNLSSVDVGLVTSGSLYGALFGSIVAFTI 114

Query: 942  SDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSP 1121
            +D+IGRR  ++LAA  +++GAL+  LAPTY  L+ GRV+ G+ VG ++  AP+Y +E +P
Sbjct: 115  ADVIGRRKELILAALLYLVGALVTALAPTYSVLIIGRVIYGVSVGLAMHAAPMYIAETAP 174

Query: 1122 AMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANI--SWRLMLGLS 1256
            +  RG L SL E F    I++G V    +  L  N+   WR M   S
Sbjct: 175  SPIRGQLVSLKEFF----IVLGMVGGYGIGSLTVNVHSGWRYMYATS 217



>pir|C91106|C91106 galactose-proton symport of transport system
            ECs3819 [imported] - Escherichia coli (strain O157:H7,
            substrain RIMD 0509952)>pir|F85951|F85951
            galactose-proton symport of transport system [imported] -
            Escherichia coli (strain O157:H7, substrain
            EDL933)>gb:AE005174_68073 Escherichia coli O157:H7
            EDL933, complete genome.>gb:BA000007_661831 Escherichia
            coli O157:H7 DNA, complete genome.
          Length = 464

 Score = 93.6 bits (231), Expect = 8e-18
 Identities = 53/164 (32%), Positives = 86/164 (52%)
 Frame = +3

Query: 762  FLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKT 941
            F     A+   +L G D+GV++GA+ FI + F+I+S   E                SG  
Sbjct: 16   FFVCFLAALAGLLFGLDIGVIAGALPFIADEFQITSHTQEWVVSSMMFGAAVGAVGSGWL 75

Query: 942  SDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSP 1121
            S  +GR+ ++++ A  F+ G+L    AP    L+  RV+ G+ VG +   AP+Y SE++P
Sbjct: 76   SFKLGRKKSLMIGAILFVAGSLFSAAAPNVEVLILSRVLLGLAVGVASYTAPLYLSEIAP 135

Query: 1122 AMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
               RG + S+ ++ I +GIL  ++S+   S   A   WR MLG+
Sbjct: 136  EKIRGSMISMYQLMITIGILGAYLSDTAFSYTGA---WRWMLGV 176



>pir|D84772|D84772 probable sugar transporter [imported] - Arabidopsis
            thaliana>gb:AC006068_1533352 Arabidopsis thaliana
            chromosome 2 clone T20F21 map ve016, complete sequence.
          Length = 580

 Score = 93.6 bits (231), Expect = 8e-18
 Identities = 55/165 (33%), Positives = 87/165 (52%), Gaps = 3/165 (1%)
 Frame = +3

Query: 771  AVFASTNSILLGYDLGVMSGAVLFIKETF---KISSVQHEXXXXXXXXXXXXXXXASGKT 941
            A+ A    +L GY+ GV++GA+L+IKE F      +   E                 G  
Sbjct: 30   ALSAGIGGLLFGYNTGVIAGALLYIKEEFGEVDNKTWLQEIIVSMTVAGAIVGAAIGGWY 89

Query: 942  SDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSP 1121
            +D  GRR ++++A   F++GAL+M +A     ++ GR++ G GVG + M +P+Y SE+SP
Sbjct: 90   NDKFGRRMSVLIADVLFLLGALVMVIAHAPWVIILGRLLVGFGVGMASMTSPLYISEMSP 149

Query: 1122 AMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            A  RG L S   + I  G  + ++ N+     P   +WR MLG+S
Sbjct: 150  ARIRGALVSTNGLLITGGQFLSYLINLAFVHTPG--TWRWMLGVS 192



>gb:AY643749_1619165 Oryza sativa (japonica cultivar-group)
            monosaccharide transporter 7 (MST7) mRNA, complete
            cds.>gb:AP003141_1824846 Oryza sativa (japonica
            cultivar-group) genomic DNA, chromosome 1, PAC
            clone:P0002B05.
          Length = 512

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 58/203 (28%), Positives = 96/203 (47%), Gaps = 20/203 (9%)
 Frame = +3

Query: 708  GGAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAV------------LFIKE 851
            G   G+P     ++  F F+  + AS+  ++ GYD+G+  G              ++ KE
Sbjct: 5    GAGDGAPKHYPGKMTVFVFIACLVASSGGLIFGYDIGISGGVTSMDPFLSRFFPSVYAKE 64

Query: 852  TFKISSVQH-----EXXXXXXXXXXXXXXXASGKTSDM---IGRRYTIVLAAATFIIGAL 1007
               + + Q+     E               AS   S +   +GR+ T++     F+IGA+
Sbjct: 65   KEVVDTNQYCKFDSEPLTLFTSSLYLAALIASLFASVITRKLGRKMTMLGGGFIFLIGAV 124

Query: 1008 LMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIG 1187
            L G A     L+ GR++ GIGVG+S+   P+Y SE++PA  RG L+ + ++ I VGIL  
Sbjct: 125  LNGAAVNVAMLIIGRILLGIGVGFSIQAVPLYLSEMAPAKMRGMLNIIFQLMITVGILFA 184

Query: 1188 FVSNILLSGLPANISWRLMLGLS 1256
             + N     +     WR+ LGL+
Sbjct: 185  NLINYFTDKIAGGWGWRVSLGLA 207



>gb:AY036055_1560031 Olea europaea hexose transporter pGlT mRNA,
            complete cds; nuclear gene for plastid product.
          Length = 544

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 55/161 (34%), Positives = 84/161 (52%), Gaps = 2/161 (1%)
 Frame = +3

Query: 780  ASTNSILLGYDLGVMSGAVLFIKETFKIS--SVQHEXXXXXXXXXXXXXXXASGKTSDMI 953
            A   +IL GY LGV++GA+ ++ +   I+  +V                    G  +D  
Sbjct: 110  ACLGAILFGYHLGVVNGALEYLAKDLGIAENAVLQGWVVSTLLAGATVGSFTGGSLADKF 169

Query: 954  GRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTR 1133
            GR  T +L A    +GA L   A     ++ GR++AGIG+G S  I P+Y SE+SP   R
Sbjct: 170  GRTKTFLLDAIPLAVGAFLCATAQNIETMIIGRLLAGIGIGISSAIVPLYISEISPTEIR 229

Query: 1134 GFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            G L S+ ++FI +GIL   V+ + L+G P  + WR M G++
Sbjct: 230  GTLGSVNQLFICIGILAALVAGLPLAGNP--LWWRTMFGVA 268



>gb:AX172681_1463062 Sequence 171 from Patent WO0144476.
          Length = 480

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 51/161 (31%), Positives = 85/161 (52%), Gaps = 2/161 (1%)
 Frame = +3

Query: 780  ASTNSILLGYDLGVMSGAVLFIKET--FKISSVQHEXXXXXXXXXXXXXXXASGKTSDMI 953
            A   +IL GY LGV++GA+ +I +   F   +V+                   G  +D +
Sbjct: 43   ACLGAILFGYHLGVVNGALEYISKDLGFATDAVKQGWVVSSTLAGATVGSFTGGALADNL 102

Query: 954  GRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTR 1133
            GR+ T  + A   I+G LL   A ++  ++ GR++ G+G+G S  + P+Y SE+SP   R
Sbjct: 103  GRKRTFQINAVPLIVGTLLSAKATSFEAMVIGRILVGVGIGVSSGVVPLYISEVSPTEIR 162

Query: 1134 GFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            G + +L ++FI VGIL+  ++ + L   P  + WR M  L+
Sbjct: 163  GTMGTLNQLFICVGILLALIAGLPLGSNP--VWWRTMFALA 201



>gb:CP000009_863061 Gluconobacter oxydans 621H, complete genome.
          Length = 494

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 56/164 (34%), Positives = 83/164 (50%)
 Frame = +3

Query: 765  LCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTS 944
            L AV A+    L GYD G++SG +  I + F++ +   E               A+G  S
Sbjct: 32   LAAVVAAICGGLYGYDTGIISGTLPLIGDDFRLGATMKEWVASAILLGAIFGAFAAGGLS 91

Query: 945  DMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPA 1124
            +  GRR T  + +  F++GA    LAP    L+  R V G+ VG S  + P+Y SEL+P 
Sbjct: 92   EKFGRRNTTCMVSGLFVVGATACSLAPDVWSLIGARFVLGLAVGGSTQVVPMYISELAPQ 151

Query: 1125 MTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
              RG L ++  V I +GILI   +NI+      N  WR M+G++
Sbjct: 152  ERRGTLVTMFNVAIGLGILI---ANIIGFTERVNWGWRPMVGVA 192



>gb:AF280432_1782885 Mesembryanthemum crystallinum putative
            Na+/myo-inositol symporter (Itr2) mRNA, complete cds.
          Length = 581

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 55/165 (33%), Positives = 83/165 (50%), Gaps = 3/165 (1%)
 Frame = +3

Query: 771  AVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQ---HEXXXXXXXXXXXXXXXASGKT 941
            A  A    +L GYD GV+SGA+L+IKE FK    +    E                 G  
Sbjct: 31   AFSAGIGGLLFGYDTGVISGALLYIKEDFKEVERKTWLQETIVAMAVAGAIIGAGVGGYL 90

Query: 942  SDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSP 1121
            +D  GR+  I++A   F IGA++M LAP    ++ GR+  G+GVG + M +P+Y SE SP
Sbjct: 91   NDKFGRKPAIIIADILFFIGAIIMSLAPAPWMIILGRIFVGLGVGMASMTSPLYISETSP 150

Query: 1122 AMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
               R  L S   + I     + ++ N+  + +    +WR MLG++
Sbjct: 151  TRIRSALVSTNGLLITGSQFLSYLINLGFTRVKG--TWRWMLGVA 193



>gb:AB016890_1513215 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MNC17.>gb:BT015354_1642182 Arabidopsis thaliana
            At5g59250 gene, complete cds.>gb:BT020338_1642733
            Arabidopsis thaliana At5g59250 gene, complete cds.
          Length = 558

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 50/146 (34%), Positives = 78/146 (53%), Gaps = 7/146 (4%)
 Frame = +3

Query: 774  VFASTNSILLGYDLGVMSGAVLFIKET-------FKISSVQHEXXXXXXXXXXXXXXXAS 932
            +F +   +L GYD+G  SGA L ++         F  S VQ                 + 
Sbjct: 103  IFPALGGLLFGYDIGATSGATLSLQSPALSGTTWFNFSPVQLGLVVSGSLYGALLGSISV 162

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
               +D +GRR  +++AA  +++G+L+ G AP    LL GR++ G G+G ++  AP+Y +E
Sbjct: 163  YGVADFLGRRRELIIAAVLYLLGSLITGCAPDLNILLVGRLLYGFGIGLAMHGAPLYIAE 222

Query: 1113 LSPAMTRGFLSSLPEVFINVGILIGF 1190
              P+  RG L SL E+FI +GIL+GF
Sbjct: 223  TCPSQIRGTLISLKELFIVLGILLGF 248



>gb:BX248345_760721 Mycobacterium bovis subsp. bovis AF2122/97
            complete genome; segment 12/14.
          Length = 502

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 56/204 (27%), Positives = 103/204 (50%)
 Frame = +3

Query: 645  GIDSAKGRTEPMEITMVESRPGGAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVM 824
            G+ + +G   P        RPG    +      R  + A L  + A++  +L GYDL  +
Sbjct: 19   GVHARRGARRPRPRGGRAERPGTGQLT------RSGRRALLVGLTAASVGVLYGYDLSAI 72

Query: 825  SGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGA 1004
            +GA+L + E F++++ + E                 G  ++ IGR+ ++VL  A + + A
Sbjct: 73   AGALLSLSEEFELTTREQELLTTTAVLGQIAGALGGGILANAIGRKKSVVLIVAGYAVFA 132

Query: 1005 LLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILI 1184
            LL   + +   L+  R++ G+ +G S+++ PVY +E +PA  RG L +  ++    GI++
Sbjct: 133  LLGATSVSVPMLVVARLLLGVTIGLSVVVVPVYVAESAPAAVRGSLVTAYQLATLSGIVV 192

Query: 1185 GFVSNILLSGLPANISWRLMLGLS 1256
            G++   LL+G   +  WR M GL+
Sbjct: 193  GYLVGYLLAG---SHGWRAMFGLA 213



>gb:AE017241_414539 Mycobacterium avium subsp. paratuberculosis str.
            k10, section 15 of 16 of the complete
            genome.>gb:AE016958_1057943 Mycobacterium avium subsp.
            paratuberculosis str. k10, complete genome.
          Length = 476

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 61/186 (32%), Positives = 90/186 (48%)
 Frame = +3

Query: 699  SRPGGAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQH 878
            +R  G   +P  P R+L     + A+ A+ + +L GYD GV+S A+L + + F I+    
Sbjct: 8    NRWSGVREAPTAPSRQLTGAVVIIALVAAISGMLYGYDTGVISWALLQLTQDFNITEGWQ 67

Query: 879  EXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVV 1058
            +                    SD+ GRR T+++ A  FI+GAL    A     L  GR+V
Sbjct: 68   QVIAASILLGAVAGALTCSWLSDLRGRRGTLLMLAVVFIVGALWCADAADSVMLSLGRLV 127

Query: 1059 AGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWR 1238
             G  VG +   AP+Y +EL+P   RG L    ++ I VGIL        L G   +ISWR
Sbjct: 128  LGFAVGGATQTAPMYVAELAPPAYRGRLVLCFQIAIGVGIL-----TATLVGAGGSISWR 182

Query: 1239 LMLGLS 1256
              +GL+
Sbjct: 183  GPIGLA 188



>gb:AE016765_327425 Escherichia coli CFT073 section 11 of 18 of the
            complete genome.>gb:AE014075_958009 Escherichia coli
            CFT073 complete genome.
          Length = 515

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 56/179 (31%), Positives = 97/179 (54%), Gaps = 2/179 (1%)
 Frame = +3

Query: 723  SPHPPK--RRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXX 896
            +P P +  RR+N F  + A  A    +L G D+GV++GA+ FI + F ++S   E     
Sbjct: 54   TPRPLRDTRRMNMFVSVAAAVAG---LLFGLDIGVIAGALPFITDHFVLTSRLQEWVVSS 110

Query: 897  XXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVG 1076
                       +G  S  +GR+Y+++  A  F++G++    A +   L+A RVV GI VG
Sbjct: 111  MMLGAAIGALFNGWLSFRLGRKYSLMAGAILFVLGSIGSAFATSVEMLIAARVVLGIAVG 170

Query: 1077 YSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
             +   AP+Y SE++    RG + S+ ++ + +GI++ F+S+   S    + +WR MLG+
Sbjct: 171  IASYTAPLYLSEMASENVRGKMISMYQLMVTLGIVLAFLSDTAFS---YSGNWRAMLGV 226



>gb:AE000516_23547 Mycobacterium tuberculosis CDC1551, complete
            genome.
          Length = 500

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 56/204 (27%), Positives = 103/204 (50%)
 Frame = +3

Query: 645  GIDSAKGRTEPMEITMVESRPGGAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVM 824
            G+ + +G   P        RPG    +      R  + A L  + A++  +L GYDL  +
Sbjct: 19   GVHARRGARRPRPRGGRAERPGTGQLT------RSGRRALLVGLTAASVGVLYGYDLSAI 72

Query: 825  SGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGA 1004
            +GA+L + E F++++ + E                 G  ++ IGR+ ++VL  A + + A
Sbjct: 73   AGALLSLSEEFELTTREQELLTTTAVLGQIAGALGGGILANAIGRKKSVVLIVAGYAVFA 132

Query: 1005 LLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILI 1184
            LL   + +   L+  R++ G+ +G S+++ PVY +E +PA  RG L +  ++    GI++
Sbjct: 133  LLGATSVSVPMLVVARLLLGVTIGLSVVVVPVYVAESAPAAVRGSLVTAYQLATLSGIVV 192

Query: 1185 GFVSNILLSGLPANISWRLMLGLS 1256
            G++   LL+G   +  WR M GL+
Sbjct: 193  GYLVGYLLAG---SHGWRAMFGLA 213



>pir|B70845|B70845 probable sygar transport protein - Mycobacterium
            tuberculosis (strain H37RV)>gb:BX842582_821437
            Mycobacterium tuberculosis H37Rv complete genome; segment
            11/13.
          Length = 502

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 56/204 (27%), Positives = 103/204 (50%)
 Frame = +3

Query: 645  GIDSAKGRTEPMEITMVESRPGGAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVM 824
            G+ + +G   P        RPG    +      R  + A L  + A++  +L GYDL  +
Sbjct: 19   GVHARRGARRPRPRGGRAERPGTGQLT------RSGRRALLVGLTAASVGVLYGYDLSAI 72

Query: 825  SGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGA 1004
            +GA+L + E F++++ + E                 G  ++ IGR+ ++VL  A + + A
Sbjct: 73   AGALLSLSEEFELTTREQELLTTTAVLGQIAGALGGGILANAIGRKKSVVLIVAGYAVFA 132

Query: 1005 LLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILI 1184
            LL   + +   L+  R++ G+ +G S+++ PVY +E +PA  RG L +  ++    GI++
Sbjct: 133  LLGATSVSVPMLVVARLLLGVTIGLSVVVVPVYVAESAPAAVRGSLVTAYQLATLSGIVV 192

Query: 1185 GFVSNILLSGLPANISWRLMLGLS 1256
            G++   LL+G   +  WR M GL+
Sbjct: 193  GYLVGYLLAG---SHGWRAMFGLA 213



>pir|T27072|T27072 hypothetical protein Y51A2D.4 - Caenorhabditis
            elegans>gb:CEY51A2D_1370383 Caenorhabditis elegans YAC
            Y51A2D, complete sequence.
          Length = 606

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 59/180 (32%), Positives = 89/180 (49%), Gaps = 4/180 (2%)
 Frame = +3

Query: 729  HPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKET---FKISSVQHEXXXXXX 899
            H PK  L  F ++ A  +     L GYD  V+S A+L++ +      + +V  E      
Sbjct: 17   HTPK--LGLFVYILAAASVIGGFLFGYDTSVVSAAMLYMPDAPGLKPMDTVWQEVLVSIS 74

Query: 900  XXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGY 1079
                      SG +SD IGRR  I+ A+A F IGAL+   +     LL GRV+ GI +G+
Sbjct: 75   PGMAAVGSLMSGTSSDYIGRRKVILGASAIFTIGALVCAASVNKIMLLVGRVLLGIAIGF 134

Query: 1080 SLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGL-PANISWRLMLGLS 1256
            + MI PVY  E +P   RG L +   + I+ G ++  ++    S + P N+ WRLM   +
Sbjct: 135  ASMIVPVYLGETAPTHVRGMLVAAFALMISFGQVVANITGGAFSYIDPYNVGWRLMFAFA 194



>pir|AC0877|AC0877 galactose-proton symport (galactose transporter)
            STY3244 [imported] - Salmonella enterica subsp. enterica
            serovar Typhi (strain CT18)>gb:CP000026_77676 Salmonella
            enterica subsp. enterica serovar Paratypi A str. ATCC
            9150.>gb:AE008842_244738 Salmonella typhimurium LT2,
            section 146 of 220 of the complete
            genome.>gb:AE016844_347011 Salmonella enterica subsp.
            enterica serovar Typhi Ty2, section 11 of 16 of the
            complete genome.>gb:AL627277_543331 Salmonella enterica
            serovar Typhi (Salmonella typhi) strain CT18, complete
            chromosome; segment 13/20.>gb:AE014613_984343 Salmonella
            enterica subsp. enterica serovar Typhi Ty2, complete
            genome.>gb:AE006468_1001820 Salmonella typhimurium LT2,
            complete genome.
          Length = 464

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 55/171 (32%), Positives = 89/171 (52%), Gaps = 1/171 (0%)
 Frame = +3

Query: 744  RLNK-FAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXX 920
            R NK   F     A+   +L G D+GV++GA+ FI + F+I++   E             
Sbjct: 9    RSNKAMTFFVCFLAALAGLLFGLDIGVIAGALPFITDEFQITAHTQEWVVSSMMFGAAVG 68

Query: 921  XXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPV 1100
               SG  S  +GR+ ++++ A  F+ G+L    AP    L+  RV+ G+ VG +   AP+
Sbjct: 69   AVGSGWLSFKLGRKKSLMIGAILFVAGSLFSAAAPNVEVLIISRVLLGLAVGVASYTAPL 128

Query: 1101 YTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            Y SE++P   RG + S+ ++ I +GIL  ++S+   S   A   WR MLG+
Sbjct: 129  YLSEIAPEKIRGSMISMYQLMITIGILGAYLSDTAFSYSGA---WRWMLGV 176



>gb:AE017341_1753926 Cryptococcus neoformans var. neoformans JEC21
            chromosome 1, complete sequence.
          Length = 567

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 56/172 (32%), Positives = 87/172 (50%), Gaps = 2/172 (1%)
 Frame = +3

Query: 744  RLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFK--ISSVQHEXXXXXXXXXXXX 917
            ++ KF +   + A+ + +L GYD   +SG ++ IK+     +SS Q E            
Sbjct: 76   KITKFVWTLVLAAAISGLLFGYDTAAISGMLVIIKDDLGTILSSWQKEAITSATTLGALL 135

Query: 918  XXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAP 1097
               A+G  SD  GRR  IV A   FI G++      T   ++AGR + G+GVG +  I P
Sbjct: 136  GGLAAGCISDFTGRRLVIVFANVAFIGGSICQAACHTVAVMIAGRFIVGLGVGLASCIVP 195

Query: 1098 VYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            +Y  EL+P M RG L ++  V I +G ++ +   I  S   A+  WR ++GL
Sbjct: 196  LYIGELAPTMIRGRLVTINCVAITLGQVVAYA--IGASFQNAHNGWRWIVGL 245



>gb:CR382129_1661574 Yarrowia lipolytica chromosome C of strain CLIB99
            of Yarrowia lipolytica.
          Length = 515

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 58/172 (33%), Positives = 87/172 (50%), Gaps = 7/172 (4%)
 Frame = +3

Query: 759  AFLCAVFASTNSILLGYDLGVMSG--AVLFIKETF-----KISSVQHEXXXXXXXXXXXX 917
            A   AVF +   IL GYD G +SG  A+ F+K+TF     + +S Q              
Sbjct: 20   AAFVAVFVAFGGILFGYDTGTISGVMAMPFVKKTFTDDGLEFTSEQTSLITSILSAGTFT 79

Query: 918  XXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAP 1097
               ++   SD +GRR  ++L    F +GA+L   A     L+ GRVVAG+GVG    I P
Sbjct: 80   GAISAPWASDTLGRRLGLILFCVVFSVGAILQTAATGRTLLIVGRVVAGLGVGGVSSIVP 139

Query: 1098 VYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            +Y SE++P   RG + S+ +  I +G+L+  + N        + S+R+ LGL
Sbjct: 140  LYQSEVAPKWIRGAVVSIYQFAITIGLLLAAIVNNATKNKDNSASYRIPLGL 191



>gb:ECU29581_133935 Escherichia coli K-12 genome; approximately 63 to
            64 minutes.
          Length = 472

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 54/171 (31%), Positives = 93/171 (54%)
 Frame = +3

Query: 741  RRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXX 920
            RR+N F  + A  A    +L G D+GV++GA+ FI + F ++S   E             
Sbjct: 19   RRMNMFVSVAAAVAG---LLFGLDIGVIAGALPFITDHFVLTSRLQEWVVSSMMLGAAIG 75

Query: 921  XXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPV 1100
               +G  S  +GR+Y+++  A  F++G++    A +   L+A RVV GI VG +   AP+
Sbjct: 76   ALFNGWLSFRLGRKYSLMAGAILFVLGSIGSAFATSVEMLIAARVVLGIAVGIASYTAPL 135

Query: 1101 YTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            Y SE++    RG + S+ ++ + +GI++ F+S+   S    + +WR MLG+
Sbjct: 136  YLSEMASENVRGKMISMYQLMVTLGIVLAFLSDTAFS---YSGNWRAMLGV 183



>gb:AE005674_72433 Shigella flexneri 2a str. 301, complete
            genome.>gb:AE016988_372611 Shigella flexneri 2a str.
            2457T section 11 of 16 of the complete
            genome.>gb:AE014073_997361 Shigella flexneri 2a str.
            2457T complete genome.
          Length = 472

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 54/171 (31%), Positives = 93/171 (54%)
 Frame = +3

Query: 741  RRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXX 920
            RR+N F  + A  A    +L G D+GV++GA+ FI + F ++S   E             
Sbjct: 19   RRMNMFVSVAAAVAG---LLFGLDIGVIAGALPFITDHFVLTSRLQEWVVSSMMLGAAIG 75

Query: 921  XXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPV 1100
               +G  S  +GR+Y+++  A  F++G++    A +   L+A RVV GI VG +   AP+
Sbjct: 76   ALFNGWLSFRLGRKYSLMAGAILFVLGSIGSAFATSVEMLIAARVVLGIAVGIASYTAPL 135

Query: 1101 YTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            Y SE++    RG + S+ ++ + +GI++ F+S+   S    + +WR MLG+
Sbjct: 136  YLSEMASENVRGKMISMYQLMVTLGIVLAFLSDTAFS---YSGNWRAMLGV 183



>sp|P87110|ITR2_SCHPO Myo-inositol transporter 2.>pir|T38125|T38125
            myo-inositol transporter 2 - fission yeast
            (Schizosaccharomyces pombe)>gb:SPAC20G8_1717071 S.pombe
            chromosome I cosmid c20G8.
          Length = 557

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 51/172 (29%), Positives = 89/172 (51%), Gaps = 2/172 (1%)
 Frame = +3

Query: 744  RLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFK--ISSVQHEXXXXXXXXXXXX 917
            +++ + ++ +  A  + +L GYD GV+SGA+  +       +SS Q E            
Sbjct: 76   KISSWIWVLSAVAGISGLLFGYDTGVISGALAVLGSDLGHVLSSGQKELITSATSFAALI 135

Query: 918  XXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAP 1097
                SG  +D +GR+  ++ A A F+IG+++M  +     ++ GR + G G+G + +I P
Sbjct: 136  SATTSGWLADWVGRKRLLLCADAIFVIGSVIMAASRNVAMMVVGRFIVGYGIGLTSLIVP 195

Query: 1098 VYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            +Y +EL+PA  RG L  +  VFI  G LI +  N     +  +  WR+M G+
Sbjct: 196  MYITELAPARLRGRLVIIYVVFITGGQLIAYSLNAAFEHV--HQGWRIMFGI 245



>sp|P45598|ARAE_KLEOX Arabinose-proton symporter (Arabinose
            transporter).>pir|S47089|S47089 arabinose-proton
            symporter - Klebsiella oxytoca>gb:KOARAE_139175 K.oxytoca
            araE gene.
          Length = 472

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 53/171 (30%), Positives = 93/171 (54%)
 Frame = +3

Query: 741  RRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXX 920
            RR+N+F  + A  A    +L G D+GV++GA+ FI + F +SS   E             
Sbjct: 19   RRMNQFVSIAAAVAG---LLFGLDIGVIAGALPFITDHFVLSSRLQEWVVSSMMLGAAIG 75

Query: 921  XXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPV 1100
               +G  S  +GR+Y++++ A  F+ G++    A +   LL  R+V G+ VG +   AP+
Sbjct: 76   ALFNGWLSFRLGRKYSLMVGAVLFVAGSVGSAFATSVEMLLVARIVLGVAVGIASYTAPL 135

Query: 1101 YTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            Y SE++    RG + S+ ++ + +GI++ F+S+   S    + +WR MLG+
Sbjct: 136  YLSEMASENVRGKMISMYQLMVTLGIVMAFLSDTAFS---YSGNWRAMLGV 183



>sp|P09830|ARAE_ECOLI Arabinose-proton symporter (Arabinose
            transporter).>pir|B91091|B91091 L-arabinose isomerase (EC
            5.3.1.4) - Escherichia coli  (strain O157:H7, substrain
            RIMD 0509952)>pir|E85936|E85936 L-arabinose isomerase (EC
            5.3.1.4) - Escherichia coli  (strain O157:H7, substrain
            EDL933)>pir|B26430|B26430 L-arabinose isomerase (EC
            5.3.1.4) - Escherichia coli  (strain
            K-12)>gb:AE005174_67952 Escherichia coli O157:H7 EDL933,
            complete genome.>gb:ECOARAEA_128121 E.coli
            arabinose-proton symporter (araE) gene, complete cds, and
            LysA activator protein (lysR) gene, 3'
            end.>gb:U00096_201863 Escherichia coli K-12 MG1655
            complete genome.>gb:BA000007_661710 Escherichia coli
            O157:H7 DNA, complete genome.
          Length = 472

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 54/171 (31%), Positives = 93/171 (54%)
 Frame = +3

Query: 741  RRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXX 920
            RR+N F  + A  A    +L G D+GV++GA+ FI + F ++S   E             
Sbjct: 19   RRMNMFVSVAAAVAG---LLFGLDIGVIAGALPFITDHFVLTSRLQEWVVSSMMLGAAIG 75

Query: 921  XXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPV 1100
               +G  S  +GR+Y+++  A  F++G++    A +   L+A RVV GI VG +   AP+
Sbjct: 76   ALFNGWLSFRLGRKYSLMAGAILFVLGSIGSAFATSVEMLIAARVVLGIAVGIASYTAPL 135

Query: 1101 YTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            Y SE++    RG + S+ ++ + +GI++ F+S+   S    + +WR MLG+
Sbjct: 136  YLSEMASENVRGKMISMYQLMVTLGIVLAFLSDTAFS---YSGNWRAMLGV 183



>gb:AX008640_1456283 Sequence 1 from Patent
            WO9966042.>gb:AF215854_1777955 Zea mays hexose
            transporter (pGlcT) mRNA, partial cds; nuclear gene for
            chloroplast product.
          Length = 542

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 53/161 (32%), Positives = 84/161 (52%), Gaps = 2/161 (1%)
 Frame = +3

Query: 780  ASTNSILLGYDLGVMSGAVLFIKETFKIS--SVQHEXXXXXXXXXXXXXXXASGKTSDMI 953
            A   +IL GY LGV++GA+ ++ +   I+  +V                    G  +D  
Sbjct: 108  ACLGAILFGYHLGVVNGALEYLAKDLGIAENAVLQGWVVSTSLAGATLGSFTGGSLADKF 167

Query: 954  GRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTR 1133
            GR  T +L A    +GA L   A     ++ GR++AGIG+G S  + P+Y SE+SP   R
Sbjct: 168  GRTRTFILDAVPLALGAFLSATAQDIRTMIIGRLLAGIGIGVSSALVPLYISEISPTEIR 227

Query: 1134 GFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            G L ++ ++FI +GIL   ++ + L+G PA   WR M G++
Sbjct: 228  GTLGTVNQLFICIGILAALLAGLPLAGNPA--WWRTMFGIA 266



>pir|T23658|T23658 hypothetical protein M01F1.5 - Caenorhabditis
            elegans
          Length = 639

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 61/191 (31%), Positives = 92/191 (48%), Gaps = 8/191 (4%)
 Frame = +3

Query: 690  MVESRP---GGAHGSPHPPKR-RLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETF 857
            MV+  P   G   G   P    +   F ++ A  A     L GYD G++S A+L++    
Sbjct: 1    MVQVAPVAAGAGSGQTRPSSDPKTGWFVYMLAFSAVIGGFLFGYDTGIVSAAMLYVPNAS 60

Query: 858  KIS---SVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPT 1028
             I    SV  E                SG  SD +GR+  I+ A+ TF IGA++   A T
Sbjct: 61   GIKPLDSVWQEIIVSITPGVAAIGSLCSGPGSDFLGRKKIIIGASVTFTIGAIICAAAWT 120

Query: 1029 YGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILL 1208
               LL GR++ G+ +G++ MI P+Y SE SP+  RG L +  ++ I VG++I  +     
Sbjct: 121  KIILLIGRILLGLAIGFASMIVPIYVSEASPSHIRGKLVTGFQLMITVGLVIANIIGGAF 180

Query: 1209 SGL-PANISWR 1238
            S + P  + WR
Sbjct: 181  SYVDPDQVGWR 191



>gb:AK052156_1169909 Mus musculus 13 days embryo heart cDNA, RIKEN
            full-length enriched library, clone:D330001H08
            product:solute carrier family 2 (facilitated glucose
            transporter), member 10, full insert
            sequence.>gb:AY029579_2074083 Mus musculus glucose
            transporter 10 mRNA, complete cds.
          Length = 536

 Score = 91.7 bits (226), Expect = 3e-17
 Identities = 57/162 (35%), Positives = 81/162 (50%)
 Frame = +3

Query: 765  LCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTS 944
            LCA  +    +  GY+L V+SGA+L ++  F +S ++ E                 G   
Sbjct: 10   LCASVSLLGGLTFGYELAVISGALLPLQLNFGLSCLEQELLVGSLLLGALLASLVGGFLI 69

Query: 945  DMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPA 1124
            D  GRR  I+ + A  + G+L++GLA +  +LL GR+  G  +  S M   +Y SEL   
Sbjct: 70   DCYGRRRAILGSNAVLLAGSLILGLASSLPWLLLGRLSVGFAISLSSMACCIYVSELVGP 129

Query: 1125 MTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLG 1250
              RG L SL EV I VGIL  +  N +L+G P    WR M G
Sbjct: 130  RQRGVLVSLYEVGITVGILFSYGLNYVLAGSP--WGWRHMFG 169



>gb:AF215853_1777954 Solanum tuberosum hexose transporter (pGlcT)
            mRNA, partial cds; nuclear gene for chloroplast product.
          Length = 470

 Score = 91.3 bits (225), Expect = 4e-17
 Identities = 55/161 (34%), Positives = 84/161 (52%), Gaps = 2/161 (1%)
 Frame = +3

Query: 780  ASTNSILLGYDLGVMSGAVLFIKETFKIS--SVQHEXXXXXXXXXXXXXXXASGKTSDMI 953
            A   +IL GY LGV++GA+ ++ +   I+  +V                    G  +D  
Sbjct: 36   ACLGAILFGYHLGVVNGALEYLAKDLGIAENTVIQGWIVSTVLAGAFVGSFTGGVLADKF 95

Query: 954  GRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTR 1133
            GR  T +L A    +GA L   A +   ++ GR++ GIG+G S  I P+Y SE+SP   R
Sbjct: 96   GRTKTFILDAIPLSVGAFLCTTAQSVQAMIIGRLLTGIGIGISSAIVPLYISEISPTEIR 155

Query: 1134 GFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            G L ++ ++FI +GIL+  V  + LSG P+   WR M GL+
Sbjct: 156  GTLGTVNQLFICIGILVALVVGLPLSGNPS--WWRTMFGLA 194



>gb:AX008642_1456284 Sequence 3 from Patent WO9966042.
          Length = 472

 Score = 91.3 bits (225), Expect = 4e-17
 Identities = 55/161 (34%), Positives = 84/161 (52%), Gaps = 2/161 (1%)
 Frame = +3

Query: 780  ASTNSILLGYDLGVMSGAVLFIKETFKIS--SVQHEXXXXXXXXXXXXXXXASGKTSDMI 953
            A   +IL GY LGV++GA+ ++ +   I+  +V                    G  +D  
Sbjct: 38   ACLGAILFGYHLGVVNGALEYLAKDLGIAENTVIQGWIVSTVLAGAFVGSFTGGVLADKF 97

Query: 954  GRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTR 1133
            GR  T +L A    +GA L   A +   ++ GR++ GIG+G S  I P+Y SE+SP   R
Sbjct: 98   GRTKTFILDAIPLSVGAFLCTTAQSVQAMIIGRLLTGIGIGISSAIVPLYISEISPTEIR 157

Query: 1134 GFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            G L ++ ++FI +GIL+  V  + LSG P+   WR M GL+
Sbjct: 158  GTLGTVNQLFICIGILVALVVGLPLSGNPS--WWRTMFGLA 196



>gb:AE005674_72516 Shigella flexneri 2a str. 301, complete
            genome.>gb:AE016988_372688 Shigella flexneri 2a str.
            2457T section 11 of 16 of the complete
            genome.>gb:AE014073_997438 Shigella flexneri 2a str.
            2457T complete genome.
          Length = 451

 Score = 91.3 bits (225), Expect = 4e-17
 Identities = 52/164 (31%), Positives = 85/164 (51%)
 Frame = +3

Query: 762  FLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKT 941
            F     A+   +L G D+GV++GA+ FI + F+I+S   E                 G  
Sbjct: 3    FFVCFLAALAGLLFGLDIGVIAGALPFIADEFQITSHTQEWVVSSMMFGAAVGAVGIGWL 62

Query: 942  SDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSP 1121
            S  +GR+ ++++ A  F+ G+L    AP    L+  RV+ G+ VG +   AP+Y SE++P
Sbjct: 63   SFKLGRKKSLMIGAILFVAGSLFSAAAPNVEVLILSRVLLGLAVGVASYTAPLYLSEIAP 122

Query: 1122 AMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
               RG + S+ ++ I +GIL  ++S+   S   A   WR MLG+
Sbjct: 123  EKIRGSMISMYQLMITIGILGAYLSDTAFSYTGA---WRWMLGV 163



>gb:AE017239_414154 Mycobacterium avium subsp. paratuberculosis str.
            k10, section 13 of 16 of the complete
            genome.>gb:AE016958_1057558 Mycobacterium avium subsp.
            paratuberculosis str. k10, complete genome.
          Length = 450

 Score = 90.9 bits (224), Expect = 5e-17
 Identities = 50/171 (29%), Positives = 94/171 (54%)
 Frame = +3

Query: 744  RLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXX 923
            R ++   L  + A++  ++ GYDL +++GA LF+ E F +S+ Q E              
Sbjct: 3    RGSRRGLLVGLTAASVGVIYGYDLSIIAGAQLFVTEDFGLSTRQQELLTTMAVIGQIGGA 62

Query: 924  XASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVY 1103
              +G  ++ IGR+ +++L  + + + ALL   +     LL  R++ G+ +G ++++ PVY
Sbjct: 63   LFAGVLANAIGRQRSVLLILSGYAVFALLAAFSVGLPMLLTARLLLGLTIGVTVVVVPVY 122

Query: 1104 TSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
             +E +P   RG L +  ++ I  G+++G++S  LL+      SWR MLGL+
Sbjct: 123  VAESAPTAVRGALLTAYQLAIVSGLIVGYLSGYLLAD---THSWRWMLGLA 170



>gb:AE008838_244664 Salmonella typhimurium LT2, section 142 of 220 of
            the complete genome.>gb:AE006468_1001746 Salmonella
            typhimurium LT2, complete genome.
          Length = 472

 Score = 90.9 bits (224), Expect = 5e-17
 Identities = 52/171 (30%), Positives = 93/171 (54%)
 Frame = +3

Query: 741  RRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXX 920
            RR+N F    +V A+   +L G D+GV++GA+ FI + F ++S   E             
Sbjct: 19   RRMNMFV---SVSAAVAGLLFGLDIGVIAGALPFITDHFVLTSRLQEWVVSSMMLGAAIG 75

Query: 921  XXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPV 1100
               +G  S  +GR+Y+++  A  F++G+L    A +   L+  RV+ G+ VG +   AP+
Sbjct: 76   ALFNGWLSFRLGRKYSLMAGAILFVLGSLGSAFASSVEVLIGARVILGVAVGIASYTAPL 135

Query: 1101 YTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            Y SE++    RG + S+ ++ + +GI++ F+S+   S    + +WR MLG+
Sbjct: 136  YLSEMASENVRGKMISMYQLMVTLGIVLAFLSDTAFS---YSGNWRAMLGV 183



>pir|AB0868|AB0868 L-arabinose isomerase [imported] - Salmonella
            enterica subsp. enterica serovar Typhi (strain
            CT18)>gb:CP000026_77610 Salmonella enterica subsp.
            enterica serovar Paratypi A str. ATCC
            9150.>gb:AE016844_346936 Salmonella enterica subsp.
            enterica serovar Typhi Ty2, section 11 of 16 of the
            complete genome.>gb:AL627277_543258 Salmonella enterica
            serovar Typhi (Salmonella typhi) strain CT18, complete
            chromosome; segment 13/20.>gb:AE014613_984268 Salmonella
            enterica subsp. enterica serovar Typhi Ty2, complete
            genome.
          Length = 471

 Score = 90.9 bits (224), Expect = 5e-17
 Identities = 52/171 (30%), Positives = 93/171 (54%)
 Frame = +3

Query: 741  RRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXX 920
            RR+N F    +V A+   +L G D+GV++GA+ FI + F ++S   E             
Sbjct: 18   RRMNMFV---SVSAAVAGLLFGLDIGVIAGALPFITDHFVLTSRLQEWVVSSMMLGAAIG 74

Query: 921  XXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPV 1100
               +G  S  +GR+Y+++  A  F++G+L    A +   L+  RV+ G+ VG +   AP+
Sbjct: 75   ALFNGWLSFRLGRKYSLMAGAILFVLGSLGSAFASSVEVLIGARVILGVAVGIASYTAPL 134

Query: 1101 YTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            Y SE++    RG + S+ ++ + +GI++ F+S+   S    + +WR MLG+
Sbjct: 135  YLSEMASENVRGKMISMYQLMVTLGIVLAFLSDTAFS---YSGNWRAMLGV 182



>gb:AP000615_1820473 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 3, clone:P0043E01.
          Length = 723

 Score = 90.5 bits (223), Expect = 6e-17
 Identities = 53/166 (31%), Positives = 89/166 (53%), Gaps = 2/166 (1%)
 Frame = +3

Query: 759  AFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISS--VQHEXXXXXXXXXXXXXXXAS 932
            A L A+ AS  ++L G+D   ++GA+++IK  F + +  +                   S
Sbjct: 59   AVLAAIVASIGNLLQGWDNAAIAGAIMYIKNEFNLQNDPMMEGLILAMSLIGATIITALS 118

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
            G  ++ IG+R  + +AA  + I AL+M  A     LL  R++ G G G  +  AP+Y SE
Sbjct: 119  GMITNSIGKRPLLSVAAILYSISALIMFQASNEYMLLLARLIYGFGSGLVVTYAPLYISE 178

Query: 1113 LSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLG 1250
             +P   RG L++LP+   ++G+L+ ++   L+S L  N +WR+MLG
Sbjct: 179  TAPTNMRGLLNTLPQFNGSLGMLLSYIMVFLMS-LTLNPNWRIMLG 223



>gb:AC099739_1737223 Oryza sativa (japonica cultivar-group) chromosome
            3 clone OJ1528D07, complete sequence.
          Length = 714

 Score = 90.5 bits (223), Expect = 6e-17
 Identities = 53/166 (31%), Positives = 89/166 (53%), Gaps = 2/166 (1%)
 Frame = +3

Query: 759  AFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISS--VQHEXXXXXXXXXXXXXXXAS 932
            A L A+ AS  ++L G+D   ++GA+++IK  F + +  +                   S
Sbjct: 50   AVLAAIVASIGNLLQGWDNAAIAGAIMYIKNEFNLQNDPMMEGLILAMSLIGATIITALS 109

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
            G  ++ IG+R  + +AA  + I AL+M  A     LL  R++ G G G  +  AP+Y SE
Sbjct: 110  GMITNSIGKRPLLSVAAILYSISALIMFQASNEYMLLLARLIYGFGSGLVVTYAPLYISE 169

Query: 1113 LSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLG 1250
             +P   RG L++LP+   ++G+L+ ++   L+S L  N +WR+MLG
Sbjct: 170  TAPTNMRGLLNTLPQFNGSLGMLLSYIMVFLMS-LTLNPNWRIMLG 214



>gb:AY165599_1586172 Saccharum hybrid cultivar putative sugar
            transporter type 2a mRNA, complete cds.
          Length = 745

 Score = 90.5 bits (223), Expect = 6e-17
 Identities = 53/167 (31%), Positives = 89/167 (53%), Gaps = 2/167 (1%)
 Frame = +3

Query: 759  AFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISS--VQHEXXXXXXXXXXXXXXXAS 932
            A L A+ AS  ++L G+D   +S A+L+IK+ FK+ S                      S
Sbjct: 4    AALVAIVASIGNLLQGWDNATISAALLYIKKEFKLESEPTVEGLIVAMSLIGATIITTFS 63

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
            G  SD IGR   ++L++  + + +L+M  +P    LL  R++ G GVG ++ + P+Y SE
Sbjct: 64   GPVSDWIGRLPMLILSSVLYFVSSLIMLWSPNVYVLLLARLINGFGVGLAVTLVPLYISE 123

Query: 1113 LSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
             +P   RG L++LP+   + G+ + +     +S LP+   WR+MLG+
Sbjct: 124  TAPPEIRGLLNTLPQFSGSGGMFLSYCMVFGMSLLPSP-DWRIMLGV 169



>gb:BA000036_717908 Corynebacterium glutamicum ATCC 13032 DNA,
            complete genome.>gb:BX927148_831771 Corynebacterium
            glutamicum ATCC 13032, IS fingerprint type 4-5, complete
            genome; segment 1/10.
          Length = 491

 Score = 90.5 bits (223), Expect = 6e-17
 Identities = 54/177 (30%), Positives = 89/177 (50%), Gaps = 2/177 (1%)
 Frame = +3

Query: 732  PPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXX 911
            P ++RL    F  A+ A+   +L GYD GV++GA+  +     +++              
Sbjct: 24   PYRKRL----FYVALVATFGGLLFGYDTGVINGALNPMTRELGLTAFTEGVVTSSLLFGA 79

Query: 912  XXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMI 1091
                   G+ SD  GRR TI+  A  F +G ++   AP++  ++ GRV+ G+ VG +  +
Sbjct: 80   AAGAMFFGRISDNWGRRKTIISLAVAFFVGTMICVFAPSFAVMVVGRVLLGLAVGGASTV 139

Query: 1092 APVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANIS--WRLMLGLS 1256
             PVY +EL+P   RG L+   E+ I VG L  FV N ++  +  +    WR ML ++
Sbjct: 140  VPVYLAELAPFEIRGSLAGRNELMIVVGQLAAFVINAIIGNVFGHHDGVWRYMLAIA 196



>gb:AE016822_340512 Leifsonia xyli subsp. xyli str. CTCB07, complete
            genome.
          Length = 500

 Score = 90.5 bits (223), Expect = 6e-17
 Identities = 51/161 (31%), Positives = 88/161 (54%)
 Frame = +3

Query: 771  AVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTSDM 950
            A+ A+    L G+D  V++GAV  I+  F +++                    +G+ +D 
Sbjct: 31   ALAAAVGGFLFGFDSSVINGAVDSIQRNFALNAFVTGFIVAIAFFGCAVGAFVAGRLADR 90

Query: 951  IGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMT 1130
             GR   ++L A  F+I ++  GLA +   L   R+V G+G+G + ++AP Y +E+SP  +
Sbjct: 91   WGRLRVMLLGAVLFLISSVGAGLAFSVWDLGLWRIVGGLGIGIASVVAPAYIAEISPRQS 150

Query: 1131 RGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            RG L SL ++ I +GI +  +S+ LL+G+  + S +L LGL
Sbjct: 151  RGRLGSLQQLAITLGIFVALLSDALLAGIAGSASSQLWLGL 191



>pir|T51556|T51556 sugar transporter-like protein - Arabidopsis
            thaliana>gb:ATF2K13_1550505 Arabidopsis thaliana DNA
            chromosome 5, BAC clone F2K13 (ESSA project).
          Length = 440

 Score = 90.5 bits (223), Expect = 6e-17
 Identities = 57/189 (30%), Positives = 91/189 (48%), Gaps = 13/189 (6%)
 Frame = +3

Query: 729  HPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISS-----------VQ 875
            H P+      A L  +F +   +L GY++G  S A + ++E   + S           ++
Sbjct: 34   HVPENYSVVAAILPFLFPALGGLLYGYEIGATSCATISLQEPMTLLSYYAVPFSAVAFIK 93

Query: 876  HEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRV 1055
                              +   +D+IGRR  ++LAA  +++GAL+  LAPTY  L+ GRV
Sbjct: 94   WNFMTSGSLYGALFGSIVAFTIADVIGRRKELILAALLYLVGALVTALAPTYSVLIIGRV 153

Query: 1056 VAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANI-- 1229
            + G+ VG ++  AP+Y +E +P+  RG L SL E F    I++G V    +  L  N+  
Sbjct: 154  IYGVSVGLAMHAAPMYIAETAPSPIRGQLVSLKEFF----IVLGMVGGYGIGSLTVNVHS 209

Query: 1230 SWRLMLGLS 1256
             WR M   S
Sbjct: 210  GWRYMYATS 218



>pir|S69671|S69671 hypothetical protein YDR387c - yeast (Saccharomyces
            cerevisiae)>gb:SCD9509_1707567 Saccharomyces cerevisiae
            chromosome IV cosmids 9481, 9509, 9926, 9461, and lambda
            3641.
          Length = 555

 Score = 90.5 bits (223), Expect = 6e-17
 Identities = 54/168 (32%), Positives = 86/168 (51%), Gaps = 4/168 (2%)
 Frame = +3

Query: 765  LCAVFASTNSILLGYDLGVMSGAVLFIK----ETFKISSVQHEXXXXXXXXXXXXXXXAS 932
            L  V A+   +L GYD GV+SG +L +K        ++ VQ E                +
Sbjct: 41   LIFVGATIGGLLFGYDTGVISGVLLSLKPEDLSLVVLTDVQKELITSSTSVGSFFGSILA 100

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
               +D  GRR T+ +  + FI+ A+ M +A T  +L+ GR++ GI VG S    P++ SE
Sbjct: 101  FPLADRYGRRITLAICCSIFILAAIGMAIARTLTFLICGRLLVGIAVGVSAQCVPLFLSE 160

Query: 1113 LSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            +SP+  RGF+ +L  + I  G L+ +V   L+  +  + SWR +  LS
Sbjct: 161  ISPSRIRGFMLTLNIIAITGGQLVSYVIASLMKEI--DNSWRYLFALS 206



>gb:AF215855_1777956 Arabidopsis thaliana hexose transporter (pGlcT)
            gene, partial cds; nuclear gene for chloroplast product.
          Length = 515

 Score = 90.1 bits (222), Expect = 8e-17
 Identities = 54/161 (33%), Positives = 83/161 (51%), Gaps = 2/161 (1%)
 Frame = +3

Query: 780  ASTNSILLGYDLGVMSGAVLFIKETFKIS--SVQHEXXXXXXXXXXXXXXXASGKTSDMI 953
            A   +IL GY LGV++GA+ ++ +   I+  +V                    G  +D  
Sbjct: 78   ACLGAILFGYHLGVVNGALEYLAKDLGIAENTVLQGWIVSSLLAGATVGSFTGGALADKF 137

Query: 954  GRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTR 1133
            GR  T  L A    IGA L   A +   ++ GR++AGIG+G S  I P+Y SE+SP   R
Sbjct: 138  GRTRTFQLDAIPLAIGAFLCATAQSVQTMIVGRLLAGIGIGISSAIVPLYISEISPTEIR 197

Query: 1134 GFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            G L S+ ++FI +GIL   ++ + L+  P  + WR M G++
Sbjct: 198  GALGSVNQLFICIGILAALIAGLPLAANP--LWWRTMFGVA 236



>gb:AY058152_1564290 Arabidopsis thaliana AT5g16150/T21H19_70 mRNA,
            complete cds.>gb:AY091052_1574280 Arabidopsis thaliana
            putative sugar transporter (At5g16150) mRNA, complete
            cds.>gb:AY117359_1579400 Arabidopsis thaliana putative
            sugar transporter (At5g16150) mRNA, complete cds.
          Length = 546

 Score = 90.1 bits (222), Expect = 8e-17
 Identities = 54/161 (33%), Positives = 83/161 (51%), Gaps = 2/161 (1%)
 Frame = +3

Query: 780  ASTNSILLGYDLGVMSGAVLFIKETFKIS--SVQHEXXXXXXXXXXXXXXXASGKTSDMI 953
            A   +IL GY LGV++GA+ ++ +   I+  +V                    G  +D  
Sbjct: 112  ACLGAILFGYHLGVVNGALEYLAKDLGIAENTVLQGWIVSSLLAGATVGSFTGGALADKF 171

Query: 954  GRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTR 1133
            GR  T  L A    IGA L   A +   ++ GR++AGIG+G S  I P+Y SE+SP   R
Sbjct: 172  GRTRTFQLDAIPLAIGAFLCATAQSVQTMIVGRLLAGIGIGISSAIVPLYISEISPTEIR 231

Query: 1134 GFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            G L S+ ++FI +GIL   ++ + L+  P  + WR M G++
Sbjct: 232  GALGSVNQLFICIGILAALIAGLPLAANP--LWWRTMFGVA 270



>pir|T27077|T27077 hypothetical protein Y51A2D.5 - Caenorhabditis
            elegans>gb:CEY51A2D_1370384 Caenorhabditis elegans YAC
            Y51A2D, complete sequence.
          Length = 613

 Score = 90.1 bits (222), Expect = 8e-17
 Identities = 57/185 (30%), Positives = 86/185 (46%), Gaps = 5/185 (2%)
 Frame = +3

Query: 720  GSPHPPKR-RLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKET---FKISSVQHEXX 887
            G P P K  +L  F +L    A     L GYD  V+S A+L++ E      + +V  E  
Sbjct: 12   GRPRPEKNPKLGFFVYLLGSAAIIGGFLFGYDTSVVSAAMLYVPEAPGLKPMGTVWKEVI 71

Query: 888  XXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGI 1067
                          SG  SD  GR+  I+ +   F+ GA++  +A T   +L GR+  G+
Sbjct: 72   VSITPGMAAVGAWFSGAGSDRYGRKPIIIGSTLIFVCGAVICAVAWTKIVMLIGRIFLGV 131

Query: 1068 GVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVG-ILIGFVSNILLSGLPANISWRLM 1244
            G+G++ M+ PVY  E SP   RG L S   + I+ G ++   +  +     P  I WRLM
Sbjct: 132  GIGFASMVVPVYLGEASPTHVRGTLVSAFAMMISFGQVVANIMGGVFSYWEPYTIGWRLM 191

Query: 1245 LGLSG 1259
               +G
Sbjct: 192  FAFAG 196



>gb:AP003943_1835566 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OJ1119_B04.
          Length = 515

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 57/208 (27%), Positives = 95/208 (45%), Gaps = 19/208 (9%)
 Frame = +3

Query: 693  VESRPGGAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVL---FIKETF-- 857
            VE++  G  G     K ++  + +LC + A+T+ ++ GYD+G+  G      F+ + F  
Sbjct: 7    VEAKVAGG-GERREFKGKITWYVWLCGIIAATSGLMFGYDVGISGGVTAMDGFLIKFFPS 65

Query: 858  --------------KISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFI 995
                          K    + +               A+ +    +GRR T+ LA+  F+
Sbjct: 66   VYARKHRARENNYCKFDDQRLQLFTSSLYLAALAASFAASRLCTRLGRRRTMQLASVFFL 125

Query: 996  IGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVG 1175
             G  L   A     L+ GR+  G+GVG+    AP++ SE++PA  RG L+ L ++ + +G
Sbjct: 126  GGTALCAGAANLAMLIVGRICLGVGVGFGNQAAPLFLSEIAPAHIRGALNILFQLDVTIG 185

Query: 1176 ILIGFVSNILLSGLPANISWRLMLGLSG 1259
            ILI  V N   S    +  WR  LG +G
Sbjct: 186  ILIANVVNYFTSSAHPSTGWRYSLGGAG 213



>gb:AF286906_1783215 Mesembryanthemum crystallinum putative glucose
            translocator mRNA, complete cds; nuclear gene for
            chloroplast product.
          Length = 555

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 54/161 (33%), Positives = 82/161 (50%), Gaps = 2/161 (1%)
 Frame = +3

Query: 780  ASTNSILLGYDLGVMSGAVLFIKETFKIS--SVQHEXXXXXXXXXXXXXXXASGKTSDMI 953
            A   +IL GY LGV++GA+ ++     I+  +V                    G  +D  
Sbjct: 121  ACLGAILFGYHLGVVNGALEYLSPDLGIAGNTVLQGWVVSILLAGATVGSFTGGSLADKF 180

Query: 954  GRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTR 1133
            GR  T  L A    IGA L   A +   ++ GR++ GIG+G S  + P+Y SE+SP   R
Sbjct: 181  GRTRTFQLDAIPLAIGAYLCATAQSVQTMMIGRLLCGIGIGISSALVPLYISEISPTEIR 240

Query: 1134 GFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            G L S+ ++FI +GIL   V+ + L+G P  + WR M G++
Sbjct: 241  GALGSVNQLFICIGILAALVAGLPLAGNP--LWWRTMFGIA 279



>gb:AX008644_1456285 Sequence 5 from Patent
            WO9966042.>gb:AF215851_1777952 Spinacia oleracea hexose
            transporter mRNA, complete cds; nuclear gene for
            chloroplast product.
          Length = 551

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 54/161 (33%), Positives = 81/161 (50%), Gaps = 2/161 (1%)
 Frame = +3

Query: 780  ASTNSILLGYDLGVMSGAVLFIKETFKIS--SVQHEXXXXXXXXXXXXXXXASGKTSDMI 953
            A   +IL GY LGV++GA+ ++     I+  +V                    G  +D  
Sbjct: 117  ACLGAILFGYHLGVVNGALDYLSADLAIAGNTVLQGWVVSILLAGATVGSFTGGSLADKF 176

Query: 954  GRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTR 1133
            GR  T  L A    IGA L   A     ++ GR++ GIG+G S  + P+Y SE+SP   R
Sbjct: 177  GRTKTFQLDAIPLAIGAYLCATAQNVQIMMIGRLLCGIGIGISSALVPLYISEISPTEIR 236

Query: 1134 GFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            G L S+ ++FI +GIL   V+ + L+G P  + WR M G++
Sbjct: 237  GALGSVNQLFICIGILAALVAGLPLAGNP--LWWRTMFGIA 275



>gb:BX294151_770701 Pirellula sp. strain 1 complete genome; segment
            19/24.
          Length = 484

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 56/189 (29%), Positives = 89/189 (47%)
 Frame = +3

Query: 687  TMVESRPGGAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKIS 866
            T VE R      S +  + +LN+  FL ++ +S    L G+D  V+SGA   I+  + + 
Sbjct: 20   TAVEQRASDEQRS-NIGQSKLNQRVFLWSLTSSLAGFLFGFDTVVISGAEKAIQGLWALG 78

Query: 867  SVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLA 1046
              QH                  G  +D  GR+ T++     +++ A+  G A      + 
Sbjct: 79   DFQHGLALSAALWGTVIGSLVGGWPTDKFGRKKTLLWIGILYLVSAIWSGFATDVFSFMI 138

Query: 1047 GRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPAN 1226
             R + G+GVG S + AP+Y SE+SP   RG L+ L +  I  GI++ F SN L+      
Sbjct: 139  ARFIGGLGVGISTVAAPLYISEISPPKHRGTLTGLFQFNIVFGIMVAFASNYLIGTWGNE 198

Query: 1227 ISWRLMLGL 1253
             +WR ML +
Sbjct: 199  NAWRWMLAV 207



>gb:AE012277_281006 Xanthomonas campestris pv. campestris str. ATCC
            33913, section 185 of 460 of the complete
            genome.>gb:AE008922_914288 Xanthomonas campestris pv.
            campestris str. ATCC 33913, complete genome.
          Length = 481

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 49/180 (27%), Positives = 92/180 (51%)
 Frame = +3

Query: 672  EPMEITMVESRPGGAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKE 851
            EPM    ++  P     +         +F  L +  A+    L G+D GV++G V  +K+
Sbjct: 5    EPMSSVSIDGAPDAGENT---------RFIILISCVATIGGFLFGFDSGVINGTVDGLKQ 55

Query: 852  TFKISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTY 1031
            TF+ S+ +                  +G+ +D  GRR  ++++AA F++ A+  G + + 
Sbjct: 56   TFQSSAAETGFEVASMLLGCAIGAFFAGRLADRWGRRAVLIISAALFLLSAIGAGASHSS 115

Query: 1032 GYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLS 1211
            G+ +  RV+ G  VG + +I+P Y +E++ A  RG L+++ ++ I  G+   F+SN LL+
Sbjct: 116  GFFIFARVMGGFAVGAASVISPAYIAEVASARYRGRLATMQQIAIISGLFCAFLSNYLLA 175



>pir|H97064|H97064 probable sugar-proton symporter [imported] -
            Clostridium acetobutylicum>gb:AE007645_228668 Clostridium
            acetobutylicum ATCC 824 section 133 of 356 of the
            complete genome.>gb:AE001437_1091623 Clostridium
            acetobutylicum ATCC 824, complete genome.
          Length = 469

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 52/165 (31%), Positives = 85/165 (51%)
 Frame = +3

Query: 756  FAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASG 935
            F  L +  A    +L GYD  V+SGA+ F+K+ + +S                     SG
Sbjct: 13   FIVLISCAAGLGGLLYGYDTAVISGAIGFLKKLYNLSPAMQGFVISSIMVGGVLGVGFSG 72

Query: 936  KTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSEL 1115
               D IGRR  ++LAAA F I A++  ++ +   L+  R+V G+G+G +  ++  Y +E 
Sbjct: 73   FLGDAIGRRKVLMLAAALFAISAVISSISTSAFMLIFARIVGGLGIGMASALSVTYITEC 132

Query: 1116 SPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLG 1250
            +P   RG LSSL ++F  +GI I F  N+ +  + +  +WR+  G
Sbjct: 133  APPSIRGRLSSLYQLFTILGISITFFVNLGIVNMGSE-TWRVSTG 176



>pir|F97065|F97065 D-xylose-proton symporter [imported] - Clostridium
            acetobutylicum>gb:AE007646_228674 Clostridium
            acetobutylicum ATCC 824 section 134 of 356 of the
            complete genome.>gb:AE001437_1091629 Clostridium
            acetobutylicum ATCC 824, complete genome.
          Length = 455

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 51/158 (32%), Positives = 79/158 (50%)
 Frame = +3

Query: 777  FASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTSDMIG 956
            F +    + GYD+G+++GA+  I  T+ +SS                        +D  G
Sbjct: 13   FGAFGGFMFGYDIGIINGALPGINATWHVSSWLEGFITSGLFVGAMIGASLMASLADRFG 72

Query: 957  RRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRG 1136
            RR  I+ +A  F +GAL   ++ +   L+  RV+ G+ VG +  + P+Y  E+SPA TRG
Sbjct: 73   RRRMIMWSAIVFALGALGSAVSTSTNLLIGARVILGVAVGGASALVPMYMGEISPAETRG 132

Query: 1137 FLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLG 1250
             LS L ++ I VG+L  +  N   +G  A   WR MLG
Sbjct: 133  KLSGLNQLMITVGMLFSYGVNFAFAG--AFEGWRWMLG 168



>gb:BC073721_2557540 Xenopus laevis MGC83667 protein, mRNA (cDNA clone
            MGC:83667 IMAGE:5085530), complete cds.
          Length = 553

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 53/165 (32%), Positives = 84/165 (50%), Gaps = 4/165 (2%)
 Frame = +3

Query: 774  VFASTNSIL----LGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKT 941
            V A+T+S+L     GY+LG++SGA+L +K  F+++  + E                 G  
Sbjct: 9    VLAATSSLLGGLIFGYELGIISGALLMLKTVFQLTCFEQEALVSAVLFGALLASLIGGFI 68

Query: 942  SDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSP 1121
             D  GRR +I+ +    + G++++    ++ +L+ GRV  G  +  S M   +Y SE+  
Sbjct: 69   IDRSGRRTSIMGSNLVVLAGSIILIATSSFWWLVVGRVTVGFAISISSMACCIYVSEIVR 128

Query: 1122 AMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
               RG L SL E  I VGILI +  N  LS +  N  W+ M GL+
Sbjct: 129  PHQRGTLVSLYETGITVGILISYAMNYFLSAV--NDGWKYMFGLA 171



>gb:AY822464_1628880 Oryza sativa (japonica cultivar-group)
            monosaccharide transporter 8 (MST8) mRNA, complete
            cds.>gb:AP003141_1824845 Oryza sativa (japonica
            cultivar-group) genomic DNA, chromosome 1, PAC
            clone:P0002B05.
          Length = 513

 Score = 89.0 bits (219), Expect = 2e-16
 Identities = 61/202 (30%), Positives = 95/202 (47%), Gaps = 20/202 (9%)
 Frame = +3

Query: 711  GAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAV------------LFIKET 854
            GAH + +P K  +  F FL  + AS+  ++ GYD+G+  G              ++ KE 
Sbjct: 11   GAHKN-YPGKMTI--FVFLACLVASSGGLIFGYDIGISGGVTSMDSFLIKFFPSVYAKEK 67

Query: 855  FKISSVQH-----EXXXXXXXXXXXXXXXASGKTSDM---IGRRYTIVLAAATFIIGALL 1010
              + + Q+     E               AS   S +    GRR T++     F++GA+L
Sbjct: 68   EMVETNQYCKFDSELLTLFTSSLYLAALIASLFASVITRKFGRRITMLGGGVIFLVGAIL 127

Query: 1011 MGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGF 1190
             G A     L+ GR++ GIGVG+S    P+Y SE++PA  RG L+   ++ I VGIL   
Sbjct: 128  NGAAADVAMLIIGRILLGIGVGFSNQAVPLYLSEMAPARMRGMLNISFQLMITVGILAAN 187

Query: 1191 VSNILLSGLPANISWRLMLGLS 1256
            + N     +     WR+ LGL+
Sbjct: 188  LINYFTDKIAGGWGWRVSLGLA 209



>gb:HVU534445_1682803 Hordeum vulgare mRNA for hexose transporter
            (stp1 gene).
          Length = 743

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 49/167 (29%), Positives = 88/167 (52%), Gaps = 2/167 (1%)
 Frame = +3

Query: 759  AFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISS--VQHEXXXXXXXXXXXXXXXAS 932
            A L A+ AS  ++L G+D   ++GAVL+IK+ F + +  +                   S
Sbjct: 5    AVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFSLETQPLIEGLIVAMSLIGATVITTFS 64

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
            G  +D +GRR  ++ ++  + +  L+M  AP    LL  R++ G G+G ++ + P+Y SE
Sbjct: 65   GAVADAVGRRPLLIASSVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLYISE 124

Query: 1113 LSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
             +P   RG L++LP+   + G+ + +     +S +P    WR+MLG+
Sbjct: 125  TAPTDIRGLLNTLPQFSGSGGMFLSYCMVFTMSLMP-QPDWRIMLGV 170



>gb:CR382132_1665942 Yarrowia lipolytica chromosome F of strain CLIB99
            of Yarrowia lipolytica.
          Length = 540

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 61/222 (27%), Positives = 100/222 (45%), Gaps = 4/222 (1%)
 Frame = +3

Query: 603  VDPNQDLDS*NMDSGIDSAKGR--TEPMEITMVESRPGGAHGSPHPPKRRLNKFAFLCAV 776
            +D N+ + +    SG  + +G      +  T  +    G+    +    +++ F F+   
Sbjct: 3    LDKNRQITTSESSSGSSADEGTHIMRGLTSTSTQDETTGSISEGNLEAEKISPFVFVLVA 62

Query: 777  FASTNSILLGYDLGVMSGAVLFIKETF--KISSVQHEXXXXXXXXXXXXXXXASGKTSDM 950
             AS +  L GYD G +SGA++ IKE     +S+   E                +G   D 
Sbjct: 63   LASISGFLFGYDTGYVSGALVVIKEDLGRALSNGDKELITASTSLGALLGGVIAGAMCDF 122

Query: 951  IGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMT 1130
             GR++ I  A   F++GA +   A     ++ GR V G GVG + + AP+Y SEL+P   
Sbjct: 123  FGRKWVITFANILFLVGAAIQCGAHAVWTMIGGRFVMGWGVGIASLCAPLYISELAPTRI 182

Query: 1131 RGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            RG L  L  + I  G L+ +   I       +  WR+++GLS
Sbjct: 183  RGRLVVLNVLAITGGQLVAY--GIGAGMAHVHQGWRILVGLS 222



>gb:AE016959_1023657 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC073166_1540973 Oryza sativa
            chromosome 10 BAC OSJNBb0064P21 genomic sequence,
            complete sequence.>gb:AE017116_1753476 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 70 of 77
            of the complete sequence.
          Length = 740

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 51/167 (30%), Positives = 87/167 (52%), Gaps = 2/167 (1%)
 Frame = +3

Query: 759  AFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISS--VQHEXXXXXXXXXXXXXXXAS 932
            A L A+ AS  ++L G+D   ++GAVL+IK+ F + S  +                   S
Sbjct: 4    AVLVAIAASIGNLLQGWDNATIAGAVLYIKKEFNLQSEPLIEGLIVAMSLIGATIITTFS 63

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
            G  +D  GRR  ++ +A  + +  L+M  AP    LL  R++ G G+G ++ + P+Y SE
Sbjct: 64   GAVADSFGRRPMLIASAVLYFVSGLVMLWAPNVYVLLLARLIDGFGIGLAVTLVPLYISE 123

Query: 1113 LSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
             +P   RG L++LP+   + G+ + +     +S +P    WR+MLG+
Sbjct: 124  TAPTDIRGLLNTLPQFSGSGGMFLSYCMVFGMSLMP-QPDWRIMLGV 169



>gb:AE013598_296610 Xanthomonas oryzae pv. oryzae KACC10331, complete
            genome.
          Length = 501

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 48/180 (26%), Positives = 92/180 (51%)
 Frame = +3

Query: 672  EPMEITMVESRPGGAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKE 851
            EPM    ++  P     +         +F  L +  A+    L G+D GV++G V  +K+
Sbjct: 25   EPMSSASIDGAPDAGENT---------RFIILISCVATIGGFLFGFDSGVINGTVDGLKQ 75

Query: 852  TFKISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTY 1031
            TF+ ++ +                  +G+ +D  GRR  ++++AA F++ A+  G + + 
Sbjct: 76   TFQSTAAETGFEVASMLLGCAIGAFFAGRLADRSGRRAVLIISAALFLLSAIGAGASHSS 135

Query: 1032 GYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLS 1211
            G+ +  RV+ G  VG + +I+P Y +E++ A  RG L+++ ++ I  G+   F+SN LL+
Sbjct: 136  GFFIFARVMGGFAVGAASVISPAYIAEVASARYRGRLATMQQIAIISGLFCAFLSNYLLA 195



>sp|O95528|GT10_HUMAN Solute carrier family 2, facilitated glucose
            transporter, member 10 (Glucose transporter type
            10).>gb:AF248053_1892895 Homo sapiens glucose transporter
            (GLUT10) mRNA, complete cds.>gb:AF321240_1896644 Homo
            sapiens facilitative glucose transporter GLUT10 (SLC2A10)
            mRNA, complete cds.>gb:HS28H20_1997907 Human DNA sequence
            from clone RP1-28H20 on chromosome 20q13.1 Contains the
            SLC2A10 gene encoding a solute carrier family 2
            (facilitated glucose transporter) member 10, the 5' end
            of the C20orf64 gene and three CpG islands, complete
            sequence.>gb:HS28H201_1997908 Novel human gene mapping to
            chromosome 20, similar to membrane transporters.
          Length = 541

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 54/162 (33%), Positives = 78/162 (48%)
 Frame = +3

Query: 765  LCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTS 944
            LCA  +    +  GY+L V+SGA+L ++  F +S ++ E                 G   
Sbjct: 10   LCASVSLLGGLTFGYELAVISGALLPLQLDFGLSCLEQEFLVGSLLLGALLASLVGGFLI 69

Query: 945  DMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPA 1124
            D  GR+  I+ +    + G+L +GLA +  +L+ GR V G  +  S M   +Y SEL   
Sbjct: 70   DCYGRKQAILGSNLVLLAGSLTLGLAGSLAWLVLGRAVVGFAISLSSMACCIYVSELVGP 129

Query: 1125 MTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLG 1250
              RG L SL E  I VGIL+ +  N  L+G P    WR M G
Sbjct: 130  RQRGVLVSLYEAGITVGILLSYALNYALAGTP--WGWRHMFG 169



>gb:NCB8B8_1690269 Neurospora crassa DNA linkage group II BAC clone
            B8B8.
          Length = 816

 Score = 88.2 bits (217), Expect = 3e-16
 Identities = 56/169 (33%), Positives = 83/169 (49%), Gaps = 7/169 (4%)
 Frame = +3

Query: 762  FLCAVFASTNSILLGYDLGVMSGAVL--FIKETF-KISSVQHEXXXXXXXXXXXXXXXAS 932
            +  ++F S    L GYD GVMSG +   + K+ F + +S Q                   
Sbjct: 251  YFTSIFVSLGVFLFGYDQGVMSGIITGPYFKDYFNQPTSAQIGTMVAILEIGALISSLLV 310

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
            G+  D+IGRR TI+  +  F +G  L  +A     ++ GR++AG+GVG    I PVY SE
Sbjct: 311  GRIGDIIGRRKTILYGSCIFFVGGALQTMATDMAMMMTGRIIAGLGVGMLSTIVPVYQSE 370

Query: 1113 LSPAMTRGFLSSLPEVFINVGILIGFVSNI----LLSGLPANISWRLML 1247
            +SP   RG L+ +       G +IG+ +++        L  NISWRL L
Sbjct: 371  ISPPHNRGKLACIE----FSGNIIGYTTSVWVDYFCGFLEGNISWRLPL 415



>gb:AE008692_240031 Zymomonas mobilis subsp. mobilis ZM4, complete
            genome.
          Length = 480

 Score = 87.8 bits (216), Expect = 4e-16
 Identities = 52/153 (33%), Positives = 78/153 (50%)
 Frame = +3

Query: 798  LLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVL 977
            L GYD G++SGA++ I   FK+ + Q E                 G+ S  +GRR+ I++
Sbjct: 42   LYGYDTGIISGALMNIAHDFKLDAHQQEIITSILLFGAVIGSLVCGRLSAFVGRRHMIMI 101

Query: 978  AAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPE 1157
              A F    +  G APT  +L A R+V G  VG S  I PVY +EL+PA  RG + +   
Sbjct: 102  VTAIFGFSVIAAGYAPTAFWLGAARLVLGFAVGGSSQIVPVYIAELAPADQRGRMVTFYN 161

Query: 1158 VFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            + I +GIL    + I+ + L    +WR M  ++
Sbjct: 162  ISIGLGIL---AAGIVGAFLQEEWTWRTMFSVA 191



>gb:CR382132_1665226 Yarrowia lipolytica chromosome F of strain CLIB99
            of Yarrowia lipolytica.
          Length = 532

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 59/171 (34%), Positives = 84/171 (49%), Gaps = 7/171 (4%)
 Frame = +3

Query: 762  FLCAVFASTNSILLGYDLGVMSGAV--LFIKETF-KISSVQHEXXXXXXXXXXXXXXXAS 932
            +  +VF S    L GYD GVMSG +   + KE F + +  +                   
Sbjct: 11   YFTSVFVSLGVFLFGYDQGVMSGIITGFYFKEYFHEPTRAEIGTMVSILEVGAFVSSLMV 70

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
            G+  D+IGRR TI+  A  FIIG      A +   ++ GRVVAG GVG    I PVY SE
Sbjct: 71   GRIGDIIGRRKTIMYGAFIFIIGGAFQTFAVSMSEMILGRVVAGFGVGMLSTIVPVYQSE 130

Query: 1113 LSPAMTRGFLSSLPEVFINVGILIGFVSNI----LLSGLPANISWRLMLGL 1253
            +SP   RG L+ +       G ++G+ S++      S + +N+SWR+ L L
Sbjct: 131  ISPPHNRGKLACIE----FTGNIVGYASSVWVDYFCSFINSNMSWRIPLFL 177



>gb:AB007648_1510203 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MKD15.>gb:ATH344339_1552516 Arabidopsis thaliana
            mRNA for STP11 protein.>gb:AK175890_1817878 Arabidopsis
            thaliana mRNA for monosaccharide transporter, complete
            cds, clone: RAFL22-53-G07.
          Length = 514

 Score = 87.4 bits (215), Expect = 6e-16
 Identities = 58/202 (28%), Positives = 94/202 (46%), Gaps = 21/202 (10%)
 Frame = +3

Query: 717  HGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVL---FIKETF---------- 857
            HG  +  + R+  F  +  + A+   +L GYD+G+  G +    F+ + F          
Sbjct: 12   HGGDY--EGRVTAFVMITCIVAAMGGLLFGYDIGISGGVISMEDFLTKFFPDVLRQMQNK 69

Query: 858  -----KISSVQHEXXXXXXXXXXXXXXXASGKTSD---MIGRRYTIVLAAATFIIGALLM 1013
                 +     +E               AS   S    + GR+ ++V+ +  F+ GALL 
Sbjct: 70   RGRETEYCKYDNELLTLFTSSLYLAALFASFLASTITRLFGRKVSMVIGSLAFLSGALLN 129

Query: 1014 GLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFV 1193
            GLA     L+ GR+  G+GVG++    P+Y SE++PA  RG L+   ++ I +GIL   +
Sbjct: 130  GLAINLEMLIIGRLFLGVGVGFANQSVPLYLSEMAPAKIRGALNIGFQLAITIGILAANI 189

Query: 1194 SNILLSGLPANISWRLMLGLSG 1259
             N +   L   I WRL LGL+G
Sbjct: 190  VNYVTPKLQNGIGWRLSLGLAG 211



>gb:AF438553_1799915 Lycopersicon esculentum putative Na+/myo-inositol
            symporter mRNA, partial cds.
          Length = 248

 Score = 87.0 bits (214), Expect = 7e-16
 Identities = 52/150 (34%), Positives = 80/150 (53%), Gaps = 3/150 (2%)
 Frame = +3

Query: 816  GVMSGAVLFIKETFKISSVQ---HEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAA 986
            GV+SGA+L+I++ FK    +    E                 G  +D  GRR +I+LA  
Sbjct: 2    GVISGALLYIRDDFKSVGKRTWLQETIVSMAVAGAIFGAAFGGWFNDKYGRRKSILLADI 61

Query: 987  TFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFI 1166
             F IGA++M +AP    ++ GRV+ G+GVG + M +P+Y SE SPA  RG L S   + I
Sbjct: 62   LFFIGAIVMAVAPAPWVIIIGRVLVGLGVGMASMTSPLYISEASPARIRGALVSTNGLLI 121

Query: 1167 NVGILIGFVSNILLSGLPANISWRLMLGLS 1256
              G  + ++ N+  +      +WR MLG++
Sbjct: 122  TGGQFLSYLINLAFTRTKG--TWRWMLGVA 149



>gb:AC093018_1735832 Oryza sativa chromosome 3 BAC OSJNBb0081B07
            genomic sequence, complete sequence.
          Length = 525

 Score = 87.0 bits (214), Expect = 7e-16
 Identities = 50/134 (37%), Positives = 75/134 (55%), Gaps = 2/134 (1%)
 Frame = +3

Query: 855  FKISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYG 1034
            F +SS+Q                  + + +D +GRR  +V AAA +I GAL+ G AP + 
Sbjct: 104  FSLSSIQLGLVASGSLYGALGGSLLAYRVADFLGRRIELVTAAALYISGALVTGFAPDFV 163

Query: 1035 YLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSG 1214
             L+ GR++ GIG+G ++  AP+Y +E SP+  RG L SL E+FI +GIL G+    L+  
Sbjct: 164  LLIIGRLLYGIGIGLAMHGAPLYIAETSPSRIRGTLISLKELFIVLGILTGY----LVGS 219

Query: 1215 LPANI--SWRLMLG 1250
            L  ++   WR M G
Sbjct: 220  LEIDVVGGWRYMFG 233



>gb:AY683004_1622139 Zea mays monosaccharide transport protein 1
            (MST1) mRNA, complete cds.
          Length = 523

 Score = 87.0 bits (214), Expect = 7e-16
 Identities = 52/198 (26%), Positives = 92/198 (46%), Gaps = 19/198 (9%)
 Frame = +3

Query: 720  GSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVL---FIKETF----------- 857
            G  +P K  L  F  L  + A+T  ++ GYD+G+  G      F+++ F           
Sbjct: 12   GKDYPGK--LTLFVLLTCIVAATGGLIFGYDIGISGGVTSMNPFLEKFFPEVYRKKQEAK 69

Query: 858  -----KISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLA 1022
                 K  +   +                +   +  +GR++++++   TF++GA L G A
Sbjct: 70   TNQYCKYDNQLLQTFTSSLYLAALVASFFAATVTRAVGRKWSMLVGGLTFLVGAALNGAA 129

Query: 1023 PTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNI 1202
                 L+ GR++ G+GVG++    PVY SE++PA  RG L+   ++ I +GIL   + N 
Sbjct: 130  QNIAMLIIGRILLGVGVGFANQSVPVYLSEMAPARLRGMLNIGFQLMITIGILAAELINY 189

Query: 1203 LLSGLPANISWRLMLGLS 1256
              + + A   WR+ L L+
Sbjct: 190  GTNKIKAGYGWRVSLALA 207



>gb:AB052885_1521256 Oryza sativa OsMST3 mRNA for monosaccharide
            transporter 3, complete cds.>gb:AP004673_1843135 Oryza
            sativa (japonica cultivar-group) genomic DNA, chromosome
            7, PAC clone:P0617C02.>gb:AP006186_1861452 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 7, BAC
            clone:B1317D11.
          Length = 518

 Score = 87.0 bits (214), Expect = 7e-16
 Identities = 54/199 (27%), Positives = 91/199 (45%), Gaps = 20/199 (10%)
 Frame = +3

Query: 720  GSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVL---FIKETF----------- 857
            G  +P K  L  F F   V A+T  ++ GYD+G+  G      F+++ F           
Sbjct: 12   GKDYPGK--LTLFVFFTCVVAATGGLIFGYDIGISGGVTSMDPFLRKFFPEVYRKKQMAD 69

Query: 858  ------KISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGL 1019
                  K  +   +                +   + ++GR++++     TF+IGA L G 
Sbjct: 70   KNNQYCKYDNQLLQTFTSSLYLAALVSSFFAATVTRVLGRKWSMFAGGLTFLIGAALNGA 129

Query: 1020 APTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSN 1199
            A     L+ GR++ G+GVG++    PVY SE++PA  RG L+   ++ I +GIL   + N
Sbjct: 130  AENVAMLIVGRILLGVGVGFANQSVPVYLSEMAPARLRGMLNIGFQLMITIGILAAELIN 189

Query: 1200 ILLSGLPANISWRLMLGLS 1256
               + + A   WR+ L L+
Sbjct: 190  YGTAKIKAGWGWRVSLALA 208



>gb:AP006841_575043 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 457

 Score = 86.7 bits (213), Expect = 9e-16
 Identities = 54/169 (31%), Positives = 84/169 (49%)
 Frame = +3

Query: 744  RLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXX 923
            R NK  FL         +++G ++  +SGAV F++E F +  +                 
Sbjct: 3    RENKPLFLYTFITVFGGLIVGLNMAGISGAVPFLQEQFMLDDMALGLVVSILTVGCLCGA 62

Query: 924  XASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVY 1103
               G  SD  GR+  +  +A  FI+ +L   L+     LL  R++ G+G+G    +AP+Y
Sbjct: 63   LLGGGFSDRYGRQKVMFSSAVFFIVSSLGCALSGNLVSLLVFRLICGLGIGVISAVAPIY 122

Query: 1104 TSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLG 1250
             SE+SPA  RG L S  ++ I +GILI ++ + +L     N  WRLMLG
Sbjct: 123  ISEISPARLRGTLVSYNQLAIVIGILIAYIVDYILLDYERN--WRLMLG 169



>pir|C87350|C87350 major facilitator family transporter CC0814
            [imported] - Caulobacter crescentus>gb:AE005758_74829
            Caulobacter crescentus CB15 section 84 of 359 of the
            complete genome.>gb:AE005673_921861 Caulobacter
            crescentus CB15 complete genome.
          Length = 519

 Score = 86.7 bits (213), Expect = 9e-16
 Identities = 57/202 (28%), Positives = 97/202 (48%), Gaps = 2/202 (0%)
 Frame = +3

Query: 654  SAKGRTEPMEITMVES--RPGGAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMS 827
            ++ GR  PM  T V S    G + G      +    F       A+    + GYD GV++
Sbjct: 29   ASTGRYGPMGRTPVASVSNAGPSAGMSADGGKVNMTFVAAIVAVATIGGFMFGYDSGVIN 88

Query: 828  GAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGAL 1007
            G    ++  F +S +                  A+G+ +D+ GRR  ++++A  F+I A+
Sbjct: 89   GTQEGLESAFNLSKLGTGLNVGAILIGCAIGAFAAGRLADVWGRRTVMIISALLFVISAI 148

Query: 1008 LMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIG 1187
              G A +    +  R++ G+GVG + ++ PVY SE++PA  RG LSS+ ++ I  G+   
Sbjct: 149  GTGAAESSIVFIIFRLIGGLGVGAASVLCPVYISEVTPANIRGRLSSVQQIMIITGLTGA 208

Query: 1188 FVSNILLSGLPANISWRLMLGL 1253
            FV+N  L+    + +    LGL
Sbjct: 209  FVANYALAHTAGSSTAEFWLGL 230



>gb:BC056306_2551747 Danio rerio zgc:66027, mRNA (cDNA clone MGC:66027
            IMAGE:6794207), complete cds.
          Length = 610

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 56/207 (27%), Positives = 102/207 (49%), Gaps = 2/207 (0%)
 Frame = +3

Query: 636  MDSGIDSAKGRTEPMEITMVESRPGGAHGSPHPPKRRLNKFAF-LCAV-FASTNSILLGY 809
            MD+  +S +  ++P     V++     H    P  +  N  A  LC+V  A  + +L+GY
Sbjct: 1    MDAPEESIRMTSDPQSKIYVQNPDTHIHLEQSPSAKSGNGRALVLCSVSVACLSGLLMGY 60

Query: 810  DLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAAT 989
            ++ ++SGA+L +++   +S  + E                 G   D  GRR+TI+L A  
Sbjct: 61   EMSLISGALLQLRDVLTLSCPEQEQVVGSLLLGAFLLSLGGGTILDHYGRRFTIILTALL 120

Query: 990  FIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFIN 1169
             ++G LL     ++  L+ GR++ G+ V  S   + +Y +E++PA  RG    + E+ + 
Sbjct: 121  CVLGTLLSVCVVSFWALVVGRMLVGMSVALSGTASCLYAAEVAPAAWRGRCVCVYELMVV 180

Query: 1170 VGILIGFVSNILLSGLPANISWRLMLG 1250
            +G+L+GF  +   +G+P    WR   G
Sbjct: 181  LGMLLGFGLSWAFAGVPD--GWRFTFG 205



>gb:AF159589_484340 Lactobacillus casei ptsHI operon, complete
            sequence; and putative sugar permease gene, complete cds.
          Length = 470

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 48/166 (28%), Positives = 81/166 (48%), Gaps = 2/166 (1%)
 Frame = +3

Query: 765  LCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTS 944
            L A+ ++   +L GYD GV++GA+ FI    K++                      G+ S
Sbjct: 24   LVALISTMGGLLFGYDTGVINGALPFISSELKLAPGSQGWVTSSLTLGAAFGAILVGRLS 83

Query: 945  DMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPA 1124
            D  GRR  I + A  F +  +   L+P+ G+L+  R++ G+ VG   ++ P + +E++P 
Sbjct: 84   DRYGRRRLITMLAGLFFLATVASSLSPSAGWLIGARLILGLAVGGVSVLVPSFLAEIAPT 143

Query: 1125 MTRGFLSSLPEVFINVGILIGFVSNILLSGLPANIS--WRLMLGLS 1256
              RG L +  E+ +  G L+ FV N  L     N+   WR M+ L+
Sbjct: 144  SHRGRLVTQNELMVVTGQLLAFVLNAFLGTTFGNVPGIWRWMIVLA 189



>gb:AE017283_430772 Propionibacterium acnes KPA171202, complete
            genome.
          Length = 481

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 58/188 (30%), Positives = 99/188 (52%)
 Frame = +3

Query: 693  VESRPGGAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSV 872
            VE +PG + GS    +      A   AV A+   I  GYD+   + A+ F++  F I S 
Sbjct: 9    VEMKPGDS-GSAGATRNSQTSRAVFIAVTAAALGITYGYDISNTAAALQFVQRDFGIYSA 67

Query: 873  QHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGR 1052
             +                  G  ++ IGR+ ++++ AA + I A+L  ++P+ G  LA R
Sbjct: 68   IN----TASVVGQIAGAILGGPMANAIGRKKSMLVIAAGYTIFAILTAISPSAGLFLAMR 123

Query: 1053 VVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANIS 1232
            V+ GI +G S+ + PV+ +E +PA  RG L++  +V   VGI++G++    L  LP + +
Sbjct: 124  VLLGITIGLSITVVPVFIAESAPASRRGGLATAYQVTCVVGIILGYLVGYSL--LPTD-T 180

Query: 1233 WRLMLGLS 1256
            WR +LG++
Sbjct: 181  WRWILGVA 188



>gb:SYGLCP_195529 Synechocystis PCC 6803 glcP gene and ORF2.
          Length = 468

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 55/164 (33%), Positives = 83/164 (50%), Gaps = 3/164 (1%)
 Frame = +3

Query: 753  KFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXAS 932
            KF  L +  A+    L G+D  V++GAV  +++ F+  S+                   +
Sbjct: 15   KFVLLISGVAALGGFLFGFDTAVINGAVAALQKHFQTDSLLTGLSVSLALLGSALGAFGA 74

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
            G  +D  GR  T++LAA  F + ++  GL  T    +  RV+ GIGVG + +IAP Y +E
Sbjct: 75   GPIADRHGRIKTMILAAVLFTLSSIGSGLPFTIWDFIFWRVLGGIGVGAASVIAPAYIAE 134

Query: 1113 LSPAMTRGFLSSLPEVFINVGILIGFVSN---ILLSGLPANISW 1235
            +SPA  RG L SL ++ I  GI I  +SN    L++G  A   W
Sbjct: 135  VSPAHLRGRLGSLQQLAIVSGIFIALLSNWFIALMAGGSAQNPW 178



>sp|P15729|GLCP_SYNY3 Glucose transport protein.>pir|S10014|S10014
            glucose transport protein - Synechocystis sp. (strain PCC
            6803)>gb:SPGTR_188194 Synechocystis gtr gene for glucose
            transporter.>gb:BA000022_689506 Synechocystis sp. PCC
            6803 DNA, complete genome.
          Length = 468

 Score = 85.9 bits (211), Expect = 2e-15
 Identities = 55/164 (33%), Positives = 83/164 (50%), Gaps = 3/164 (1%)
 Frame = +3

Query: 753  KFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXAS 932
            KF  L +  A+    L G+D  V++GAV  +++ F+  S+                   +
Sbjct: 15   KFVLLISGVAALGGFLFGFDTAVINGAVAALQKHFQTDSLLTGLSVSLALLGSALGAFGA 74

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
            G  +D  GR  T++LAA  F + ++  GL  T    +  RV+ GIGVG + +IAP Y +E
Sbjct: 75   GPIADRHGRIKTMILAAVLFTLSSIGSGLPFTIWDFIFWRVLGGIGVGAASVIAPAYIAE 134

Query: 1113 LSPAMTRGFLSSLPEVFINVGILIGFVSN---ILLSGLPANISW 1235
            +SPA  RG L SL ++ I  GI I  +SN    L++G  A   W
Sbjct: 135  VSPAHLRGRLGSLQQLAIVSGIFIALLSNWFIALMAGGSAQNPW 178



>gb:AE014295_312289 Bifidobacterium longum NCC2705, complete genome.
          Length = 517

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 47/160 (29%), Positives = 81/160 (50%), Gaps = 2/160 (1%)
 Frame = +3

Query: 777  FASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTSDMIG 956
            F +   +L G+D G++SGA   I+  F +S  Q                 + G  SD  G
Sbjct: 77   FGALGGMLFGFDTGIISGASPLIESDFGLSVSQTGFITSSVLIGSCAGALSIGALSDRFG 136

Query: 957  RRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRG 1136
            R+  ++++A  F++G+ L   +  +  ++  R++ G+ VG +  + P Y +EL+P   RG
Sbjct: 137  RKKLLIVSALLFLLGSGLCASSTGFAMMVCARIILGLAVGAASALTPAYLAELAPKERRG 196

Query: 1137 FLSSLPEVFINVGILIGFVSNI--LLSGLPANISWRLMLG 1250
             LS+L ++ +  GIL+ + SN+  L   L     WR MLG
Sbjct: 197  SLSTLFQLMVTFGILLAYASNLGFLNHNLFGIRDWRWMLG 236



>gb:AF492010_1804887 Olea europaea monosaccharide transporter (MST)
            gene, partial cds.
          Length = 205

 Score = 85.1 bits (209), Expect = 3e-15
 Identities = 42/110 (38%), Positives = 70/110 (63%)
 Frame = +3

Query: 930  SGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTS 1109
            + K  +++GR+ TI LA+  FI+GA+  G+AP    L+ GR++ G GVG+     P++ S
Sbjct: 56   ASKACNVLGRKPTIGLASILFILGAIASGIAPNKALLIIGRILFGFGVGFGNESVPLFLS 115

Query: 1110 ELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLSG 1259
            E++P   RG ++ L ++F+ +GILI  + N  +S +  N  WR+ LGL+G
Sbjct: 116  EVAPMQHRGAVNILFQLFVTIGILIANLVNYAVSSIHPN-GWRIALGLAG 164



>gb:CP000009_862826 Gluconobacter oxydans 621H, complete genome.
          Length = 475

 Score = 84.7 bits (208), Expect = 4e-15
 Identities = 47/162 (29%), Positives = 87/162 (53%)
 Frame = +3

Query: 774  VFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTSDMI 953
            V A+   ++ G D+GV++GA+    + +  S+V  E               ++G  S  +
Sbjct: 34   VIAALAGLMSGLDIGVVAGALDLFGKEYHASTVALEWVVSSMMAGAAAGALSAGWMSKAL 93

Query: 954  GRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTR 1133
            GR++++++  A F+IG +   ++ +   +++ RVV GI VG S   AP+Y SE++    R
Sbjct: 94   GRKHSLIVGGAIFVIGTIGCAMSWSVASMISFRVVMGIAVGISAFTAPLYLSEIASEDAR 153

Query: 1134 GFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLSG 1259
            G + S  ++ + VGI I F+S+   S    + +WR M G++G
Sbjct: 154  GAMVSTYQLMVTVGIFIAFLSDTYFS---YSGNWRWMFGVAG 192



>gb:CR382129_1661679 Yarrowia lipolytica chromosome C of strain CLIB99
            of Yarrowia lipolytica.
          Length = 494

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 53/173 (30%), Positives = 83/173 (47%), Gaps = 8/173 (4%)
 Frame = +3

Query: 759  AFLCAVFASTNSILLGYDLGVMSGAVL--FIKETFK------ISSVQHEXXXXXXXXXXX 914
            A + AVF +   +L GYD G ++G +   ++KE F        +S Q             
Sbjct: 2    AIIVAVFVAFGGLLYGYDTGTIAGIMTMGYVKEHFTDFGKNDFTSGQSSLTTSILSVGTF 61

Query: 915  XXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIA 1094
                 +   +D  GRR  ++L    F +GA+L  +      L+ GRV+AG+GVG    I 
Sbjct: 62   TGAIVAPLAADTAGRRLGLLLYCLVFSVGAILQTVTTGRVLLIVGRVIAGLGVGGISSIV 121

Query: 1095 PVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            P+Y SE+SP   RG + S+ +  I VG+L+  + N      P   S+R+ LG+
Sbjct: 122  PLYQSEVSPKWIRGAVVSVYQFAITVGLLLAAIVNNATKDRPNTSSYRIPLGI 174



>gb:CR382125_1657291 Kluyveromyces lactis strain NRRL Y-1140
            chromosome E of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 572

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 50/169 (29%), Positives = 85/169 (50%), Gaps = 2/169 (1%)
 Frame = +3

Query: 756  FAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISS--VQHEXXXXXXXXXXXXXXXA 929
            +A LC   A+ N    G D   + GAVL  ++ F I++  +Q                  
Sbjct: 108  WAALCTSLAAVN---FGMDESAVGGAVLGYQKAFNITNPNIQGLTLAAPYLAAGVLTLPL 164

Query: 930  SGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTS 1109
            +   +   GRR+ ++++    + G+L+ G +   G +L  R+  GIG+G      P+YT+
Sbjct: 165  TVLLNKKFGRRFIVLISCFIGVSGSLIQGFSNGLGLILFARLYLGIGMGLCSSTVPIYTA 224

Query: 1110 ELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            E +PA++RG +  L + FI +G+ +G V N     +  N+SWRLM+G S
Sbjct: 225  ECAPAVSRGAILMLWQTFIALGVCLGSVFNRAFVEIEGNLSWRLMIGSS 273



>gb:CP000009_863951 Gluconobacter oxydans 621H, complete genome.
          Length = 470

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 51/176 (28%), Positives = 84/176 (47%)
 Frame = +3

Query: 726  PHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXX 905
            P   + R    A    + A+   ++ G D GV++GA+ FI   F                
Sbjct: 12   PSTQQPRSTARATTLGILAALAGLMFGLDTGVVAGALPFIATDFHAGDALQGWIVSSMMA 71

Query: 906  XXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSL 1085
                    +G+ S   GR   ++ AA  F++G LL  LAP    ++ GR+  G+ VG + 
Sbjct: 72   GATVGSLFAGRISVRFGRTGAMLGAAILFLLGTLLCALAPGPAIMIVGRLFLGLAVGVAA 131

Query: 1086 MIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
              AP+Y SE++    RG + S  ++ +++GI + FVS+ LL+   +   WR MLG+
Sbjct: 132  FAAPLYISEITVESVRGAMISFYQLMVSLGIFLAFVSDSLLA---SGGHWRWMLGV 184



>pir|T45780|T45780 sugar transporter-like protein - Arabidopsis
            thaliana>gb:ATF26O13_1550150 Arabidopsis thaliana DNA
            chromosome 3, BAC clone F26O13.>gb:ATH532571_1552865
            Arabidopsis thaliana mRNA for monosaccharide sensing
            protein 3 (mssp3 gene).
          Length = 729

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 50/167 (29%), Positives = 90/167 (53%), Gaps = 4/167 (2%)
 Frame = +3

Query: 765  LCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQ--HEXXXXXXXXXXXXXXXASGK 938
            L A+ A+  ++L G+D   ++GAV++IK+ F +                        SG 
Sbjct: 6    LVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAMSLIGATLITTFSGP 65

Query: 939  TSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELS 1118
             SD +GRR  ++L++  + + +++M  +P    LL  R++ G G+G ++ + P+Y SE +
Sbjct: 66   VSDKVGRRSMLILSSVLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIYISETA 125

Query: 1119 PAMTRGFLSSLPEVFINVGILIGFVSNILLSG--LPANISWRLMLGL 1253
            P+  RG L++ P+   + G+   F+S  L+ G  L  + SWRLMLG+
Sbjct: 126  PSEIRGLLNTFPQFCGSGGM---FLSYCLVFGMSLQESPSWRLMLGV 169



>gb:AE016818_1748107 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome V, complete sequence.
          Length = 547

 Score = 84.0 bits (206), Expect = 6e-15
 Identities = 55/169 (32%), Positives = 85/169 (50%), Gaps = 7/169 (4%)
 Frame = +3

Query: 762  FLCAVFASTNSILLGYDLGVMSGAVLF--IKETFKI-SSVQHEXXXXXXXXXXXXXXXAS 932
            +L AV A  + ++ G+D+  MS    F   K+ FK  + +                   S
Sbjct: 29   YLVAVVACISGMMFGFDISSMSSMQDFEPYKDYFKHPNELTQGGITASMAAGSLLGSILS 88

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
               SD  GRR ++ + ++ +IIGA+L   A     L  GR+VAG+GVG+   +APVYT+E
Sbjct: 89   PGISDAFGRRVSLHMCSSLWIIGAVLQTAAQNQAMLFVGRIVAGLGVGFGSSVAPVYTAE 148

Query: 1113 LSPAMTRGFLSSLPEVFINVGI----LIGFVSNILLSGLPANISWRLML 1247
            +SP   RG +  L ++ + VGI    LIG+ S  L S     ++W + L
Sbjct: 149  VSPPKIRGAVGGLFQLSVTVGILVMFLIGYGSVSLNSVASFRVAWSMQL 197



>gb:OSJN00261_1697581 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0076N16, complete sequence.
          Length = 506

 Score = 84.0 bits (206), Expect = 6e-15
 Identities = 52/172 (30%), Positives = 86/172 (50%), Gaps = 3/172 (1%)
 Frame = +3

Query: 750  NKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETF---KISSVQHEXXXXXXXXXXXXX 920
            N++       A     L GYD GV+SGA+L+I++ F   + +    E             
Sbjct: 28   NRYVLALTGAAGIGGFLFGYDTGVISGALLYIRDDFPAVRDNYFLQETIVSMALVGAIIG 87

Query: 921  XXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPV 1100
                G  +D  GRR + ++A   F +G+L+M  A     L+ GR++ G+GVG + + APV
Sbjct: 88   AAGGGWINDTYGRRKSTLVADMLFALGSLVMCAAGGPYILILGRLLVGLGVGIASVTAPV 147

Query: 1101 YTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            Y +E +P+  RG L S   + I  G    ++ N+  + +P   +WR MLG++
Sbjct: 148  YIAEAAPSEIRGGLVSTNVLMITGGQFFSYLINLGFTEVPG--TWRWMLGVA 197



>gb:NCB17B1_1689411 Neurospora crassa DNA linkage group II BAC clone
            B17B1.
          Length = 537

 Score = 84.0 bits (206), Expect = 6e-15
 Identities = 56/191 (29%), Positives = 89/191 (46%), Gaps = 5/191 (2%)
 Frame = +3

Query: 696  ESRPGGAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFK---IS 866
            +SR G  H SP         F +L    A  + +L GYD GV+S  ++ I  +     ++
Sbjct: 32   DSRGGKQHISPP------GLFIWLLTFSAGISGLLFGYDTGVISATLVSIGTSLSHRPLT 85

Query: 867  SVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLA 1046
            S+                   +   +D  GR+  ++ A   FIIGAL    + T   ++ 
Sbjct: 86   SLDKSVITSCTSLFALLALPFASALADDRGRKRVVLFADTLFIIGALCQAASRTVEVMVI 145

Query: 1047 GRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLS--GLP 1220
            GR V GI +G +  + P+Y +EL+PA  RG L ++  VFI +G ++ +V   +    G P
Sbjct: 146  GRSVVGIAIGAASFVTPLYIAELAPATHRGRLVTMNIVFITLGQVVAYVVGWIFGTYGSP 205

Query: 1221 ANISWRLMLGL 1253
                WR M+GL
Sbjct: 206  ETTGWRWMVGL 216



>gb:AE011810_276712 Xanthomonas axonopodis pv. citri str. 306, section
            188 of 469 of the complete genome.>gb:AE008923_918487
            Xanthomonas axonopodis pv. citri str. 306, complete
            genome.
          Length = 475

 Score = 84.0 bits (206), Expect = 6e-15
 Identities = 43/153 (28%), Positives = 84/153 (54%)
 Frame = +3

Query: 753  KFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXAS 932
            +F  L +  A+    L G+D GV++G V  +K+TF+ ++ +                  +
Sbjct: 17   RFIILISCVATIGGFLFGFDSGVINGTVDGLKQTFQSTAAETGFEVASMLLGCAIGAFFA 76

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
            G+ +D  GRR  ++++AA F++ A+  G + +  + +  RV+ G  VG + +I+P Y +E
Sbjct: 77   GRLADRWGRRAVLIISAALFLLSAIGAGASHSSAFFIFARVMGGFAVGAASVISPAYIAE 136

Query: 1113 LSPAMTRGFLSSLPEVFINVGILIGFVSNILLS 1211
            ++ A  RG L+++ ++ I  G+   F+SN LL+
Sbjct: 137  VASARYRGRLATMQQIAIISGLFCAFLSNYLLA 169



>gb:AP004126_1837991 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC
            clone:OJ9003_G05.>gb:AP004843_1845856 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, BAC
            clone:B1103G11.
          Length = 520

 Score = 83.6 bits (205), Expect = 8e-15
 Identities = 50/184 (27%), Positives = 89/184 (48%), Gaps = 20/184 (10%)
 Frame = +3

Query: 756  FAFLCAVFASTNSILLGYDLGVMSGA------------VLFIKETFKISSVQHEXXXXXX 899
            F F C + AS    + GYD+G+ +G             V+F ++  ++ + Q+       
Sbjct: 23   FVFFCCLIASVGGCIFGYDIGLTAGLTSTESFLAMFFPVIFEQQQERVITNQYCKFDSQV 82

Query: 900  XXXXXXXXXASGKTSDMI--------GRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRV 1055
                      S   + +         GR++T+ +AA  ++IGA+L  ++  +  LL GR+
Sbjct: 83   LTLFGSSLFLSAMVAGIFASPMSRAFGRKWTLFVAAVAYLIGAILGAISFNFIVLLTGRL 142

Query: 1056 VAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISW 1235
            + G+GVG  +  +P+Y SE++PA  RG L+ L ++ I VGIL   ++    S +     W
Sbjct: 143  LLGVGVGVCIHASPLYISEMAPAQQRGMLNILFQLMITVGILSASLTTYWTSKIAGGWGW 202

Query: 1236 RLML 1247
            R+ L
Sbjct: 203  RVGL 206



>gb:CR382128_1660594 Yarrowia lipolytica chromosome B of strain CLIB99
            of Yarrowia lipolytica.
          Length = 545

 Score = 83.6 bits (205), Expect = 8e-15
 Identities = 54/167 (32%), Positives = 83/167 (49%), Gaps = 3/167 (1%)
 Frame = +3

Query: 762  FLCAVFASTNSILLGYDLGVMSGAVLF--IKETFKI-SSVQHEXXXXXXXXXXXXXXXAS 932
            +L A  A+   +L G+D+  +S  V     KE F   +S+Q                  +
Sbjct: 24   YLTAAVATMGGLLFGFDISSVSAFVDTKPYKEYFGYPTSIQQGGITASMAGGSFLSSLVA 83

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
            G  SD +GRR+ I  A+  +++GA +   A   G L+AGR+++G+G+G    + PVY SE
Sbjct: 84   GWISDRLGRRFAIHFASFWWVVGAAIQSSAQNKGQLIAGRLISGLGIGLGSSVIPVYISE 143

Query: 1113 LSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            LSP   RG L  L +  +  GILI F  +  LS +     +R+  GL
Sbjct: 144  LSPKKIRGRLVGLFQWAVTWGILIMFYISFGLSNIHGVAGFRVAWGL 190



>gb:AY872172_2150336 Synthetic construct hypothetical protein
            (FTT0600) gene, complete cds.
          Length = 436

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 48/167 (28%), Positives = 81/167 (48%), Gaps = 6/167 (3%)
 Frame = +3

Query: 762  FLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKT 941
            F+   F++   +L GYD+G++ GA+ FIK    +++ Q                   G  
Sbjct: 45   FMIIFFSAMGGMLYGYDIGIIGGALPFIKYELGMTAAQESFLGGSVLFGGAFAILIGGVL 104

Query: 942  SDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSP 1121
            +D+ GR+  I  +   F I   ++  A +Y  LL  R++ G+ VG+  +  P+Y +E  P
Sbjct: 105  ADIFGRKNMITASGLIFTISVFMIYSAESYNSLLFSRLIQGVAVGFISITVPLYLTESVP 164

Query: 1122 AMTRGFLSSLPEVFINVGILIG------FVSNILLSGLPANISWRLM 1244
            +M RG   +  ++F+  GILI       F+SN  ++GL     WR M
Sbjct: 165  SMIRGLAVTCFQLFLTAGILISVAISLLFISNDPVTGLEIG-DWRNM 210



>gb:AY774484_2149197 Synthetic construct Francisella tularensis clone
            FLH158021.01X NT02FT0795 gene, complete cds.
          Length = 392

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 48/167 (28%), Positives = 81/167 (48%), Gaps = 6/167 (3%)
 Frame = +3

Query: 762  FLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKT 941
            F+   F++   +L GYD+G++ GA+ FIK    +++ Q                   G  
Sbjct: 10   FMIIFFSAMGGMLYGYDIGIIGGALPFIKYELGMTAAQESFLGGSVLFGGAFAILIGGVL 69

Query: 942  SDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSP 1121
            +D+ GR+  I  +   F I   ++  A +Y  LL  R++ G+ VG+  +  P+Y +E  P
Sbjct: 70   ADIFGRKNMITASGLIFTISVFMIYSAESYNSLLFSRLIQGVAVGFISITVPLYLTESVP 129

Query: 1122 AMTRGFLSSLPEVFINVGILIG------FVSNILLSGLPANISWRLM 1244
            +M RG   +  ++F+  GILI       F+SN  ++GL     WR M
Sbjct: 130  SMIRGLAVTCFQLFLTAGILISVAISLLFISNDPVTGLEIG-DWRNM 175



>gb:AP003878_1834723 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, BAC clone:OJ1120_C08.
          Length = 519

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 53/200 (26%), Positives = 87/200 (43%), Gaps = 20/200 (10%)
 Frame = +3

Query: 720  GSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVL---FIKETF----------- 857
            G  +P K  +  F F   + AS+  ++ GYD+G+  G      F+ E F           
Sbjct: 12   GKTYPGK--MTAFVFFTCLVASSGGLIFGYDIGISGGVTSMDSFLSEFFPSVYAQAKASK 69

Query: 858  ------KISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGL 1019
                  K  S                    +   + + GR++++     TF+ G+ L G 
Sbjct: 70   DTNQYCKFDSQLLTLFTSSLYLAALATSFVAAWVTRVFGRKWSMFCGGVTFLAGSALNGA 129

Query: 1020 APTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSN 1199
            A     L+ GR++ GIGVG++    P+Y SE++PA  RG L+   ++   +GIL   + N
Sbjct: 130  ATDVMMLILGRILLGIGVGFANQSVPLYLSEMAPANLRGMLNIGFQLMTTIGILSANLIN 189

Query: 1200 ILLSGLPANISWRLMLGLSG 1259
               S +     WR+ LGL+G
Sbjct: 190  YATSSIEGGWGWRIGLGLAG 209



>gb:LES132224_1684465 Lycopersicon esculentum mRNA for hexose
            transporter (HT2).
          Length = 523

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 53/204 (25%), Positives = 91/204 (44%), Gaps = 20/204 (9%)
 Frame = +3

Query: 708  GGAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVL---FIKETF------- 857
            GG H      + ++     +  + A+T  ++ GYD+GV  G      F+K+ F       
Sbjct: 12   GGTHF-----EAKITPIVIISCIMAATGGLMFGYDVGVSGGVTSMDPFLKKFFPTVYKRT 66

Query: 858  ----------KISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGAL 1007
                      K  +   +                +  T+  +GRR T+++A   FIIG +
Sbjct: 67   KEPGLDSNYCKYDNQGLQLFTSSLYLAGLTATFFASYTTRKLGRRLTMLIAGCFFIIGVV 126

Query: 1008 LMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIG 1187
            L   A     L+ GR++ G GVG++    P++ SE++P   RG L+ L ++ + +GIL  
Sbjct: 127  LNAAAQDLAMLIIGRILLGCGVGFANQAVPLFLSEIAPTRIRGGLNILFQLNVTIGILFA 186

Query: 1188 FVSNILLSGLPANISWRLMLGLSG 1259
             + N   + +     WRL LGL+G
Sbjct: 187  NLVNYGTAKISGGWGWRLSLGLAG 210



>gb:AY140054_1582494 Arabidopsis thaliana unknown protein (At3g03090)
            mRNA, complete cds.>gb:BT010375_1640321 Arabidopsis
            thaliana At3g03090 mRNA, complete cds.
          Length = 503

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 56/203 (27%), Positives = 98/203 (48%), Gaps = 8/203 (3%)
 Frame = +3

Query: 606  DP-NQDLDS*NMDSGIDSAKGRTEPMEITMVESRPGGAHGSPHPPKRRLNKFAFLCAVFA 782
            DP NQ + S     G  S+ G T   E  + E+         H P+      A    +F 
Sbjct: 4    DPENQSISSVGQVVGDSSSGGITAEKEPLLKEN---------HSPENYSVLAAIPPFLFP 54

Query: 783  STNSILLGYDLGVMSGAVLFIKET-------FKISSVQHEXXXXXXXXXXXXXXXASGKT 941
            +  ++L GY++G  S A++ +K         + +SSV                   +   
Sbjct: 55   ALGALLFGYEIGATSCAIMSLKSPTLSGISWYDLSSVDVGIITSGSLYGALIGSIVAFSV 114

Query: 942  SDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSP 1121
            +D+IGRR  ++LAA  +++GA++  +AP +  L+ GRV  G+G+G ++  AP+Y +E +P
Sbjct: 115  ADIIGRRKELILAAFLYLVGAIVTVVAPVFSILIIGRVTYGMGIGLTMHAAPMYIAETAP 174

Query: 1122 AMTRGFLSSLPEVFINVGILIGF 1190
            +  RG + SL E    +G++ G+
Sbjct: 175  SQIRGRMISLKEFSTVLGMVGGY 197



>gb:BSARARE_750256 B.subtilis araR and araE genes.
          Length = 223

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 54/181 (29%), Positives = 85/181 (46%), Gaps = 7/181 (3%)
 Frame = +3

Query: 726  PHPPKRRLNKFAF--LCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXX 899
            P+ P  R +   F  L +  A    +L GYD  V+SGA+ F+K+ + +S           
Sbjct: 10   PNVPVTRSHSMGFVILISCAAGLGGLLYGYDTAVISGAIGFLKDLYSLSPFMEGLVISSI 69

Query: 900  XXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGY 1079
                      SG  SD  GRR  ++ AA  F I A++  L+     L+  R++ G+G+G 
Sbjct: 70   MIGGVVGVGISGFLSDRFGRRKILMTAALLFAISAIVSALSQDVSTLIIARIIGGLGIGM 129

Query: 1080 SLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILL--SGL---PANISWRLM 1244
               ++  Y +E +P   RG LSSL ++F  +GI   +  N+ +  SG      +  WR M
Sbjct: 130  GSSLSVTYITEAAPPAIRGSLSSLYQLFTILGISATYFINLAVQRSGTYEWGVHTGWRWM 189

Query: 1245 L 1247
            L
Sbjct: 190  L 190



>pir|T01844|T01844 probable sugar transport protein F9D12.9 -
            Arabidopsis thaliana>gb:ATH344332_1552509 Arabidopsis
            thaliana mRNA for STP8 protein.>gb:F9D12_1678666
            Arabidopsis thaliana BAC F9D12.
          Length = 507

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 51/191 (26%), Positives = 87/191 (45%), Gaps = 19/191 (9%)
 Frame = +3

Query: 744  RLNKFAFLCAVFASTNSILLGYDLGVMSGAVL---FIKETF----------------KIS 866
            ++  + F+C + A+   ++ GYD+G+  G      F+KE F                K  
Sbjct: 17   KMTVYVFICVIIAAVGGLIFGYDIGISGGVTAMDDFLKEFFPSVYERKKHAHENNYCKYD 76

Query: 867  SVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLA 1046
            +   +                +  T   +GRR T+ LA+  F+IG  L   A     L+ 
Sbjct: 77   NQFLQLFTSSLYLAALVASFFASATCSKLGRRPTMQLASIFFLIGVGLAAGAVNIYMLII 136

Query: 1047 GRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPAN 1226
            GR++ G GVG+     P++ SE++PA  RG L+ + ++ + +GILI  + N   S +   
Sbjct: 137  GRILLGFGVGFGNQAVPLFLSEIAPARLRGGLNIVFQLMVTIGILIANIVNYFTSSIHP- 195

Query: 1227 ISWRLMLGLSG 1259
              WR+ LG +G
Sbjct: 196  YGWRIALGGAG 206



>sp|P96710|ARAE_BACSU Arabinose-proton symporter (Arabinose
            transporter).>pir|F69587|F69587 L-arabinose transport
            (permease) araE - Bacillus subtilis>gb:BSUB0018_755361
            Bacillus subtilis complete genome (section 18 of 21):
            from 3414339 to 3609030.
          Length = 464

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 54/181 (29%), Positives = 85/181 (46%), Gaps = 7/181 (3%)
 Frame = +3

Query: 726  PHPPKRRLNKFAF--LCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXX 899
            P+ P  R +   F  L +  A    +L GYD  V+SGA+ F+K+ + +S           
Sbjct: 10   PNVPVTRSHSMGFVILISCAAGLGGLLYGYDTAVISGAIGFLKDLYSLSPFMEGLVISSI 69

Query: 900  XXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGY 1079
                      SG  SD  GRR  ++ AA  F I A++  L+     L+  R++ G+G+G 
Sbjct: 70   MIGGVVGVGISGFLSDRFGRRKILMTAALLFAISAIVSALSQDVSTLIIARIIGGLGIGM 129

Query: 1080 SLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILL--SGL---PANISWRLM 1244
               ++  Y +E +P   RG LSSL ++F  +GI   +  N+ +  SG      +  WR M
Sbjct: 130  GSSLSVTYITEAAPPAIRGSLSSLYQLFTILGISATYFINLAVQRSGTYEWGVHTGWRWM 189

Query: 1245 L 1247
            L
Sbjct: 190  L 190



>gb:CR382135_1668233 Debaryomyces hansenii chromosome C of strain
            CBS767 of Debaryomyces hansenii.
          Length = 557

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 53/151 (35%), Positives = 68/151 (45%), Gaps = 5/151 (3%)
 Frame = +3

Query: 762  FLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGK- 938
            F    FAS   +L GYD GV+SG V       K   +  +                 G  
Sbjct: 26   FCIIAFASIGGLLFGYDQGVISGIVTMESFAAKFPRIFSDPDYKGWFVSTFLLCAWFGSL 85

Query: 939  ----TSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYT 1106
                  D  GRR TI +A   F+IG++      +   L AGR VAGIGVG   M+ P+Y 
Sbjct: 86   INSPVVDRFGRRDTIRIACVVFVIGSVFQCAGTSVSMLFAGRAVAGIGVGQLTMVVPIYM 145

Query: 1107 SELSPAMTRGFLSSLPEVFINVGILIGFVSN 1199
            SEL+P   RG L  + +  I +GILI F  N
Sbjct: 146  SELAPPSVRGGLVVIQQFSITIGILISFWIN 176



>gb:AJ698934_1813466 Populus tremula x Populus tremuloides mRNA for
            monosaccharide transporter (tMST2.1 gene), strain T 89.
          Length = 519

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 60/206 (29%), Positives = 93/206 (45%), Gaps = 25/206 (12%)
 Frame = +3

Query: 708  GGAHGSPHPPKRRLNKFAF---LCAVFASTNSILLGYDLGVMSGAV---LFIKETF---- 857
            GGA       K    KF F      +FA+T  ++ GYDLG+  G     +F+K+ F    
Sbjct: 3    GGAFAPTSGGKEYPGKFTFRVFFTCLFAATGGLIFGYDLGISGGVTSMDVFLKDFFPDVY 62

Query: 858  -KISSVQHEXX-------------XXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFI 995
             K SSV+                               +   +   GRR T++ +   F 
Sbjct: 63   QKESSVKPSDDQYCKFDSQILTLFTSSLYLAALVSSIGASMATRTYGRRPTMMTSGLLFA 122

Query: 996  IGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVG 1175
             GA++ GLA     L+ GR++ G G+G +    P+Y SE++P   RG L+ + ++FI +G
Sbjct: 123  AGAIVNGLAKNVVMLIVGRLLLGFGIGCANQSVPIYLSEVAPYKYRGALNMMFQLFITIG 182

Query: 1176 ILIGFVSNILLSGL-PANISWRLMLG 1250
            ILI    N   + L   +++WRL LG
Sbjct: 183  ILIANSLNYAFARLIGGDMAWRLSLG 208



>gb:AF000952_1760507 Prunus armeniaca putative sugar transporter mRNA,
            complete cds.
          Length = 475

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 52/179 (29%), Positives = 85/179 (47%), Gaps = 2/179 (1%)
 Frame = +3

Query: 726  PHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKIS--SVQHEXXXXXX 899
            P  P+ + +   F     A   +IL GY LGV++GA+ ++ +   I+  +V         
Sbjct: 23   PSKPQGKSSGTVFPFVGVACLGAILFGYHLGVVNGALEYLSKDLGIAENAVLQGWVVSAL 82

Query: 900  XXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGY 1079
                       G  +D  GR  T  L      IGA L   + +   ++ GR +  +G+G 
Sbjct: 83   LAGATVGSFTGGALADKFGRTRTFQLDVIPLAIGAFLCATSQSVQTMIVGRYLLAVGIGI 142

Query: 1080 SLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            +  I P+Y SE+SP   RG L S+ ++FI +GIL   V+ + L+  P  + WR M G++
Sbjct: 143  TSAIVPLYISEISPTEIRGALGSVNQLFICIGILGALVAGLPLAANP--LWWRTMFGVA 199



>gb:AE017343_1755565 Cryptococcus neoformans var. neoformans JEC21
            chromosome 3, complete sequence.
          Length = 561

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 59/184 (32%), Positives = 88/184 (47%), Gaps = 9/184 (4%)
 Frame = +3

Query: 729  HPPKRRL--NKFAFLCAVFASTNSILLGYDLGVMSGAVL--FIKETF-KISSVQHEXXXX 893
            H  +R+L  +   +  +VF S    L GYD GVMSG +   + K  F + +S Q      
Sbjct: 11   HKTQRKLVGHNLLYSVSVFLSIGVWLFGYDQGVMSGIITGPYFKAYFNQPTSTQIGNMVA 70

Query: 894  XXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGV 1073
                       A+   +D  GRR T+   A  F IG  +      Y  ++ GR+V+G GV
Sbjct: 71   VLEIGAFITSLAAAHIADNYGRRMTLRTGAIVFTIGGAIQTFCVGYNSMVLGRIVSGFGV 130

Query: 1074 GYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILL----SGLPANISWRL 1241
            G   M+ P+Y SE+SPA  RG L S+       G +IG+ S++ +    S   ++ SWRL
Sbjct: 131  GMLSMVVPIYQSEISPADHRGLLGSVE----FTGNIIGYASSVWIDYACSFFQSDWSWRL 186

Query: 1242 MLGL 1253
             L +
Sbjct: 187  PLSV 190



>gb:CR380955_1651835 Candida glabrata strain CBS138 chromosome I
            complete sequence.
          Length = 570

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 49/173 (28%), Positives = 89/173 (51%), Gaps = 3/173 (1%)
 Frame = +3

Query: 747  LNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIK---ETFKISSVQHEXXXXXXXXXXXX 917
            ++ F  +    AS +  L GYD G +S A++ I    +  +++  + E            
Sbjct: 69   VSHFIIMLTFVASLSGFLFGYDTGYISSALISIGTDLDNKELTYGEKEITTAATSLGALI 128

Query: 918  XXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAP 1097
                +G + D+ GR+  ++ +   F+IGA+L   A  +  + AGR + G GVG   +IAP
Sbjct: 129  FALVAGFSVDIFGRKPCLMFSNIMFLIGAILQVTAHKFWQMTAGRFIMGFGVGIGSLIAP 188

Query: 1098 VYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            +Y SE++P M RG L+ +  +++  G LI +     L+ +  +  WR+++GLS
Sbjct: 189  LYISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHV--HNGWRILVGLS 239



>gb:BX842632_1644003 Neurospora crassa DNA linkage group I BAC contig
            B5K2.
          Length = 594

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 56/197 (28%), Positives = 89/197 (45%), Gaps = 13/197 (6%)
 Frame = +3

Query: 702  RPGGAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSG--AVLFIKETFKISSV- 872
            +P    GS  P        A +  +F +T  +LLGYD G ++G  A+   K+ F    + 
Sbjct: 10   KPDNVAGSSAP--------AIMVGLFVATGGLLLGYDTGTINGILAMKSFKDHFSTGYID 61

Query: 873  ----------QHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLA 1022
                      +                  +    D  GRR +++ A   F+IGA+L   A
Sbjct: 62   GNGQPGIYPKESALIVAMLSAGTAIGALLAAPLGDHYGRRRSLIGAIGIFVIGAILQVCA 121

Query: 1023 PTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNI 1202
                 L+AGR VAG+G+G   ++ P+Y SE++P   RG L    ++ I +G+L   V NI
Sbjct: 122  YNIDLLVAGRTVAGVGIGIVSVLVPLYQSEMAPKWIRGTLVCTYQLSITMGLLAAAVVNI 181

Query: 1203 LLSGLPANISWRLMLGL 1253
            L   L    ++R+ +GL
Sbjct: 182  LTYKLKTAAAYRVPIGL 198



>gb:AY738713_1626108 Botryotinia fuckeliana fructose transporter 1
            (frt1) gene, complete cds.
          Length = 615

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 50/167 (29%), Positives = 82/167 (49%)
 Frame = +3

Query: 756  FAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASG 935
            + +L   FAS   +L G D  ++SGA L++  +  +++ Q                   G
Sbjct: 101  YTWLLVAFASMGGLLSGIDQSLISGANLYMPSSLGLNTKQVSLVSSGVPLGAVGGALMLG 160

Query: 936  KTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSEL 1115
              ++ +GR+  IV +   + +GA L   A  +G ++AGRV+ G+GVG      PVY +E 
Sbjct: 161  PLNEAVGRKQAIVWSLFLYTVGAALEAGAVNFGMMMAGRVILGLGVGLEGGTVPVYVAES 220

Query: 1116 SPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
                 RG L SL +  I +G ++G+V   +  G+ +   WR MLG S
Sbjct: 221  VAPKYRGNLVSLYQFMIALGEVLGYVVAAIFVGVKSG-GWRYMLGSS 266



>pir|T51485|T51485 sugar transporter-like protein - Arabidopsis
            thaliana>gb:ATT21H19_1555116 Arabidopsis thaliana DNA
            chromosome 5, BAC clone T21H19 (ESSA project).
          Length = 560

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 53/175 (30%), Positives = 82/175 (46%), Gaps = 16/175 (9%)
 Frame = +3

Query: 780  ASTNSILLGYDLGVMSGAVLFIKETFKISSVQ----------------HEXXXXXXXXXX 911
            A   +IL GY LGV++GA+ ++ +   I+                   +           
Sbjct: 112  ACLGAILFGYHLGVVNGALEYLAKDLGIAENTVLQGKYMMIHFFTPPVNGWIVSSLLAGA 171

Query: 912  XXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMI 1091
                   G  +D  GR  T  L A    IGA L   A +   ++ GR++AGIG+G S  I
Sbjct: 172  TVGSFTGGALADKFGRTRTFQLDAIPLAIGAFLCATAQSVQTMIVGRLLAGIGIGISSAI 231

Query: 1092 APVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
             P+Y SE+SP   RG L S+ ++FI +GIL   ++ + L+  P  + WR M G++
Sbjct: 232  VPLYISEISPTEIRGALGSVNQLFICIGILAALIAGLPLAANP--LWWRTMFGVA 284



>pir|T07379|T07379 hexose transport protein -
            tomato>gb:LES010942_1684452 Lycopersicon esculentum mRNA
            for hexose transporter.
          Length = 523

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 50/190 (26%), Positives = 87/190 (45%), Gaps = 20/190 (10%)
 Frame = +3

Query: 750  NKFAFLCAVFASTNSILLGYDLGVMSGAVL---FIKETF-----------------KISS 869
            ++   +  + A+T  ++ GYD+GV  G      F+K+ F                 K  +
Sbjct: 21   HQLVIISCIMAATGGLMFGYDVGVSGGVTSMDPFLKKFFPTVYKRTKEPGLDSNYCKYDN 80

Query: 870  VQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAG 1049
               +                +  T+  +GRR T+++A   FIIG +L   A     L+ G
Sbjct: 81   QGLQLFTSSLYLAGLTATFFASYTTRKLGRRLTMLIAGCFFIIGVVLNAAAQDLAMLIIG 140

Query: 1050 RVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANI 1229
            R++ G GVG++    P++ SE++P   RG L+ L ++ + +GIL   + N   + +    
Sbjct: 141  RILLGCGVGFANQAVPLFLSEIAPTRIRGGLNILFQLNVTIGILFANLVNYGTAKISGGW 200

Query: 1230 SWRLMLGLSG 1259
             WRL LGL+G
Sbjct: 201  GWRLSLGLAG 210



>sp|Q92253|RCO3_NEUCR Probable glucose transporter
            rco-3.>gb:NCU54768_1690692 Neurospora crassa RCO3 (rco-3)
            gene, complete cds.
          Length = 594

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 56/197 (28%), Positives = 89/197 (45%), Gaps = 13/197 (6%)
 Frame = +3

Query: 702  RPGGAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSG--AVLFIKETFKISSV- 872
            +P    GS  P        A +  +F +T  +LLGYD G ++G  A+   K+ F    + 
Sbjct: 10   KPDNVAGSSAP--------AIMVGLFVATGGLLLGYDTGTINGILAMKSFKDHFSTGYID 61

Query: 873  ----------QHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLA 1022
                      +                  +    D  GRR +++ A   F+IGA+L   A
Sbjct: 62   GNGQPGIYPKESALIVAMLSAGTAIGALLAAPLGDHYGRRRSLIGAIGIFVIGAILQVCA 121

Query: 1023 PTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNI 1202
                 L+AGR VAG+G+G   ++ P+Y SE++P   RG L    ++ I +G+L   V NI
Sbjct: 122  YNIDLLVAGRTVAGVGIGIVSVLVPLYQSEMAPKWIRGTLVCTYQLSITMGLLAAAVVNI 181

Query: 1203 LLSGLPANISWRLMLGL 1253
            L   L    ++R+ +GL
Sbjct: 182  LTYKLKTAAAYRVPIGL 198



>sp|Q01440|GTR1_LEIDO Membrane transporter D1.>pir|A48442|A48442
            membrane transport protein (clone D1.SH) - Leishmania
            donovani>gb:LEID1TRA_1387361 Leishmania donovani D1
            transporter gene, complete cds.
          Length = 547

 Score = 82.4 bits (202), Expect = 2e-14
 Identities = 53/162 (32%), Positives = 80/162 (49%), Gaps = 4/162 (2%)
 Frame = +3

Query: 780  ASTNSILLGYDLGVMSGAVLFIKETFKIS--SVQHEXXXXXXXXXXXXXXXASGKTSDMI 953
            A+    L GYD GV++ A+  +K+ F  S  S Q+                 SG  S   
Sbjct: 9    AALGGFLFGYDTGVINAALFQMKDHFGFSEHSWQYALIVAIAIAGAFVGAFISGFISAAF 68

Query: 954  GRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTR 1133
            GRR  I +A A F+IG++LMG AP    +L  RV+ G+ +G S    PVY +E++    R
Sbjct: 69   GRRPCIAVADALFVIGSVLMGAAPNVEVVLVSRVIVGLAIGISSATIPVYLAEVTSPKHR 128

Query: 1134 GFLSSLPEVFINVG--ILIGFVSNILLSGLPANISWRLMLGL 1253
            G    L  +F+  G  +  GF + I++     NI WR+ +G+
Sbjct: 129  GATIVLNNLFLTGGQFVAAGFTA-IMVVFTSKNIGWRVAIGI 169



>gb:BC067616_2554788 Danio rerio cDNA clone MGC:85776 IMAGE:6960744,
            complete cds.
          Length = 601

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 47/163 (28%), Positives = 85/163 (52%), Gaps = 1/163 (0%)
 Frame = +3

Query: 765  LCAV-FASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKT 941
            LC+V  A  + +L+GY++ ++SGA+L +++   +S  + E                 G  
Sbjct: 36   LCSVSVACLSGLLMGYEMSLISGALLQLRDVLTLSCPEQEQVVGSLLLGAFLLSLGGGTI 95

Query: 942  SDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSP 1121
             D  GRR+TI+L A   ++G LL     ++  L+ GR++ G+ V  S   + +Y +E++P
Sbjct: 96   LDHYGRRFTIILTALLCVLGTLLSVCVVSFWALVVGRMLVGMSVALSGTASCLYAAEVAP 155

Query: 1122 AMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLG 1250
            A  RG    + E+ + +G+L+GF  +   +G+P    WR   G
Sbjct: 156  AAWRGRCVCVYELMVVLGMLLGFGLSWAFAGVPD--GWRFTFG 196



>gb:AP004185_1838707 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, BAC clone:OJ1301_C12.
          Length = 465

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 54/169 (31%), Positives = 83/169 (49%), Gaps = 1/169 (0%)
 Frame = +3

Query: 738  KRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXX 917
            +R  NK+ F+ AV +S   +LLGYDL ++ G+    +          +            
Sbjct: 2    RRPKNKYGFVTAVLSSATPLLLGYDLVMVCGSATLPEPPGV------KLLACVAVASCVL 55

Query: 918  XXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAP 1097
               A+     ++G R T++L+AA    GAL  GLA ++    AG  V G+G+G +LM  P
Sbjct: 56   GALAAVGAQCVVGDRCTVLLSAAVLCAGALARGLATSFAAFEAGVFVNGVGMGLALMSVP 115

Query: 1098 VYTSELSPAMTRGFLSSLPEVFINVG-ILIGFVSNILLSGLPANISWRL 1241
             Y  ELSP+     L+S P+ F+ +G IL G   +     LP  ++WRL
Sbjct: 116  AYAGELSPSSLHRGLTSHPDGFVCLGCILGGLCFSPRFLNLPVRVAWRL 164



>gb:AX813899_1475669 Sequence 139 from Patent WO03040292.
          Length = 508

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 56/187 (29%), Positives = 90/187 (48%), Gaps = 14/187 (7%)
 Frame = +3

Query: 735  PKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXX 914
            P RRL + + +    A  + +L GYD GV SGA   + +   ++ +Q             
Sbjct: 21   PARRLGQISLV----ACLDGLLFGYDTGVASGAEGHMAQELGLNVLQLGVVISSLVFAAA 76

Query: 915  XXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPT----------YGYLLAGRVVAG 1064
                 +G+ SD IGRR  I+  +  F +G++L+  +P           +  L+ GR++ G
Sbjct: 77   FGALFAGRISDEIGRRKAIITLSVLFFLGSILVVFSPAGELGQFYGPGFATLVTGRIMLG 136

Query: 1065 IGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNIL----LSGLPANIS 1232
            + VG +  + PVY +EL+P   RG L+   E+ I  G L+ FV N L    L G+   I 
Sbjct: 137  LAVGGASTVVPVYLAELAPLEIRGSLTGRNELAIVTGQLLAFVINALIAVTLHGVIDGI- 195

Query: 1233 WRLMLGL 1253
            WR+M  +
Sbjct: 196  WRIMFAV 202



>gb:YSCITR1_1729396 Saccharomyces cerevisiae ITR1 gene for
            myo-inositol transporter, complete cds.
          Length = 584

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 48/173 (27%), Positives = 87/173 (50%), Gaps = 3/173 (1%)
 Frame = +3

Query: 747  LNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFK---ISSVQHEXXXXXXXXXXXX 917
            L+ F       AS +  + GYD G +S A++ I        ++  + E            
Sbjct: 82   LSPFIITLTFVASISGFMFGYDTGYISSALISIGTDLDHKVLTYGEKEIVTAATSLGALI 141

Query: 918  XXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAP 1097
                +G  +D+ GR+  ++ +   F+IGA+L   A T+  +  GR++ G GVG   +IAP
Sbjct: 142  TSIFAGTAADIFGRKRCLMGSNLMFVIGAILQVSAHTFWQMAVGRLIMGFGVGIGSLIAP 201

Query: 1098 VYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            ++ SE++P M RG L+ +  +++  G L+ +     L+ +  N  WR+++GLS
Sbjct: 202  LFISEIAPKMIRGRLTVINSLWLTGGQLVAYGCGAGLNYV--NNGWRILVGLS 252



>pir|T12199|T12199 monosaccharid transport protein - fava
            bean>gb:VFZ93775_1727210 V.faba mRNA for hexose
            transporter.
          Length = 516

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 52/202 (25%), Positives = 88/202 (43%), Gaps = 20/202 (9%)
 Frame = +3

Query: 705  PGGAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVL-------FIKETFKI 863
            P GA    +P    L  F  +  V A+   ++ GYD+G+  G          F    ++ 
Sbjct: 7    PIGAGNKEYPGN--LTPFVTITCVVAAMGGLIFGYDIGISGGVTSMNPFLEKFFPAVYRK 64

Query: 864  SSVQH----------EXXXXXXXXXXXXXXXASGKTSDM---IGRRYTIVLAAATFIIGA 1004
             + QH          E               +S   S +    GR+ +++     F++GA
Sbjct: 65   KNAQHSKNQYCQYDSETLTLFTSSLYLAALLSSVVASTITRRFGRKLSMLFGGLLFLVGA 124

Query: 1005 LLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILI 1184
            L+ GLA     L+ GR++ G G+G++    P+Y SE++P   RG L+   ++ I +GIL+
Sbjct: 125  LINGLAQNVAMLIVGRILLGFGIGFANQSVPLYLSEMAPYKYRGALNIGFQLSITIGILV 184

Query: 1185 GFVSNILLSGLPANISWRLMLG 1250
              + N   + +     WRL LG
Sbjct: 185  ANILNYFFAKIKGGWGWRLSLG 206



>sp|P30605|ITR1_YEAST Myo-inositol transporter 1.>pir|S69555|S69555
            myo-inositol transport protein ITR1 - yeast
            (Saccharomyces cerevisiae)>gb:SCD9717_1707592
            Saccharomyces cerevisiae chromosome IV cosmids 8166,
            9787, 9717, and lambda 3073.
          Length = 584

 Score = 81.3 bits (199), Expect = 4e-14
 Identities = 48/173 (27%), Positives = 87/173 (50%), Gaps = 3/173 (1%)
 Frame = +3

Query: 747  LNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFK---ISSVQHEXXXXXXXXXXXX 917
            L+ F       AS +  + GYD G +S A++ I        ++  + E            
Sbjct: 82   LSPFIITLTFVASISGFMFGYDTGYISSALISIGTDLDHKVLTYGEKEIVTAATSLGALI 141

Query: 918  XXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAP 1097
                +G  +D+ GR+  ++ +   F+IGA+L   A T+  +  GR++ G GVG   +IAP
Sbjct: 142  TSIFAGTAADIFGRKRCLMGSNLMFVIGAILQVSAHTFWQMAVGRLIMGFGVGIGSLIAP 201

Query: 1098 VYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            ++ SE++P M RG L+ +  +++  G L+ +     L+ +  N  WR+++GLS
Sbjct: 202  LFISEIAPKMIRGRLTVINSLWLTGGQLVAYGCGAGLNYV--NNGWRILVGLS 252



>gb:CR382131_1664419 Yarrowia lipolytica chromosome E of strain CLIB99
            of Yarrowia lipolytica.
          Length = 602

 Score = 80.9 bits (198), Expect = 5e-14
 Identities = 55/167 (32%), Positives = 83/167 (49%), Gaps = 3/167 (1%)
 Frame = +3

Query: 762  FLCAVFASTNSILLGYDLGVMSGAV---LFIKETFKISSVQHEXXXXXXXXXXXXXXXAS 932
            +L A  A+   +L G+D+  +S  V    +++     +S+Q                  +
Sbjct: 77   YLTAAVATMGGMLFGFDISSVSAFVGEDQYMQYFGHPTSIQQGGITASMAGGSMLSCSFA 136

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
            G  SD IGR+ TI +AAA +I+GA +   A   G L+AGRV++GIG+G      PV+ SE
Sbjct: 137  GFISDRIGRKPTIQIAAAWWIVGAAIQCSAQNMGQLIAGRVISGIGIGIGSSQIPVFISE 196

Query: 1113 LSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            LSP   RG L    +  +  GILI F  +   S +    S+RL  G+
Sbjct: 197  LSPKKIRGRLVGCFQWAVTWGILIMFYISFGCSYIKGPASFRLAWGI 243



>gb:AY045591_1561182 Arabidopsis thaliana AT5g26340/F9D12_17 mRNA,
            complete cds.>gb:AY143909_1583366 Arabidopsis thaliana
            At5g26340/F9D12_17 mRNA, complete cds.
          Length = 344

 Score = 80.9 bits (198), Expect = 5e-14
 Identities = 50/193 (25%), Positives = 87/193 (45%), Gaps = 21/193 (10%)
 Frame = +3

Query: 744  RLNKFAFLCAVFASTNSILLGYDLGVMSGAVL---FIKETF------------------K 860
            ++     +  + A+T  ++ GYD+GV  G      F+++ F                  K
Sbjct: 18   KITPIVIISCIMAATGGLMFGYDVGVSGGVTSMPDFLEKFFPVVYRKVVAGADKDSNYCK 77

Query: 861  ISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYL 1040
              +   +                +  T+  +GRR T+++A   FIIG  L   A     L
Sbjct: 78   YDNQGLQLFTSSLYLAGLTATFFASYTTRTLGRRLTMLIAGVFFIIGVALNAGAQDLAML 137

Query: 1041 LAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLP 1220
            +AGR++ G GVG++    P++ SE++P   RG L+ L ++ + +GIL   + N   + + 
Sbjct: 138  IAGRILLGCGVGFANQAVPLFLSEIAPTRIRGGLNILFQLNVTIGILFANLVNYGTAKIK 197

Query: 1221 ANISWRLMLGLSG 1259
                WRL LGL+G
Sbjct: 198  GGWGWRLSLGLAG 210



>gb:AF212041_488748 Zymomonas mobilis fosmid clone 42D10, complete
            sequence.
          Length = 479

 Score = 80.9 bits (198), Expect = 5e-14
 Identities = 51/153 (33%), Positives = 77/153 (50%)
 Frame = +3

Query: 798  LLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVL 977
            L GYD G++SGA++ I   FK+ + Q E                 G+ S  +GRR+ I++
Sbjct: 42   LYGYDTGIISGALMNIAHDFKLDAHQQEIITSILLFGAVIGSLVCGRLSAFVGRRHMIMI 101

Query: 978  AAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPE 1157
              A F    +    APT  +L A R+V G  VG S  I PVY +EL+PA  RG + +   
Sbjct: 102  VTAIFGFSVIAAD-APTAFWLGAARLVLGFAVGGSSQIVPVYIAELAPADQRGRMVTFYN 160

Query: 1158 VFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            + I +GIL    + I+ + L    +WR M  ++
Sbjct: 161  ISIGLGIL---AAGIVGAFLQEEWTWRTMFSVA 190



>gb:CR378676_97308 Photobacterium profundum SS9 chromosome 2; segment
            2/7.
          Length = 480

 Score = 80.9 bits (198), Expect = 5e-14
 Identities = 55/175 (31%), Positives = 89/175 (50%), Gaps = 5/175 (2%)
 Frame = +3

Query: 738  KRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXX 917
            K  L+    +C + A+   ILLGYD  V+SGA+  I+E F +++ Q              
Sbjct: 11   KHNLSYIIRICCI-AALGGILLGYDTAVISGAIGPIREYFNLTAAQTGWAVSSVVLGSII 69

Query: 918  XXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAP 1097
               +SG  +   GRR  + LAA  FII A+   LA T+   +  R+V GI VG + +++P
Sbjct: 70   GAISSGWCALKYGRRKALFLAALLFIISAIGSALAATFTIYVLFRIVGGIAVGLACVVSP 129

Query: 1098 VYTSELSPAMTRGFLSSLPEVFINVGIL-IGFVSNILLSGLP----ANISWRLML 1247
            +Y SE++P   RG   S+ +    +G   + +V+ ++  G+      +I WR ML
Sbjct: 130  MYMSEVAPKDFRGRAVSMFQQSAVIGQTGVFYVNYLIAKGMSEAWLVDIGWRWML 184



>pir|T01853|T01853 probable hexose transport protein F9D12.17 -
            Arabidopsis thaliana>gb:ATH344338_1552515 Arabidopsis
            thaliana mRNA for STP13 protein.>gb:AY052692_1562852
            Arabidopsis thaliana AT5g26340/F9D12_17 mRNA, complete
            cds.>gb:F9D12_1678675 Arabidopsis thaliana BAC
            F9D12.>gb:AF250340_1780874 Arabidopsis thaliana putative
            hexose transporter MSS1 (F9D12.17) mRNA, complete cds.
          Length = 526

 Score = 80.9 bits (198), Expect = 5e-14
 Identities = 50/193 (25%), Positives = 87/193 (45%), Gaps = 21/193 (10%)
 Frame = +3

Query: 744  RLNKFAFLCAVFASTNSILLGYDLGVMSGAVL---FIKETF------------------K 860
            ++     +  + A+T  ++ GYD+GV  G      F+++ F                  K
Sbjct: 18   KITPIVIISCIMAATGGLMFGYDVGVSGGVTSMPDFLEKFFPVVYRKVVAGADKDSNYCK 77

Query: 861  ISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYL 1040
              +   +                +  T+  +GRR T+++A   FIIG  L   A     L
Sbjct: 78   YDNQGLQLFTSSLYLAGLTATFFASYTTRTLGRRLTMLIAGVFFIIGVALNAGAQDLAML 137

Query: 1041 LAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLP 1220
            +AGR++ G GVG++    P++ SE++P   RG L+ L ++ + +GIL   + N   + + 
Sbjct: 138  IAGRILLGCGVGFANQAVPLFLSEIAPTRIRGGLNILFQLNVTIGILFANLVNYGTAKIK 197

Query: 1221 ANISWRLMLGLSG 1259
                WRL LGL+G
Sbjct: 198  GGWGWRLSLGLAG 210



>sp|P30606|ITR2_YEAST Myo-inositol transporter 2.>pir|B40538|B40538
            myo-inositol transport protein ITR2 - yeast
            (Saccharomyces cerevisiae)>gb:SCCHRXV44_1707055
            S.cerevisiae chromosome XV DNA (44 kb
            fragment).>gb:SCYOL103W_1714155 S.cerevisiae chromosome
            XV reading frame ORF YOL103w.>gb:YSCITR2_1729397
            Saccharomyces cerevisiae ITR2 gene for myo-inositol
            transporter, complete cds.
          Length = 612

 Score = 80.9 bits (198), Expect = 5e-14
 Identities = 47/173 (27%), Positives = 86/173 (49%), Gaps = 3/173 (1%)
 Frame = +3

Query: 747  LNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFK---ISSVQHEXXXXXXXXXXXX 917
            ++ F       AS +  + GYD G +S A++ I        ++  + E            
Sbjct: 108  ISPFIITLTFVASISGFMFGYDTGYISSALISINRDLDNKVLTYGEKELITAATSLGALI 167

Query: 918  XXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAP 1097
                +G  +D+ GRR  ++ +   F+IGA+L   A  +  + AGR++ G GVG   +I+P
Sbjct: 168  TSVGAGTAADVFGRRPCLMFSNLMFLIGAILQITAHKFWQMAAGRLIMGFGVGIGSLISP 227

Query: 1098 VYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            ++ SE++P M RG L+ +  +++  G LI +     L+ +     WR+++GLS
Sbjct: 228  LFISEIAPKMIRGRLTVINSLWLTGGQLIAYGCGAGLNHV--KNGWRILVGLS 278



>gb:CR380959_1653719 Candida glabrata strain CBS138 chromosome M
            complete sequence.
          Length = 547

 Score = 80.5 bits (197), Expect = 7e-14
 Identities = 55/168 (32%), Positives = 77/168 (45%), Gaps = 6/168 (3%)
 Frame = +3

Query: 771  AVFASTN--SILLGYDLGVMSGAVLFIKET----FKISSVQHEXXXXXXXXXXXXXXXAS 932
            A+F S+    +L GYD GV+SG +L +K        IS    E                 
Sbjct: 52   ALFGSSTVGGLLFGYDTGVISGVLLSLKPQDLGRATISDWDKELITSITCLGCFVGSLLG 111

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
               +D  GRR T+ +    FI+ AL M LA     L+ GR V GI VG +    PVY  E
Sbjct: 112  SPLADKYGRRITLAIFCVLFIVAALWMALASNLVLLVFGRFVVGIAVGTAAQCTPVYLCE 171

Query: 1113 LSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            +SPA  RG + +L  + +  G  + ++    L     N SWR++ GLS
Sbjct: 172  ISPAKIRGQILALNSIAVTGGQFLSYIFAYEL--YDVNGSWRILFGLS 217



>gb:AC069251_1540747 Genomic sequence for Arabidopsis thaliana BAC
            F2D10 from chromosome I, complete sequence.
          Length = 734

 Score = 80.5 bits (197), Expect = 7e-14
 Identities = 47/167 (28%), Positives = 84/167 (50%)
 Frame = +3

Query: 753  KFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXAS 932
            K A L A+ A+  + L G+D   ++GA+++I +   + +                    S
Sbjct: 2    KGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTCS 61

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
            G  SD +GRR  ++L++  + +  L+M  +P    L   R++ G G G ++ + PVY SE
Sbjct: 62   GPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLAVTLVPVYISE 121

Query: 1113 LSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
             +P   RG L++LP+   + G+ + +     +S L  + SWR MLG+
Sbjct: 122  TAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMS-LSDSPSWRAMLGV 167



>pir|T51139|T51139 sugar transport protein [imported] - Arabidopsis
            thaliana>gb:ATSUGTRPR_1554187 A.thaliana mRNA for sugar
            transporter.
          Length = 734

 Score = 80.5 bits (197), Expect = 7e-14
 Identities = 47/167 (28%), Positives = 84/167 (50%)
 Frame = +3

Query: 753  KFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXAS 932
            K A L A+ A+  + L G+D   ++GA+++I +   + +                    S
Sbjct: 2    KGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTCS 61

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
            G  SD +GRR  ++L++  + +  L+M  +P    L   R++ G G G ++ + PVY SE
Sbjct: 62   GPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLAVTLVPVYISE 121

Query: 1113 LSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
             +P   RG L++LP+   + G+ + +     +S L  + SWR MLG+
Sbjct: 122  TAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMS-LSDSPSWRAMLGV 167



>pir|H86340|H86340 Sugar transporter [imported] - Arabidopsis
            thaliana>gb:AE005172_891043 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC007369_1535818 Arabidopsis thaliana
            chromosome I BAC F9H16 genomic sequence, complete
            sequence.
          Length = 734

 Score = 80.5 bits (197), Expect = 7e-14
 Identities = 47/167 (28%), Positives = 84/167 (50%)
 Frame = +3

Query: 753  KFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXAS 932
            K A L A+ A+  + L G+D   ++GA+++I +   + +                    S
Sbjct: 2    KGATLVALAATIGNFLQGWDNATIAGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTCS 61

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
            G  SD +GRR  ++L++  + +  L+M  +P    L   R++ G G G ++ + PVY SE
Sbjct: 62   GPISDWLGRRPMLILSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLAVTLVPVYISE 121

Query: 1113 LSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
             +P   RG L++LP+   + G+ + +     +S L  + SWR MLG+
Sbjct: 122  TAPPEIRGQLNTLPQFLGSGGMFLSYCMVFTMS-LSDSPSWRAMLGV 167



>gb:AP004082_1837424 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, BAC clone:OJ1149_C12.
          Length = 652

 Score = 80.1 bits (196), Expect = 9e-14
 Identities = 48/168 (28%), Positives = 84/168 (50%), Gaps = 3/168 (1%)
 Frame = +3

Query: 759  AFLCAVFASTNSILLGYDLGVMSGAVLFIKE---TFKISSVQHEXXXXXXXXXXXXXXXA 929
            A + A  A+  ++L G+D   ++GA+L+++      +                       
Sbjct: 4    AVVAAAAAAVGNMLQGWDNATIAGALLYMRRDLPALQAHPALQGLVVATSLIGATIVTTF 63

Query: 930  SGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTS 1109
            SG  SD  GRR  ++ +A  + +  LLM  +P    LL  R+V G  +G ++ + PVY S
Sbjct: 64   SGPLSDSRGRRPMLIASALLYSLAGLLMLWSPNVPILLLARLVDGFAIGLAVTLVPVYIS 123

Query: 1110 ELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            E +P  TRG L++LP++  + G+ + +    L++  P   +WRLMLG+
Sbjct: 124  ETAPPDTRGLLNTLPQLTGSTGMFLSYCMVFLITLAPIP-NWRLMLGV 170



>gb:BA000036_720785 Corynebacterium glutamicum ATCC 13032 DNA,
            complete genome.>gb:BX927157_834600 Corynebacterium
            glutamicum ATCC 13032, IS fingerprint type 4-5, complete
            genome; segment 10/10.
          Length = 508

 Score = 80.1 bits (196), Expect = 9e-14
 Identities = 55/187 (29%), Positives = 89/187 (47%), Gaps = 14/187 (7%)
 Frame = +3

Query: 735  PKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXX 914
            P RRL + + +    A    +L GYD GV +GA   + +   ++ +Q             
Sbjct: 21   PARRLGQISLV----ACLGGLLFGYDTGVANGAEGHMAQELGLNVLQLGVVISSLVFAAA 76

Query: 915  XXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPT----------YGYLLAGRVVAG 1064
                 +G+ SD IGRR  I+  +  F +G++L+  +P           +  L+ GR++ G
Sbjct: 77   FGALFAGRISDEIGRRKAIITLSVLFFLGSILVVFSPAGELGQFYGPGFATLVTGRIMLG 136

Query: 1065 IGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNIL----LSGLPANIS 1232
            + VG +  + PVY +EL+P   RG L+   E+ I  G L+ FV N L    L G+   I 
Sbjct: 137  LAVGGASTVVPVYLAELAPLEIRGSLTGRNELAIVTGQLLAFVINALIAVTLHGVIDGI- 195

Query: 1233 WRLMLGL 1253
            WR+M  +
Sbjct: 196  WRIMFAV 202



>pir|S25009|S25009 monosaccharide transport protein STP4 - Arabidopsis
            thaliana>gb:AB025631_1516569 Arabidopsis thaliana genomic
            DNA, chromosome 3, P1 clone: MPN9.>gb:ATSTP4_1554180
            A.thaliana STP4 mRNA.>gb:AY133592_1581415 Arabidopsis
            thaliana AT3g19930/MPN9_17 mRNA, complete
            cds.>gb:AF367352_1791803 Arabidopsis thaliana
            AT3g19930/MPN9_17 mRNA, complete cds.>gb:AF428342_1799272
            Arabidopsis thaliana AT3g19930/MPN9_17 mRNA, complete
            cds.
          Length = 514

 Score = 80.1 bits (196), Expect = 9e-14
 Identities = 52/190 (27%), Positives = 85/190 (44%), Gaps = 19/190 (10%)
 Frame = +3

Query: 744  RLNKFAFLCAVFASTNSILLGYDLGVMSGAVL---FIKETF----KISSVQHEXXXXXXX 902
            +L    F+     +   ++ GYDLG+  G      F++E F    K     HE       
Sbjct: 18   KLTPKVFVTCFIGAFGGLIFGYDLGISGGVTSMEPFLEEFFPYVYKKMKSAHENEYCRFD 77

Query: 903  XXXXXXXXASGKTSDMI------------GRRYTIVLAAATFIIGALLMGLAPTYGYLLA 1046
                    +S   + ++            GR++++ L   TF IG+   G A     LL 
Sbjct: 78   SQLLTLFTSSLYVAALVSSLFASTITRVFGRKWSMFLGGFTFFIGSAFNGFAQNIAMLLI 137

Query: 1047 GRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPAN 1226
            GR++ G GVG++    PVY SE++P   RG  ++  +V I  GI++  + N   + +  N
Sbjct: 138  GRILLGFGVGFANQSVPVYLSEMAPPNLRGAFNNGFQVAIIFGIVVATIINYFTAQMKGN 197

Query: 1227 ISWRLMLGLS 1256
            I WR+ LGL+
Sbjct: 198  IGWRISLGLA 207



>pir|T14864|T14864 probable monosaccharide transport protein Mst-1 -
            Norway spruce>gb:PAMST1_1698759 P.abies mRNA for
            monosaccharide transporter Mst-1.
          Length = 513

 Score = 80.1 bits (196), Expect = 9e-14
 Identities = 62/209 (29%), Positives = 95/209 (45%), Gaps = 20/209 (9%)
 Frame = +3

Query: 690  MVESRPGGAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVL---FIKETFK 860
            M  SRP    G     +  +  +  L  + A+T   L GYDLGV  G      F+K+ F+
Sbjct: 5    MAVSRP--KQGRAELYEGHITAYVILACIVAATGGSLFGYDLGVSGGVTSMDDFLKKFFR 62

Query: 861  --ISSVQH---EXXXXXXXXXXXXXXXASGKTSDMI------------GRRYTIVLAAAT 989
                  QH   E               +S   S ++            GRR +I++   +
Sbjct: 63   HVYERKQHHLRETDYCKYDNQLLTLFTSSLYLSGLVATFGASYITRSKGRRVSIIIGGLS 122

Query: 990  FIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFIN 1169
            F++GA+L   A   G L+ GR++ G GVG+S    P+Y SE++PA  RG  ++L ++   
Sbjct: 123  FLLGAILNAAAKNLGMLIVGRILLGAGVGFSNQSVPLYLSEMAPAKVRGGTNNLFQLKTC 182

Query: 1170 VGILIGFVSNILLSGLPANISWRLMLGLS 1256
            +GI +  V N   + L     WRL LGL+
Sbjct: 183  LGIFVTNVINYFTNKLHP-WGWRLSLGLA 210



>gb:AE016941_362972 Bacteroides thetaiotaomicron VPI-5482, section 16
            of 21 of the complete genome.>gb:AE015928_989460
            Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 468

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 48/165 (29%), Positives = 80/165 (48%), Gaps = 5/165 (3%)
 Frame = +3

Query: 756  FAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASG 935
            +    +V A+    L GYD  V+SG +  +   F++ ++Q                  SG
Sbjct: 9    YIIFLSVVAALGGFLFGYDTAVISGTIAQVTHLFQLDTLQQGWYVGCALIGSIVGVLFSG 68

Query: 936  KTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSEL 1115
              SD IGR+ T++L+A  F   A+       +  L+  R++ GIG+G   +++P+Y SE+
Sbjct: 69   ILSDSIGRKRTMILSAILFSTSAIGCAFCIDFNQLVVYRIIGGIGIGVVSIVSPLYISEV 128

Query: 1116 SPAMTRGFLSSLPEVFINVGILIGFVSNILL-----SGLPANISW 1235
            S A  RG + SL ++ + VG L  ++ N  L     SG    I+W
Sbjct: 129  SVAQFRGRMVSLYQLAVTVGFLGAYLVNYQLLAYSESGNHLPIAW 173



>gb:AE016927_359804 Bacteroides thetaiotaomicron VPI-5482, section 2
            of 21 of the complete genome.>gb:AE015928_986292
            Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 468

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 44/165 (26%), Positives = 83/165 (50%), Gaps = 5/165 (3%)
 Frame = +3

Query: 756  FAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASG 935
            +    +V A+    L GYD  V+SG +  + + F++ ++Q                  +G
Sbjct: 9    YLIFLSVVAALGGFLFGYDTAVISGTIAQVTQLFQLDTLQQGWYVGCALIGSIVGVLFAG 68

Query: 936  KTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSEL 1115
              SD +GR+ T++++A  F   AL   ++  +  L+  R++ G+G+G   +++P+Y SE+
Sbjct: 69   ILSDKLGRKMTMIISATLFSTSALGCAISADFTQLVVYRIIGGVGIGVVSIVSPLYISEV 128

Query: 1116 SPAMTRGFLSSLPEVFINVGILIGFVSNILL-----SGLPANISW 1235
            + A  RG L SL ++ + VG L  ++ N  L     SG   ++ W
Sbjct: 129  AVAQYRGRLVSLYQLAVTVGFLGAYLINYQLLAYAESGNQLSMDW 173



>gb:AY465112_1607949 Pichia angusta hexose transporter-like GCR1
            (GCR1) gene, complete cds.
          Length = 541

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 48/157 (30%), Positives = 72/157 (45%), Gaps = 15/157 (9%)
 Frame = +3

Query: 759  AFLCAVFASTNSILLGYDLGVMSGAV---LFIKE------------TFKISSVQHEXXXX 893
            A+L   F +   IL GYD G +SG +    FI E            +F + S Q      
Sbjct: 26   AYLMCAFGAFGGILFGYDSGYISGVMGMDYFIHEFTGKVKHGDDDSSFVVGSSQKSLITS 85

Query: 894  XXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGV 1073
                        +G  +DM GRR  IV   + + +G  L   + T   L  GRV+AG+GV
Sbjct: 86   ILSAGTFFGAVCAGDLADMFGRRTIIVTGCSIYSVGVALQVASTTVALLSVGRVIAGVGV 145

Query: 1074 GYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILI 1184
            G+   +  +Y SE+SP   RG + S  + F+ +G+L+
Sbjct: 146  GFVSSVVVLYLSEISPKKIRGAIVSGYQFFVTIGLLL 182



>gb:AY081845_1569017 Aspergillus niger monosaccharide transporter
            (mstA) gene, complete cds.
          Length = 530

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 56/188 (29%), Positives = 86/188 (45%), Gaps = 25/188 (13%)
 Frame = +3

Query: 762  FLCAVFASTNSILLGYDLGVMSGAV---LFIKE------------TFKISSVQHEXXXXX 896
            +L   FA+   I  GYD G +SG +    FI+E            +F + S +       
Sbjct: 20   YLMCAFAAFGGIFFGYDSGYISGVMGMRYFIEEFEGLDYNTTPTDSFVLPSWKKSLITSI 79

Query: 897  XXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVG 1076
                       +G  +D  GRR TIV     FI+G +L   + + G L+AGR+VAG GVG
Sbjct: 80   LSAGTFFGALIAGDLADWFGRRTTIVSGCVVFIVGVILQTASTSLGLLVAGRLVAGFGVG 139

Query: 1077 YSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGF-----VSNILLSG-----LPAN 1226
            +   I  +Y SE++P   RG + S  +  I +G+++         N L SG     +   
Sbjct: 140  FVSAIIILYMSEIAPRKVRGAIVSGYQFCITIGLMLASCVDYGTENRLDSGSYRIPIGLQ 199

Query: 1227 ISWRLMLG 1250
            ++W L+LG
Sbjct: 200  LAWALILG 207



>gb:CR380947_1649020 Candida glabrata strain CBS138 chromosome A
            complete sequence.
          Length = 549

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 51/188 (27%), Positives = 90/188 (47%), Gaps = 15/188 (7%)
 Frame = +3

Query: 735  PKRRLNKFA--FLCAVFASTNSILLGYDLGVMSGAVL---FIKE--------TFKISSVQ 875
            PK+  + +   F+  +F +    + G+D G +SG V    FIK         T+ +S V+
Sbjct: 37   PKKPASAYTLIFILCLFIAFGGFVFGWDTGTISGFVAEEDFIKRLGQRRANNTYYLSKVR 96

Query: 876  HEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLM--GLAPTYGYLLAG 1049
                                K  DM GR+  +++    +I+G ++    +   Y Y + G
Sbjct: 97   TGLIVSIFNIGCAIGGVVLSKFGDMYGRKIGLIIVIVVYIVGIVIQIATIDKWYQYFI-G 155

Query: 1050 RVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANI 1229
            R+V+G+GVG   +++P+  SE+SP   RG L S  ++ +  GI +G+ +N      P ++
Sbjct: 156  RIVSGLGVGGIAVLSPMLISEVSPKHMRGTLVSCYQLMVTCGIFLGYCTNYGTKNYPNSV 215

Query: 1230 SWRLMLGL 1253
             WR+ LGL
Sbjct: 216  QWRVPLGL 223



>gb:AY663846_1620592 Vitis vinifera hexose transporter HT2 mRNA,
            complete cds.
          Length = 500

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 52/185 (28%), Positives = 86/185 (46%), Gaps = 21/185 (11%)
 Frame = +3

Query: 765  LCAVFASTNSILLGYDLGVMSGAVL---FIKETFKI----------------SSVQHEXX 887
            +  + A++  ++ GYD+G+  G      F+K+ F +                 S      
Sbjct: 25   ITCIVAASGGLIFGYDIGISGGVTTMQPFLKKFFPVVLRKAADAKTNIYCVYDSHVLTAF 84

Query: 888  XXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGI 1067
                          + + +  +GRR T+++   TF+IGA L G A     L+ GR++ G 
Sbjct: 85   TSSLYIAGLAASLVASRLTRAVGRRNTMIIGGLTFLIGAALNGGAENVAMLILGRILLGF 144

Query: 1068 GVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANIS--WRL 1241
            GVG++    P+Y SE++P   RG   +  + FI +G++   V+N L  G  A IS  WRL
Sbjct: 145  GVGFTNQATPIYLSEMAPPKWRGAFGTSFQFFIGIGVV---VANCLNYG-TAKISWGWRL 200

Query: 1242 MLGLS 1256
             LGL+
Sbjct: 201  SLGLA 205



>gb:AE017353_1760188 Cryptococcus neoformans var. neoformans JEC21
            chromosome 13, complete sequence.
          Length = 529

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 51/180 (28%), Positives = 76/180 (42%), Gaps = 11/180 (6%)
 Frame = +3

Query: 747  LNKFAFLCAVFASTNSILLGYDLGVMSGAV---LFIKE--------TFKISSVQHEXXXX 893
            L K A +   FAS +  L GYD G +SG      F++         T+ +SS +      
Sbjct: 3    LPKLAVILGAFASFSGFLFGYDTGYISGCKEMETFVRTFGLLQPDGTYVLSSGRDSLITS 62

Query: 894  XXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGV 1073
                             D IGRR+ IV     F IG  L            GRV AG+GV
Sbjct: 63   ILSVGTCLGALCGSMVGDRIGRRFGIVFYICLFFIGVALQTGCKNLAGFAIGRVFAGLGV 122

Query: 1074 GYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            G +  + P+Y +E SP   RGF+ +  + F+ VG+L+         G P N ++ + + +
Sbjct: 123  GGTSCLVPIYQAECSPKAIRGFVVAAYQFFVTVGLLVAACVVYATKGRPDNSAYEIPIAI 182



>gb:BT015814_1642432 Arabidopsis thaliana At1g05030 gene, complete
            cds.>gb:BT020194_1642589 Arabidopsis thaliana At1g05030
            mRNA, complete cds.
          Length = 524

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 57/197 (28%), Positives = 92/197 (46%), Gaps = 10/197 (5%)
 Frame = +3

Query: 687  TMVESRPGGAHG-SPHPPKRRLNKFAFLCAV----FASTNSILLGYDLGVMSGAVLFIKE 851
            T+   +P   H  SP PP++      +L A      AS  + L GY +GVM+G ++ I  
Sbjct: 50   TLSTKKPDDDHEISPVPPEKFSADLGWLSAFPHVSVASMANFLFGYHIGVMNGPIVSIAR 109

Query: 852  T--FKISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAP 1025
               F+ +S+                   +G   D  G R T  +     I+GAL+   A 
Sbjct: 110  ELGFEGNSILEGLVVSIFIAGAFIGSIVAGPLVDKFGYRRTFQIFTIPLILGALVSAQAH 169

Query: 1026 TYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNIL 1205
            +   +L GR + G+G+G + ++ P+Y SE++P   RG L +L      +G  +G + ++L
Sbjct: 170  SLDEILCGRFLVGLGIGVNTVLVPIYISEVAPTKYRGSLGTL----CQIGTCLGIIFSLL 225

Query: 1206 LSGLPANIS---WRLML 1247
            L G+PA      WR ML
Sbjct: 226  L-GIPAEDDPHWWRTML 241



>gb:AE017283_430272 Propionibacterium acnes KPA171202, complete
            genome.
          Length = 538

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 56/167 (33%), Positives = 78/167 (46%), Gaps = 5/167 (2%)
 Frame = +3

Query: 726  PHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKIS----SVQHEXXXX 893
            P  PKRR+     + A  A+  S+L GYD GV+SGA+ F+           +V HE    
Sbjct: 16   PAGPKRRMG----VVAAVATLGSLLFGYDTGVISGALPFMYLPHGAGGLALTVGHEGAIG 71

Query: 894  XXXXXXXXXXXA-SGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIG 1070
                          G  SD  GRR+ +++ A  F++GAL    AP+   +   RVV G  
Sbjct: 72   GTLTLGAAFGGLIGGMMSDRWGRRHNLLILAVLFVVGALGTAGAPSVWVMYPFRVVLGFA 131

Query: 1071 VGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLS 1211
            VG +    PVY SE SP   RG + +L +  I  G L+ F  N  +S
Sbjct: 132  VGAASATVPVYLSETSPKRMRGRIVALDQFMIVFGQLLAFSVNAAIS 178



>gb:OSJN00048_1693871 Oryza sativa genomic DNA, chromosome 4, BAC
            clone: OSJNBa0086B14, complete
            sequence.>gb:OSJN00140_1695553 Oryza sativa genomic DNA,
            chromosome 4, BAC clone: OSJNBa0027G07, complete
            sequence.
          Length = 520

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 48/179 (26%), Positives = 86/179 (48%), Gaps = 19/179 (10%)
 Frame = +3

Query: 780  ASTNSILLGYDLGVMSG--------AVLFIKETFKISSVQHE-----------XXXXXXX 902
            A++  ++ GYD+G+  G        A  F K   +++  + +                  
Sbjct: 32   AASGGLIFGYDIGISGGVSQMKPFLATFFPKVLMRMADAKRDQYCVFDSHALTAFTSSLY 91

Query: 903  XXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYS 1082
                    A+G+ +  +GRR  +++  A F  G  + G A     L+ GR++ G GVG++
Sbjct: 92   VAGLVASLAAGRVTRWLGRRGVMLMGGALFFAGGAMTGGAVNVAMLIVGRMLLGFGVGFT 151

Query: 1083 LMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLSG 1259
               AP+Y +E++P   RG L+   + F+++GILI  ++N   + +P    WRL LGL+G
Sbjct: 152  NQAAPLYLAEMAPPRFRGSLTVGFQFFLSLGILIANLTNYGTARVP--WGWRLSLGLAG 208



>gb:CR382135_1668012 Debaryomyces hansenii chromosome C of strain
            CBS767 of Debaryomyces hansenii.
          Length = 556

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 50/173 (28%), Positives = 87/173 (50%), Gaps = 3/173 (1%)
 Frame = +3

Query: 744  RLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFK---ISSVQHEXXXXXXXXXXX 914
            R +K   L  + +S +  + GYD G +S A++ I        +S+ + E           
Sbjct: 58   RPSKLIILITLTSSISGFMFGYDTGYISSALVNIGTDLSNKLLSNGEKEFITSATSLGAL 117

Query: 915  XXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIA 1094
                  G  +++IGR+  ++ +   F+IG ++   A T   ++ GR V G+GVG + +I+
Sbjct: 118  IGAIIGGILANLIGRKMVLLGSNVIFVIGTIIQLAAHTVWTMIVGRFVLGLGVGIASLIS 177

Query: 1095 PVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            P+  SEL+P+  RG L     +FI  G L+ +  N  L+G+  N  WR+ +GL
Sbjct: 178  PLMLSELAPSKYRGRLIVTNCMFITGGQLVAYFINWGLTGV--NNGWRVSVGL 228



>gb:CR382133_1666850 Debaryomyces hansenii chromosome A of strain
            CBS767 of Debaryomyces hansenii.
          Length = 497

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 39/105 (37%), Positives = 68/105 (64%)
 Frame = +3

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
            G  +D +GR+ T ++  + + +G++L GL+ +Y  LL GR +AG+G G +L+  P++ +E
Sbjct: 95   GSFADKLGRKKTSLIHCSIYFLGSMLNGLSNSYYMLLVGRFIAGLGAGAALVTTPIFINE 154

Query: 1113 LSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLML 1247
            ++P+  RGFL S+ +V +N+GIL  F   + L     N +WRL+L
Sbjct: 155  IAPSDYRGFLGSMNQVSVNIGIL--FTQLLALVWCDDN-NWRLLL 196



>gb:AMMST1_1819236 A.muscaria mRNA for monosaccharide transporter
            Mst-1.
          Length = 520

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 60/189 (31%), Positives = 85/189 (44%), Gaps = 22/189 (11%)
 Frame = +3

Query: 750  NKFAFLC-AVFASTNSILLGYDLGVMSGAVLF--IKETFKISSVQHEXXXXXXXXXXXXX 920
            NKF  +    F++   IL GYD G++SG +     K TF   +                 
Sbjct: 15   NKFTGIAMTAFSAFGGILYGYDTGIISGILAMDDFKRTFGQQASDGTCSLPLSSQSLFVS 74

Query: 921  XXASGK---------TSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGV 1073
              ++G            D+IGR++ IV+AAA F IG  L   + T    + GRV AG+GV
Sbjct: 75   ILSAGTFVGALFGAPMGDIIGRKWGIVIAAAIFSIGIALQTASVTAAPFVVGRVFAGLGV 134

Query: 1074 GYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSG--------LPANI 1229
            G    + P+Y SE SP   RG + SL +  I +GIL+  V N    G        +P +I
Sbjct: 135  GLVSCLVPMYQSECSPKWIRGAVVSLYQWAITIGILLAAVINNATQGRSNHSAYQIPISI 194

Query: 1230 S--WRLMLG 1250
               W  +LG
Sbjct: 195  QFVWAFILG 203



>gb:AJ698935_1813467 Populus tremula x Populus tremuloides mRNA for
            monosaccharide transporter (tMST3.1 gene), strain T 89.
          Length = 502

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 49/184 (26%), Positives = 85/184 (46%), Gaps = 20/184 (10%)
 Frame = +3

Query: 765  LCAVFASTNSILLGYDLGVMSGA-------VLFIKETFKISSVQHE------------XX 887
            +  + A+++ ++ GYD+G+  G        + F  E F+ +S                  
Sbjct: 25   ITCIVAASSGLIFGYDIGISGGVTTMAPFLIKFFPEVFRKASEAKTNMYCQFDSQVLTAF 84

Query: 888  XXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGI 1067
                          +G+ +  +GR+ T+V+   TF+ GA + G A     LL GR++ G 
Sbjct: 85   TSSLYIAGLASSLVAGRLTAAVGRKNTMVIGGCTFLAGAAINGGAANIAMLLLGRILLGF 144

Query: 1068 GVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANI-SWRLM 1244
            GVG++    PVY SE++P   RG  S+  + FI VG++    +N +  G+  +   WR  
Sbjct: 145  GVGFTNQATPVYLSEVAPPKWRGAFSTGFQFFIGVGVV---AANCINFGMAKHSWGWRFS 201

Query: 1245 LGLS 1256
            LGL+
Sbjct: 202  LGLA 205



>gb:AE017344_1755968 Cryptococcus neoformans var. neoformans JEC21
            chromosome 4, complete sequence.
          Length = 545

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 45/169 (26%), Positives = 84/169 (49%), Gaps = 3/169 (1%)
 Frame = +3

Query: 756  FAFLCAVFASTNSILLGYDLGVMSGAVLFIKETF--KISSVQHEXXXXXXXXXXXXXXXA 929
            F FL +V A+    L GYD G++  A+  +       +S+ + E                
Sbjct: 56   FMFLISV-AAIAGFLFGYDTGIVGAALPMVDTALGHTLSATESEIITAGTTIGAIFGASI 114

Query: 930  SGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTS 1109
             G  +D +GR++ +V++   F  GA+++  + +   ++ GR+V G+GVG + +IAP+Y +
Sbjct: 115  LGTMADKLGRKWAMVISDFAFTAGAIIIAASYSVPQIIVGRLVLGVGVGGAAVIAPLYIA 174

Query: 1110 ELSPAMTRGFLSSLPEVFINVG-ILIGFVSNILLSGLPANISWRLMLGL 1253
            EL+P   RG    +    I  G ++   +     +G+P +I WR++  L
Sbjct: 175  ELAPTAVRGRCVGVNAFCIPFGQVIASAIGAGFQAGVPYHIGWRVLFAL 223



>gb:AX172635_1463039 Sequence 125 from Patent WO0144476.
          Length = 173

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 41/131 (31%), Positives = 69/131 (52%), Gaps = 2/131 (1%)
 Frame = +3

Query: 780  ASTNSILLGYDLGVMSGAVLFIKET--FKISSVQHEXXXXXXXXXXXXXXXASGKTSDMI 953
            A   +IL GY LGV++GA+ +I +   F   +V+                   G  +D +
Sbjct: 43   ACLGAILFGYHLGVVNGALEYISKDLGFATDAVKQGWVVSSTLAGATVGSFTGGALADNL 102

Query: 954  GRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTR 1133
            GR+ T  + A   I+G LL   A ++  ++ GR++ G+G+G S  + P+Y SE+SP   R
Sbjct: 103  GRKRTFQINAVPLIVGTLLSAKATSFEAMVIGRILVGVGIGVSSGVVPLYISEVSPTEIR 162

Query: 1134 GFLSSLPEVFI 1166
            G + +L ++FI
Sbjct: 163  GTMGTLNQLFI 173



>gb:AL935262_553032 Lactobacillus plantarum strain WCFS1 complete
            genome; segment 11/11.
          Length = 488

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 52/174 (29%), Positives = 84/174 (48%), Gaps = 4/174 (2%)
 Frame = +3

Query: 741  RRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXX 920
            R LN  AF+    ++   +L G D GV++GA+ ++    +++   +              
Sbjct: 28   RNLNHIAFI----STLGGLLFGVDTGVINGAIGYMATPAELNLSPNNEGLVTSGITLGAA 83

Query: 921  XXA--SGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIA 1094
              A  +G  SD IGR+  +   A  F +  L   LAP   +++  RV+ G+ VG + +I 
Sbjct: 84   FGAVFAGHLSDRIGRKRLLKYLALLFFVCTLACSLAPNALFMIISRVLLGLAVGGASVIV 143

Query: 1095 PVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANIS--WRLMLG 1250
            P Y SE+S    RG L +  E+ I  G L+ F+ N +L     +IS  WR M+G
Sbjct: 144  PTYLSEISTPEIRGRLVTQNELMIVTGQLLAFIVNAILGNWFGHISNIWRYMIG 197



>pir|D96539|D96539 hypothetical protein F14I3.9 [imported] -
            Arabidopsis thaliana>gb:AE005173_892952 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC007980_1536382 Arabidopsis thaliana
            chromosome I BAC F14I3 genomic sequence, complete
            sequence.>gb:ATH344336_1552513 Arabidopsis thaliana mRNA
            for STP9 protein.
          Length = 517

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 53/203 (26%), Positives = 90/203 (44%), Gaps = 20/203 (9%)
 Frame = +3

Query: 708  GGAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVL---FIKETF-KISSVQ 875
            GG  G+ +  +  +  F  +  + A+   +L GYDLG+  G      F+ + F ++    
Sbjct: 10   GGGGGNSY--EGGVTVFVIMTCIVAAMGGLLFGYDLGISGGVTSMEEFLSKFFPEVDKQM 67

Query: 876  HEXX----------------XXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGAL 1007
            HE                                +   +   GR+ ++ +    F+IG+L
Sbjct: 68   HEARRETAYCKFDNQLLQLFTSSLYLAALASSFVASAVTRKYGRKISMFVGGVAFLIGSL 127

Query: 1008 LMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIG 1187
                A     L+ GR++ G+GVG++    PVY SE++PA  RG L+   ++ I +GILI 
Sbjct: 128  FNAFATNVAMLIVGRLLLGVGVGFANQSTPVYLSEMAPAKIRGALNIGFQMAITIGILIA 187

Query: 1188 FVSNILLSGLPANISWRLMLGLS 1256
             + N   S +  N  WR+ LGL+
Sbjct: 188  NLINYGTSQMAKN-GWRVSLGLA 209



>gb:SPAC4F8_1717962 S.pombe chromosome I cosmid c4F8.
          Length = 312

 Score = 77.4 bits (189), Expect = 6e-13
 Identities = 47/173 (27%), Positives = 88/173 (50%), Gaps = 3/173 (1%)
 Frame = +3

Query: 747  LNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETF---KISSVQHEXXXXXXXXXXXX 917
            ++K+ ++ A  A    +L GYD GV+SGA++ I  +    ++++   E            
Sbjct: 83   VSKWVWVLAFAAGIGGLLFGYDTGVISGALVVIGTSLGGHELTNGGKEFITSATSLGALL 142

Query: 918  XXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAP 1097
                +G  +D  GR+  I +A+   I+G+++   A    +++ GR V G GVG + +I P
Sbjct: 143  GGIIAGALADFFGRKPVIAIASIIIIVGSIVQVTAHHLWHMIVGRFVIGWGVGIASLIIP 202

Query: 1098 VYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            +Y SE++P+  RG L  +  + I  G +I +  +     +  +  WR M+GL+
Sbjct: 203  LYLSEIAPSKIRGRLVIIYVLLITAGQVIAYGIDTAFEHV--HNGWRWMVGLA 253



>gb:AY342321_1600826 Oryza sativa (japonica cultivar-group)
            monosaccharide transporter 4 (MST4) mRNA, complete cds.
          Length = 515

 Score = 77.4 bits (189), Expect = 6e-13
 Identities = 48/191 (25%), Positives = 87/191 (45%), Gaps = 19/191 (9%)
 Frame = +3

Query: 744  RLNKFAFLCAVFASTNSILLGYDLGVMSGAVL---FIKETFK-ISSVQHEXX-------- 887
            ++     +  + A+T  ++ GYD+G+  G      F++E F  +   +HE          
Sbjct: 17   KITPIVIISCIMAATGGLMFGYDVGISGGVTSMDDFLREFFPTVLKKKHEDKESNYCKYD 76

Query: 888  -------XXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLA 1046
                                 +  T+  +GRR T+++A   FI+G +  G A     L+ 
Sbjct: 77   NQGLQLFTSSLYLAGLTATFFASYTTRRLGRRLTMLIAGVFFIVGVIFNGAAQNLAMLIV 136

Query: 1047 GRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPAN 1226
            GR++ G GVG++    P++ SE++P   RG L+ L ++ + +GIL   + N   + +   
Sbjct: 137  GRILLGCGVGFANQAVPLFLSEIAPTRIRGGLNILFQLNVTIGILFANLVNYGTAKIHP- 195

Query: 1227 ISWRLMLGLSG 1259
              WRL L L+G
Sbjct: 196  WGWRLSLSLAG 206



>gb:ATAC013454_1543521 Arabidopsis thaliana chromosome III BAC F2O10
            genomic sequence, complete sequence.>gb:ATH344337_1552514
            Arabidopsis thaliana mRNA for STP6 protein.
          Length = 507

 Score = 77.4 bits (189), Expect = 6e-13
 Identities = 49/191 (25%), Positives = 85/191 (44%), Gaps = 19/191 (9%)
 Frame = +3

Query: 744  RLNKFAFLCAVFASTNSILLGYDLGVMSGAVL---FIKETF----------------KIS 866
            ++  + F+C + A+   ++ GYD+G+  G      F+KE F                K  
Sbjct: 16   KMTVYVFICVMIAAVGGLIFGYDIGISGGVSAMDDFLKEFFPAVWERKKHVHENNYCKYD 75

Query: 867  SVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLA 1046
            +   +                +  T   +GRR T+  A+  F+IG  L   A     L+ 
Sbjct: 76   NQFLQLFTSSLYLAALVASFVASATCSKLGRRPTMQFASIFFLIGVGLTAGAVNLVMLII 135

Query: 1047 GRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPAN 1226
            GR+  G GVG+     P++ SE++PA  RG L+ + ++ + +GILI  + N   + +   
Sbjct: 136  GRLFLGFGVGFGNQAVPLFLSEIAPAQLRGGLNIVFQLMVTIGILIANIVNYFTATVHP- 194

Query: 1227 ISWRLMLGLSG 1259
              WR+ LG +G
Sbjct: 195  YGWRIALGGAG 205



>gb:AE016959_1023831 Oryza sativa (japonica cultivar-group) chromosome
            10, complete sequence.>gb:AC079874_1732918 Oryza sativa
            chromosome 10 BAC OSJNBa0042H09 genomic sequence,
            complete sequence.>gb:AC079890_1733037 Oryza sativa
            chromosome 10 BAC OSJNBb0089A17 genomic sequence,
            complete sequence.>gb:AE017119_1753650 Oryza sativa
            (japonica cultivar-group) chromosome 10, section 73 of 77
            of the complete sequence.
          Length = 518

 Score = 77.4 bits (189), Expect = 6e-13
 Identities = 56/207 (27%), Positives = 90/207 (43%), Gaps = 19/207 (9%)
 Frame = +3

Query: 693  VESRPGGAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAV---LFIKETF-- 857
            VES  GG  G       R+  +  L  V A +  IL GYDLG+  G      F+K  F  
Sbjct: 7    VESGGGGGGGGGGGYGGRVTAYVVLTCVVAGSGGILFGYDLGISGGVTSMDSFLKRFFPD 66

Query: 858  -----KISSVQH---------EXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFI 995
                 + + V H                          +   +   GRR ++++    FI
Sbjct: 67   VYQKKQDTRVSHYCAFDSELLTVFTSSLYIAGLVATLFASSVTRRYGRRTSMLIGGTVFI 126

Query: 996  IGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVG 1175
             G++  G A     LL  R++ GIG+G++    P+Y SE++P   RG +++  E+ I++G
Sbjct: 127  AGSVFGGAAVNVFMLLINRILLGIGLGFTNQSIPLYLSEMAPPRYRGAINNGFELCISLG 186

Query: 1176 ILIGFVSNILLSGLPANISWRLMLGLS 1256
            IL   V N  +  + A   WR+ L ++
Sbjct: 187  ILFANVLNYCVVKITAGWGWRISLSMA 213



>gb:AL935262_553027 Lactobacillus plantarum strain WCFS1 complete
            genome; segment 11/11.
          Length = 470

 Score = 77.4 bits (189), Expect = 6e-13
 Identities = 49/170 (28%), Positives = 79/170 (46%), Gaps = 4/170 (2%)
 Frame = +3

Query: 756  FAFLCAVFASTNSILLGYDLGVMSGAVLF--IKETFKISSVQHEXXXXXXXXXXXXXXXA 929
            F +L    A+  S+L GYD G+++G++ F  +K    +++ Q                  
Sbjct: 17   FLWLATFIAAMGSLLFGYDTGIVNGSLEFMAVKGQLDLTAFQQGIVSSGLTLGAAFGAII 76

Query: 930  SGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTS 1109
             G  +D IGR+  + +    F +GAL    A     L+  R + G+ VG +    PVY +
Sbjct: 77   GGPFADKIGRKKILTILGIIFSVGALGCAFATNITILIVFRFILGLAVGSASANVPVYIA 136

Query: 1110 ELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANIS--WRLMLGL 1253
            E++P   RG + +  +V I  G  + F  N  L+ L A  +  WR MLGL
Sbjct: 137  EIAPTELRGKMVTTAQVMIVSGQFVAFGVNAALTPLGAQNAAIWRWMLGL 186



>sp|Q10286|ITR1_SCHPO Myo-inositol transporter 1.>pir|T43400|T43400
            myo-inositol transporter - fission yeast
            (Schizosaccharomyces pombe)>gb:SPITR1_1721897 S.pombe
            itr1 gene.
          Length = 575

 Score = 77.4 bits (189), Expect = 6e-13
 Identities = 47/173 (27%), Positives = 88/173 (50%), Gaps = 3/173 (1%)
 Frame = +3

Query: 747  LNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETF---KISSVQHEXXXXXXXXXXXX 917
            ++K+ ++ A  A    +L GYD GV+SGA++ I  +    ++++   E            
Sbjct: 83   VSKWVWVLAFAAGIGGLLFGYDTGVISGALVVIGTSLGGHELTNGGKEFITSATSLGALL 142

Query: 918  XXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAP 1097
                +G  +D  GR+  I +A+   I+G+++   A    +++ GR V G GVG + +I P
Sbjct: 143  GGIIAGALADFFGRKPVIAIASIIIIVGSIVQVTAHHLWHMIVGRFVIGWGVGIASLIIP 202

Query: 1098 VYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            +Y SE++P+  RG L  +  + I  G +I +  +     +  +  WR M+GL+
Sbjct: 203  LYLSEIAPSKIRGRLVIIYVLLITAGQVIAYGIDTAFEHV--HNGWRWMVGLA 253



>gb:AJ698937_1813469 Populus tremula x Populus tremuloides mRNA for
            monosaccharide transporter (tMST1.2 gene), strain T 89.
          Length = 514

 Score = 77.0 bits (188), Expect = 7e-13
 Identities = 53/191 (27%), Positives = 87/191 (45%), Gaps = 19/191 (9%)
 Frame = +3

Query: 744  RLNKFAFLCAVFASTNSILLGYDLGVMSGAVLF---IKETF----------------KIS 866
            R+     +C V A+   ++ GYD+GV  G       +K+ F                K  
Sbjct: 18   RITFNVIVCVVIAACGGLMFGYDIGVSGGVTAMDDVLKKFFYQVWERKQQAHENNYCKYD 77

Query: 867  SVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLA 1046
            + + +                + KT    GR+ T+ LA+  FI G  L   A     L+ 
Sbjct: 78   NKKLQLFTSSLYIAALIASFLASKTCSKFGRKPTMQLASLFFIGGVALTTFAVNIEMLII 137

Query: 1047 GRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPAN 1226
            GR++ G GVG++    P++ SEL+PA  RG L+   ++FI +GILI  + N ++ G    
Sbjct: 138  GRLLLGCGVGFANQAVPLFLSELAPAKIRGALNISFQLFITIGILIANIVNYVV-GKIHP 196

Query: 1227 ISWRLMLGLSG 1259
              +R+ LG++G
Sbjct: 197  YGFRISLGIAG 207



>gb:AE017342_1754926 Cryptococcus neoformans var. neoformans JEC21
            chromosome 2, complete sequence.
          Length = 552

 Score = 77.0 bits (188), Expect = 7e-13
 Identities = 55/185 (29%), Positives = 81/185 (43%), Gaps = 25/185 (13%)
 Frame = +3

Query: 705  PGG-----AHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAV---LFI----- 845
            PGG     A  SP   +  +   A+L  VFAS   I  G+D G M+G +    FI     
Sbjct: 2    PGGPGVLSAPLSPERVEAPVTVKAYLLCVFASFGGIFFGFDSGYMNGVLGMNYFINMMTG 61

Query: 846  ------------KETFKISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAAT 989
                        K+ F + + +                  +G  +D  GRR TIV     
Sbjct: 62   LPIPGADADQATKDAFTLPAWEKSLITSILSAGTFFGAIIAGDLADYFGRRITIVSGCCV 121

Query: 990  FIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFIN 1169
            FI+G  L   +   G L+AGR++AG GVG+   I  +Y SE++P   RG + S  +  I 
Sbjct: 122  FIVGCCLQTASTGLGLLVAGRLIAGFGVGFISAIIILYMSEIAPRKVRGAIVSGYQFCIT 181

Query: 1170 VGILI 1184
            +G+L+
Sbjct: 182  IGLLL 186



>gb:CR382123_1656010 Kluyveromyces lactis strain NRRL Y-1140
            chromosome C of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 569

 Score = 77.0 bits (188), Expect = 7e-13
 Identities = 44/175 (25%), Positives = 88/175 (50%), Gaps = 3/175 (1%)
 Frame = +3

Query: 741  RRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQH---EXXXXXXXXXX 911
            ++++ F  +    AS +  + GYD G +S A++ I       ++ +   E          
Sbjct: 55   QKISPFILILTFTASISGFMFGYDTGYISSALVSIGTDLDNKALTYGDKEIITAATSLGA 114

Query: 912  XXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMI 1091
                  +G ++D+ GR+  ++ +   F+IGA L   A ++  +  GR++ G GVG   ++
Sbjct: 115  LISAVFAGISADIFGRKPCLMFSNILFVIGAALQVSAHSFWQMAVGRLIMGFGVGIGSLL 174

Query: 1092 APVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            AP++ SE++P   RG L+ +  +++  G LI +     L+    +  WR+++GLS
Sbjct: 175  APLFISEIAPKHIRGRLTVINSLWLTGGQLIAYACGAGLN--KVHNGWRILVGLS 227



>gb:AE016860_350797 Pseudomonas syringae pv. tomato str. DC3000
            section 5 of 21 of the complete
            genome.>gb:AE016853_1035972 Pseudomonas syringae pv.
            tomato str. DC3000 complete genome.
          Length = 473

 Score = 77.0 bits (188), Expect = 7e-13
 Identities = 49/175 (28%), Positives = 85/175 (48%), Gaps = 6/175 (3%)
 Frame = +3

Query: 750  NKFAFLCAVFASTNSILLGYDLGVMSGAVLFI-----KETFKISSVQHEXXXXXXXXXXX 914
            N+  F+  + A+  ++  GYD G+++GA+ F+     +    +++               
Sbjct: 21   NRLIFISVLVATMGALAFGYDTGIIAGALPFMTLPADQGGLGLNAYSEGMITASLIVGAA 80

Query: 915  XXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIA 1094
                ASG  SD  GRR T+ L +  FI GAL   +AP+  +++A R + GI VG      
Sbjct: 81   FGSLASGYISDRFGRRLTLRLLSVLFIAGALGTAIAPSIPFMVAARFLLGIAVGGGSATV 140

Query: 1095 PVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANIS-WRLMLGLS 1256
            PV+ +E++    R  L S  E+ I  G L+ +V + +++ L      WR ML ++
Sbjct: 141  PVFIAEIAGPSRRARLVSRNELMIVSGQLLAYVLSAVMAALLHTPGIWRYMLAIA 195



>gb:AF061106_1765165 Petunia x hybrida putative monosaccharide
            transporter 1 (pmt1) mRNA, complete cds.
          Length = 510

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 47/192 (24%), Positives = 87/192 (45%), Gaps = 21/192 (10%)
 Frame = +3

Query: 744  RLNKFAFLCAVFASTNSILLGYDLGVMSGA-------------VLFIKETFKISSVQH-- 878
            ++  F  +  + A+T  +L GYD+G+  G              V   ++  K    Q+  
Sbjct: 17   KVTTFGIMTCLVAATGGLLFGYDIGISGGVTSMDEFLLKFFPNVYHKEKALKAGGNQYCK 76

Query: 879  ------EXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYL 1040
                  +               A+  T+   GR+ ++++    F++GA+L G A     L
Sbjct: 77   FDDHLLQLFTSSLYLAALVASFAASITTKAFGRKISMLIGGLIFLVGAVLNGAAMNLAAL 136

Query: 1041 LAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLP 1220
            + GR++ G+G+GY+    PVY SE++P   RG L+   ++ + +GI +  + N   S + 
Sbjct: 137  IIGRLLLGVGIGYANQSVPVYLSEMAPPKLRGALNVCFQMAVTLGIFVANMVNYGTSSMK 196

Query: 1221 ANISWRLMLGLS 1256
             N  WR+ L L+
Sbjct: 197  KN-GWRVSLVLA 207



>gb:AE016819_1749178 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome VI, complete sequence.
          Length = 571

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 43/169 (25%), Positives = 82/169 (48%), Gaps = 2/169 (1%)
 Frame = +3

Query: 756  FAFLCAVFASTNSILLGYDLGVMSGAVLFIKETF--KISSVQHEXXXXXXXXXXXXXXXA 929
            F  +    AS +  L GYD G +S A+  +      +++    E                
Sbjct: 65   FIVMLTFVASLSGFLFGYDTGYISSALQSVGTDLGHQLTYRDKEYITSATSLGALIAALG 124

Query: 930  SGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTS 1109
            +G  +D+ GRR  I+ +   F++G +L   A  +  ++ GR+V G G+G+  +I+P++ S
Sbjct: 125  AGICADLFGRRKCIMFSNILFVVGTVLQVAAFNFWQMVVGRLVMGFGIGFGSLISPLFIS 184

Query: 1110 ELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGLS 1256
            E++P M RG L+ +  +++  G LI +        +     WR+++G+S
Sbjct: 185  EIAPKMIRGRLTVINSLWLTGGQLIAYACGAGFQHV--KHGWRILVGIS 231



>gb:TACID1_196027 Thermoplasma acidophilum complete genome; segment
            1/5.
          Length = 485

 Score = 76.6 bits (187), Expect = 1e-12
 Identities = 53/177 (29%), Positives = 79/177 (44%), Gaps = 6/177 (3%)
 Frame = +3

Query: 744  RLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISS--VQHEXXXXXXXXXXXX 917
            R+ +F +L  + A+    L GYD   +  A+  ++  +   S  V+              
Sbjct: 18   RVTRFYWLLTILATIGGFLFGYDTSNIGSALPLLERIYPGISGFVEGYLVAGASLGAAVG 77

Query: 918  XXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAP 1097
               A+G T D  GR+Y ++  AA +  GALL         LL  R + GI VG    IA 
Sbjct: 78   AIIAAGLT-DRYGRKYLLIADAAIYAAGALLSAFTVDLVMLLLSRTLIGIAVGADSGIAT 136

Query: 1098 VYTSELSPAMTRGFLSSLPEVFINVGI----LIGFVSNILLSGLPANISWRLMLGLS 1256
             Y +E +P   RG L  L +  I +GI    LIG  +     GL   + WR+MLG++
Sbjct: 137  AYIAEYAPKARRGSLGILQQWMITIGILAAYLIGMATLFFAPGLAYAVGWRIMLGVA 193



>gb:AP005195_1849246 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC clone:P0567H04.
          Length = 530

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 50/201 (24%), Positives = 85/201 (42%), Gaps = 22/201 (10%)
 Frame = +3

Query: 720  GSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGA-------VLFIKETF------- 857
            G  +P K  L  F     + A+T  ++ GYD+G+  G        + F    +       
Sbjct: 12   GKDYPGK--LTMFVLFACIVAATGGLIFGYDIGISGGVTSMNPFLIKFFPSVYRKEQAAE 69

Query: 858  --------KISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLM 1013
                    K  S                    +   + + GR++++     TF++GA L 
Sbjct: 70   KNQSNQYCKFDSPLLTMFTSSLYLAALVASFFASTVTRVAGRKWSMFGGGVTFLVGAALN 129

Query: 1014 GLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFV 1193
            G A     L+ GRV+ G+GVG++    P+Y SE++PA  RG L+   ++ I +GIL   +
Sbjct: 130  GAAKNVLMLILGRVLLGVGVGFANQSVPLYLSEMAPARLRGMLNIGFQLMITIGILCANL 189

Query: 1194 SNILLSGLPANISWRLMLGLS 1256
             N   + +     WR+ L L+
Sbjct: 190  INYGTAKIKGGWGWRVSLALA 210



>gb:CR382121_1654402 Kluyveromyces lactis strain NRRL Y-1140
            chromosome A of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 677

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 49/169 (28%), Positives = 81/169 (47%), Gaps = 7/169 (4%)
 Frame = +3

Query: 762  FLCAVFASTNSILLGYDLGVMSGAVL--FIKETFKI-SSVQHEXXXXXXXXXXXXXXXAS 932
            +  ++F S    L GYD GVMSG +   + K  F   ++                     
Sbjct: 117  YFTSIFVSLGVFLFGYDQGVMSGIITGPYFKTYFNNPTAATIGTMVSILEIGALVSSLLV 176

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
                +  GRR+TI   +  FI+G L+   +   G+++ GR+++GIGVG    I P+Y SE
Sbjct: 177  SNIGEKFGRRFTIKYGSLIFILGGLVQTFSWEMGHMIFGRIISGIGVGLLSTIVPIYQSE 236

Query: 1113 LSPAMTRGFLSSLPEVFINVGILIGFVSNILL----SGLPANISWRLML 1247
            +SP   RG L+ +       G ++G+ S++ +    S + ++ SWRL L
Sbjct: 237  ISPPHNRGKLACIE----FTGNIVGYASSVWVDYACSYIESDTSWRLPL 281



>gb:AY347871_1601402 Debaryomyces hansenii Xylhp gene, partial cds.
          Length = 525

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 49/140 (35%), Positives = 65/140 (46%), Gaps = 5/140 (3%)
 Frame = +3

Query: 795  ILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTS-----DMIGR 959
            +L GYD GV+SG V       K   +  +                 G        D  GR
Sbjct: 3    LLFGYDTGVISGIVTMESFAAKFPRIYMDPDYKGWFVSTFLLCAWFGSLINSPIVDKFGR 62

Query: 960  RYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGF 1139
            R TI +A   F+IG++      +   L AGR VAGIGVG   M+ P+Y SEL+P   RG 
Sbjct: 63   RDTIRIACVVFVIGSVFQCAGISVSMLFAGRAVAGIGVGQLTMVVPMYMSELAPPSVRGG 122

Query: 1140 LSSLPEVFINVGILIGFVSN 1199
            L  + ++ I +GILI F  N
Sbjct: 123  LVVIQQLSITIGILISFWIN 142



>gb:AY342322_1600827 Oryza sativa (japonica cultivar-group)
            monosaccharide transporter 6 (MST6) mRNA, complete cds.
          Length = 529

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 50/201 (24%), Positives = 85/201 (42%), Gaps = 22/201 (10%)
 Frame = +3

Query: 720  GSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGA-------VLFIKETF------- 857
            G  +P K  L  F     + A+T  ++ GYD+G+  G        + F    +       
Sbjct: 12   GKDYPGK--LTMFVLFACIVAATGGLIFGYDIGISGGVTSMNPFLIKFFPSVYRKEQAAE 69

Query: 858  --------KISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLM 1013
                    K  S                    +   + + GR++++     TF++GA L 
Sbjct: 70   KNQSNQYCKFDSPLLTMFTSSLYLAALVASFFASTVTRVAGRKWSMFGGGVTFLVGAALN 129

Query: 1014 GLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFV 1193
            G A     L+ GRV+ G+GVG++    P+Y SE++PA  RG L+   ++ I +GIL   +
Sbjct: 130  GAAKNVLMLILGRVLLGVGVGFANQSVPLYLSEMAPARLRGMLNIGFQLMITIGILCANL 189

Query: 1194 SNILLSGLPANISWRLMLGLS 1256
             N   + +     WR+ L L+
Sbjct: 190  INYGTAKIKGGWGWRVSLALA 210



>sp|P32465|HXT1_YEAST Low-affinity glucose transporter
            HXT1.>pir|S38798|S38798 hexose transport protein HXT1 -
            yeast (Saccharomyces cerevisiae)>gb:YSCH9332_1729196
            Saccharomyces cerevisiae chromosome VIII cosmid
            9332.>gb:YSCHEXTRA_1729306 Saccharomyces cerevisiae
            hexose transporter (HXT1) gene, complete cds.
          Length = 570

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 53/215 (24%), Positives = 99/215 (46%), Gaps = 13/215 (6%)
 Frame = +3

Query: 648  IDSAKGRTEPMEITMVESRPGGAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMS 827
            +++ +G+ E     + ES+   A   P+  K  +     +C V  +    + G+D G +S
Sbjct: 29   MNTPEGKNESFHDNLSESQVQPAVAPPNTGKG-VYVTVSICCVMVAFGGFIFGWDTGTIS 87

Query: 828  GAVL---FIKE--------TFKISSVQHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIV 974
            G V    F++         +  +S V+                    K  DM GRR  ++
Sbjct: 88   GFVAQTDFLRRFGMKHHDGSHYLSKVRTGLIVSIFNIGCAIGGIVLAKLGDMYGRRIGLI 147

Query: 975  LAAATFIIGALLM--GLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSS 1148
            +    + IG ++    +   Y Y + GR+++G+GVG   +++P+  SE++P+  RG L S
Sbjct: 148  VVVVIYTIGIIIQIASINKWYQYFI-GRIISGLGVGGITVLSPMLISEVAPSEMRGTLVS 206

Query: 1149 LPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
              +V I +GI +G+ +N        ++ WR+ LGL
Sbjct: 207  CYQVMITLGIFLGYCTNFGTKNYSNSVQWRVPLGL 241



>sp|P49374|HGT1_KLULA High-affinity glucose
            transporter.>gb:CR382121_1654745 Kluyveromyces lactis
            strain NRRL Y-1140 chromosome A of strain NRRL Y-1140 of
            Kluyveromyces lactis.>gb:KLU22525_1683690 Kluyveromyces
            lactis high affinity glucose transporter (HGT1) gene,
            complete cds.
          Length = 551

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 47/169 (27%), Positives = 80/169 (47%), Gaps = 7/169 (4%)
 Frame = +3

Query: 762  FLCAVFASTNSILLGYDLGVMS---GAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXAS 932
            ++    A  + ++ G+D+  MS   G  ++        S+ +                 S
Sbjct: 29   YVIGFIACISGLMFGFDIASMSSMIGTDVYKDYFSNPDSLTYGGITASMAGGSFLGSLIS 88

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
               SD  GR+ ++ + AA +IIGA+L   A     L+ GRV++G+G+G+    APVY SE
Sbjct: 89   PNFSDAFGRKVSLHICAALWIIGAILQCAAQDQAMLIVGRVISGMGIGFGSSAAPVYCSE 148

Query: 1113 LSPAMTRGFLSSLPEVFINVGIL----IGFVSNILLSGLPANISWRLML 1247
            +SP   RG +S L +  + VGI+    IG+  + +       I+W L +
Sbjct: 149  ISPPKIRGTISGLFQFSVTVGIMVLFYIGYGCHFIDGAAAFRITWGLQM 197



>gb:AP005116_1848147 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC
            clone:P0703B01.>gb:AP005699_1856279 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, BAC
            clone:OSJNBb0046L23.
          Length = 518

 Score = 75.9 bits (185), Expect = 2e-12
 Identities = 53/176 (30%), Positives = 81/176 (46%), Gaps = 19/176 (10%)
 Frame = +3

Query: 780  ASTNSILLGYDLGVMSGAVL---FIKETF-----KISSVQHEXX-----------XXXXX 902
            A    +LLGYD+GV  G      F++  F     K+SS + +                  
Sbjct: 35   AGAVGLLLGYDIGVTGGLTQMESFLQAFFPEVLRKMSSAKQDAYCIFDSQVLNAFVSSFY 94

Query: 903  XXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYS 1082
                     +G  +  +GRR ++++A   F  G LL   A     L+ GR++ G+ VG+S
Sbjct: 95   LSTMVASLVAGHLTKTLGRRNSLLIAGVLFFAGTLLNLAAVNISMLIIGRILLGVAVGFS 154

Query: 1083 LMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLG 1250
             + APVY +E+SPA  RG  +S   +F N G L+  + N   + + A   WRL LG
Sbjct: 155  SLAAPVYLAEISPARWRGAFTSSIGLFANFGFLMADMINYRATTM-ARWGWRLSLG 209



>gb:CR382134_1667663 Debaryomyces hansenii chromosome B of strain
            CBS767 of Debaryomyces hansenii.
          Length = 514

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 56/174 (32%), Positives = 79/174 (45%), Gaps = 8/174 (4%)
 Frame = +3

Query: 756  FAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASG 935
            + FL   FAS  S   GYDLG++  A +   E+F                        +G
Sbjct: 8    YQFLVCCFASVGSFTYGYDLGII--AQVIASESFTEYMNYPNTTVTGLIVSLFTVGAFAG 65

Query: 936  KTS----DMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVY 1103
                   + + RR TI+LA   F+ G  L   A  + +L AGR  AG+GVG   MI P+Y
Sbjct: 66   ALLAGFLEKLSRRQTILLATIFFLFGGALQCGAQNFRFLFAGRFFAGVGVGLYTMIIPLY 125

Query: 1104 TSELSPAMTRGFLSSLPEVFINVGIL----IGFVSNILLSGLPANISWRLMLGL 1253
             +EL     RG ++SL + F+ +G L    IG+   I   G   +  WR+ LGL
Sbjct: 126  QAELVHPKHRGRVTSLQQFFLGIGALSAAWIGYGCYI---GFEDDRQWRVPLGL 176



>gb:AY740034_1626167 Saccharomyces mikatae IFO 1815 SIC1 gene, partial
            cds; and EMP46, GAL2, and SRL2 genes, complete cds.
          Length = 573

 Score = 75.5 bits (184), Expect = 2e-12
 Identities = 56/230 (24%), Positives = 105/230 (45%), Gaps = 19/230 (8%)
 Frame = +3

Query: 621  LDS*NMDSGIDSAKGRTEPMEITMVESRPGGAHGSPHP-PKRRLNKFAF-----LCAVFA 782
            + S + DS + +   +    E+   E+ P G+   P   PK+ ++++       LC  F 
Sbjct: 22   VSSFSKDSHLSAQSQKYSNDELKAGEANPEGSESVPMEIPKKPMSEYVTVSLLCLCVAFG 81

Query: 783  STNSILLGYDLGVMSGAVL---FIKE--------TFKISSVQHEXXXXXXXXXXXXXXXA 929
                 + G+D G +SG V    F++         T  +S+V+                  
Sbjct: 82   G---FMFGWDTGTISGFVAQTDFLRRFGMKHKDGTHYLSNVRTGLIVAIFNIGCAFGGII 138

Query: 930  SGKTSDMIGRRYTIVLAAATFIIGALLM--GLAPTYGYLLAGRVVAGIGVGYSLMIAPVY 1103
              K  DM GR+  + +  + +I+G ++    +   Y Y + GR+++G+GVG   +++P+ 
Sbjct: 139  LSKAGDMYGRKKGLSIVVSVYIVGIIIQIASINKWYQYFI-GRIISGLGVGGIAVLSPML 197

Query: 1104 TSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
             SE++P   RG L S  ++ I  GI +G+ +N        ++ WR+ LGL
Sbjct: 198  ISEIAPKHLRGTLVSCYQLMITAGIFLGYCTNYGTKNYSNSVQWRVPLGL 247



>gb:AC120986_1740003 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OJ1781_H11, complete sequence.
          Length = 501

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 50/178 (28%), Positives = 81/178 (45%)
 Frame = +3

Query: 711  GAHGSPHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXX 890
            GA  S     R  +  AFLC +  +   I  G+  G  S     I     ++  +     
Sbjct: 46   GAGTSSMAILRESHVSAFLCTLIVALGPIQFGFTGGFSSPTQDAIIRDLDLTLSEFSVFG 105

Query: 891  XXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIG 1070
                        ASG+ ++ IGR+ ++++AA   IIG L +  A    +L  GR++ G G
Sbjct: 106  SLSNVGAMVGAIASGQMAEYIGRKGSLMIAAIPNIIGWLAISFAKDSSFLYMGRLLEGFG 165

Query: 1071 VGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLM 1244
            VG      PVY +E+SP   RG L S+ ++ + VGIL+ ++  +        + WRL+
Sbjct: 166  VGVISYTVPVYIAEISPQNMRGALGSVNQLSVTVGILLAYLLGMF-------VPWRLL 216



>gb:CR382132_1665743 Yarrowia lipolytica chromosome F of strain CLIB99
            of Yarrowia lipolytica.
          Length = 533

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 51/167 (30%), Positives = 80/167 (47%), Gaps = 12/167 (7%)
 Frame = +3

Query: 726  PHPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVL---FIKE--------TFKISSV 872
            P P K+       LC +FA+    + GYD G +SG +    F++          F +S +
Sbjct: 24   PEPAKKSQLLVILLC-LFAAMGGFVFGYDTGTISGFINMDPFLESFGEADESGVFFLSRI 82

Query: 873  QHEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLA-G 1049
            +                   G  +D +GR+  IV  A  +I+G L+   A T  Y +A G
Sbjct: 83   RAGLIVGLFSIGAFLGTLLGGFLADKVGRKKGIVYVAMVYIVGMLIQITAFTAWYQIAIG 142

Query: 1050 RVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGF 1190
            RV+ G+G+G   ++ P++ SE +P   RG L S  ++FI +GI IGF
Sbjct: 143  RVIGGVGIGALSVLVPMFQSETAPQNLRGALVSSFQLFITLGIFIGF 189



>gb:CR380947_1649064 Candida glabrata strain CBS138 chromosome A
            complete sequence.
          Length = 533

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 50/188 (26%), Positives = 86/188 (45%), Gaps = 13/188 (6%)
 Frame = +3

Query: 729  HPPKRRLNKFAFLCAVFASTNSILLGYDLGVMSGAVL---FIKE--------TFKISSVQ 875
            H  K+    F  LC +  +    + G+D G +SG V    F++         T+ +S+V+
Sbjct: 18   HHKKKSDLIFVSLCCIMVAFGGFVFGWDTGTISGFVNQTDFLRRFGQQRSDGTYYLSNVR 77

Query: 876  HEXXXXXXXXXXXXXXXASGKTSDMIGRRYTIVLAAATFIIGALLM--GLAPTYGYLLAG 1049
                                K  D+ GRR  +V     + IG ++    +   Y Y + G
Sbjct: 78   TGLIVAIFNIGCAIGGITLSKLGDIWGRRLGLVTVVVVYTIGIVIQIASIDKWYQYFI-G 136

Query: 1050 RVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANI 1229
            R+++G+GVG   +++P+  SE+SP   RG L S  ++ I  GI +G+ +N        ++
Sbjct: 137  RIISGLGVGGIAVLSPMLISEVSPKQLRGTLVSCYQLMITCGIFLGYCTNYGTKNYSNSV 196

Query: 1230 SWRLMLGL 1253
             WR+ LGL
Sbjct: 197  QWRVPLGL 204



>gb:ATH344335_1552512 Arabidopsis thaliana mRNA for STP5
            protein.>gb:BT005898_1638820 Arabidopsis thaliana
            At1g34580 gene, complete cds.>gb:AK118511_1816484
            Arabidopsis thaliana At1g34580 mRNA for putative
            monosaccharide transporter, complete cds, clone:
            RAFL19-74-G05.
          Length = 506

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 47/184 (25%), Positives = 89/184 (48%), Gaps = 20/184 (10%)
 Frame = +3

Query: 765  LCAVFASTNSILLGYDLGVMSGAVLF-----------IKETFKISSVQHEXXXXXXXXXX 911
            +  + A++  ++ GYD+G+  G               +K+  +  +  +           
Sbjct: 26   MSCIVAASCGLIFGYDIGISGGVTTMKPFLEKFFPSVLKKASEAKTNVYCVYDSQLLTAF 85

Query: 912  XXXXXASGKTSDMI--------GRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGI 1067
                  +G  + ++        GRR T++L   TF+ GAL+ GLA     L++GR++ G 
Sbjct: 86   TSSLYVAGLVASLVASRLTAAYGRRTTMILGGFTFLFGALINGLAANIAMLISGRILLGF 145

Query: 1068 GVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANIS-WRLM 1244
            GVG++   APVY SE++P   RG  +     FI++G++    +N++  G  ++ + WR+ 
Sbjct: 146  GVGFTNQAAPVYLSEVAPPRWRGAFNIGFSCFISMGVV---AANLINYGTDSHRNGWRIS 202

Query: 1245 LGLS 1256
            LGL+
Sbjct: 203  LGLA 206



>gb:BA000011_665808 Thermoplasma volcanium GSS1 DNA, complete genome.
          Length = 500

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 50/175 (28%), Positives = 80/175 (45%), Gaps = 4/175 (2%)
 Frame = +3

Query: 744  RLNKFAFLCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXX 923
            ++ +F +L  + A+    L GYD   +  A++FI    +   ++                
Sbjct: 34   KVTRFYWLLTLLATIGGFLFGYDTSNIGTALVFIPYPVQ-GFIEGYLVAGASLGAAVGAL 92

Query: 924  XASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVY 1103
             A+G T D  GR+Y ++  AA +  GA+L         LL  R + G+ VG    IA  Y
Sbjct: 93   IAAGLT-DRYGRKYLLIADAAIYAAGAILSAFTIDLAMLLLSRTLIGLAVGADSGIATAY 151

Query: 1104 TSELSPAMTRGFLSSLPEVFINVGIL----IGFVSNILLSGLPANISWRLMLGLS 1256
             SE +P   RG L  L +  I +GIL    +G  +     GL + + WR+MLG++
Sbjct: 152  ISEYAPKDRRGSLGILQQWMITIGILGAYIVGMATLYAAPGLASVLDWRIMLGVA 206



>gb:AE017333_446514 Bacillus licheniformis DSM 13, complete
            genome.>gb:CP000002_856327 Bacillus licheniformis ATCC
            14580, complete genome.
          Length = 473

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 50/175 (28%), Positives = 83/175 (47%), Gaps = 6/175 (3%)
 Frame = +3

Query: 750  NKFAFLCAVF--ASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXX 923
            N+ +FL  +   ++   +L GYD GV++GA+ ++ E  +++                   
Sbjct: 6    NQKSFLRTIILVSTFGGLLFGYDTGVINGALPYMSEGDQLNLTAFTEGLVASSLLLGAAL 65

Query: 924  XA--SGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAP 1097
             A   G+ SD IGRR  I+  A  F    L   LAP    ++  R + G+ VG + +  P
Sbjct: 66   GAVFGGRLSDYIGRRKNIIFLAVLFFFSTLGCTLAPDVTVMVISRFLLGVAVGGASVTVP 125

Query: 1098 VYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANIS--WRLMLGLS 1256
             Y +E+SP+  RG + +  E+ I  G L+ F  N +L     + S  WR ML ++
Sbjct: 126  TYLAEMSPSEKRGRMVTQNELMIVSGQLLAFTFNAILGTTMGDSSHVWRYMLAIA 180



>gb:AE016822_340667 Leifsonia xyli subsp. xyli str. CTCB07, complete
            genome.
          Length = 470

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 49/161 (30%), Positives = 79/161 (49%), Gaps = 3/161 (1%)
 Frame = +3

Query: 774  VFASTNSILLGYDLGVMSGAVLFIK-ETFKISSVQHEXXXXXXXXXXXXXXXASGKTSDM 950
            V ++   +L GYD GV+SGA+ F++ E   +S  +                   G+ +D 
Sbjct: 32   VLSTFGGLLFGYDTGVISGALPFMRFEGVALSPFEEGVVVSSLLFGAAAGSLVGGRIADR 91

Query: 951  IGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPAMT 1130
             GRR  ++  A  F   AL    AP+   ++A RV+ GI VG + +  P++ +E+SPA  
Sbjct: 92   SGRRRLLIGLAIVFFAAALGCTFAPSIAVMVAARVLLGIAVGAASVAVPLFLTEVSPAQR 151

Query: 1131 RGFLSSLPEVFINVGILIGFVSN-ILLSGLPANIS-WRLML 1247
            RG + +  E+ I  G L  F  N  + + +P +   WR ML
Sbjct: 152  RGQIVTHNELMIVSGQLAAFTVNAAIAAAVPEHAEVWRWML 192



>gb:AE008907_246011 Salmonella typhimurium LT2, section 211 of 220 of
            the complete genome.>gb:AE006468_1003093 Salmonella
            typhimurium LT2, complete genome.
          Length = 477

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 45/162 (27%), Positives = 84/162 (51%)
 Frame = +3

Query: 765  LCAVFASTNSILLGYDLGVMSGAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXASGKTS 944
            +CA+ A+   IL GYD  V+SGA+  +   F +S  +                 ++G  S
Sbjct: 16   ICAI-AALGGILFGYDTAVISGAIGSLTSYFHLSPAETGWAVSCVVVGCVIGSFSAGYLS 74

Query: 945  DMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSELSPA 1124
               GR+ +++++A  F I A+   L+ T+ + +  R++ G+ VG +  ++P+Y SE+SP 
Sbjct: 75   KRFGRKKSLMVSALLFTISAVGTSLSYTFTHFVIYRIIGGLAVGLAATVSPMYMSEVSPK 134

Query: 1125 MTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLG 1250
              RG   S+ +  I  G ++ F  N  ++ + A+ +W + LG
Sbjct: 135  NMRGRALSMQQFAIVFGQILIFYVNYKIASIAAD-TWLIELG 175



>pir|G69789|G69789 sugar transporter homolog ydjK - Bacillus
            subtilis>gb:AB007638_1145 Bacillus subtilis genomic DNA
            containing gutA to cotA region, 48
            degree.>gb:BSUB0004_752588 Bacillus subtilis complete
            genome (section 4 of 21): from 611631 to 813719.
          Length = 473

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 50/172 (29%), Positives = 80/172 (46%), Gaps = 6/172 (3%)
 Frame = +3

Query: 750  NKFAFLCAVF--ASTNSILLGYDLGVMSGAVLFIKET--FKISSVQHEXXXXXXXXXXXX 917
            N+ +FL  +   ++   +L GYD GV++GA+ ++ E     +++                
Sbjct: 6    NQMSFLRTIILVSTFGGLLFGYDTGVLNGALPYMGEPDQLNLNAFTEGLVTSSLLFGAAL 65

Query: 918  XXXASGKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAP 1097
                 G+ SD  GRR  I+  A  F I  +    AP    ++  R V GI VG + +  P
Sbjct: 66   GAVFGGRMSDFNGRRKNILFLAVIFFISTIGCTFAPNVTVMIISRFVLGIAVGGASVTVP 125

Query: 1098 VYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANIS--WRLML 1247
             Y +E+SP  +RG + +  E+ I  G L+ FV N +L     + S  WR ML
Sbjct: 126  AYLAEMSPVESRGRMVTQNELMIVSGQLLAFVFNAILGTTMGDNSHVWRFML 177



>pir|S46724|S46724 hexose transport protein HXT4 - yeast
            (Saccharomyces cerevisiae)>gb:YSCH9332_1729194
            Saccharomyces cerevisiae chromosome VIII cosmid 9332.
          Length = 560

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 47/176 (26%), Positives = 84/176 (47%), Gaps = 13/176 (7%)
 Frame = +3

Query: 765  LCAVFASTNSILLGYDLGVMSGAVL---FIKE--------TFKISSVQHEXXXXXXXXXX 911
            +C +  +    + G+D G +SG V    FI+         T+ +S V+            
Sbjct: 73   ICCLMVAFGGFVFGWDTGTISGFVAQTDFIRRFGMKHHDGTYYLSKVRTGLIVSIFNIGC 132

Query: 912  XXXXXASGKTSDMIGRRYTIVLAAATFIIGALLM--GLAPTYGYLLAGRVVAGIGVGYSL 1085
                    K  DM GR+  +++    +IIG ++    +   Y Y + GR+++G+GVG   
Sbjct: 133  AIGGIILAKLGDMYGRKMGLIVVVVIYIIGIIIQIASINKWYQYFI-GRIISGLGVGGIA 191

Query: 1086 MIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            +++P+  SE+SP   RG L S  ++ I +GI +G+ +N        ++ WR+ LGL
Sbjct: 192  VLSPMLISEVSPKHIRGTLVSCYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGL 247



>sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4
            (Low-affinity glucose transporter
            LGT1).>gb:SCRAG1_1709317 S.cerevisiae LGT1 gene for low
            affinity glucose transporter.>gb:YSCHXT4A_1729373
            Saccharomyces cerevisiae hexose transporter 3 (HXT4)
            gene, complete cds.
          Length = 576

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 47/176 (26%), Positives = 84/176 (47%), Gaps = 13/176 (7%)
 Frame = +3

Query: 765  LCAVFASTNSILLGYDLGVMSGAVL---FIKE--------TFKISSVQHEXXXXXXXXXX 911
            +C +  +    + G+D G +SG V    FI+         T+ +S V+            
Sbjct: 73   ICCLMVAFGGFVFGWDTGTISGFVAQTDFIRRFGMKHHDGTYYLSKVRTGLIVSIFNIGC 132

Query: 912  XXXXXASGKTSDMIGRRYTIVLAAATFIIGALLM--GLAPTYGYLLAGRVVAGIGVGYSL 1085
                    K  DM GR+  +++    +IIG ++    +   Y Y + GR+++G+GVG   
Sbjct: 133  AIGGIILAKLGDMYGRKMGLIVVVVIYIIGIIIQIASINKWYQYFI-GRIISGLGVGGIA 191

Query: 1086 MIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            +++P+  SE+SP   RG L S  ++ I +GI +G+ +N        ++ WR+ LGL
Sbjct: 192  VLSPMLISEVSPKHIRGTLVSCYQLMITLGIFLGYCTNYGTKTYTNSVQWRVPLGL 247



>sp|O74713|HGT1_CANAL High-affinity glucose
            transporter.>gb:CAHGT1_1644908 Candida albicans HGT1
            gene.
          Length = 545

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 45/167 (26%), Positives = 80/167 (47%), Gaps = 3/167 (1%)
 Frame = +3

Query: 762  FLCAVFASTNSILLGYDLGVMS---GAVLFIKETFKISSVQHEXXXXXXXXXXXXXXXAS 932
            F  A  ++   ++ G+D+  MS   GA  +++      S                   AS
Sbjct: 30   FFIASISTIAGMMFGFDISSMSAFIGAEHYMRYFNSPGSDIQGFITSSMALGSFFGSIAS 89

Query: 933  GKTSDMIGRRYTIVLAAATFIIGALLMGLAPTYGYLLAGRVVAGIGVGYSLMIAPVYTSE 1112
               S+  GRR +++  A  +++GA +         L+ GR+++GIGVG+   +APVY +E
Sbjct: 90   SFVSEPFGRRLSLLTCAFFWMVGAAIQSSVQNRAQLIIGRIISGIGVGFGSAVAPVYGAE 149

Query: 1113 LSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPANISWRLMLGL 1253
            L+P   RG +  + + F+ +GI+I F  +  L  +    S+R+  GL
Sbjct: 150  LAPRKIRGLIGGMFQFFVTLGIMIMFYLSFGLGHINGVASFRIAWGL 196



>gb:MTU38651_1687689 Medicago truncatula sugar tranporter mRNA,
            complete cds.
          Length = 518

 Score = 74.7 bits (182), Expect = 4e-12
 Identities = 47/188 (25%), Positives = 84/188 (44%), Gaps = 20/188 (10%)
 Frame = +3

Query: 747  LNKFAFLCAVFASTNSILLGYDLGVMSGAVL---FIKETFKI---------SSVQHEXXX 890
            L  F  +  + A+   ++ GYD+G+  G      F+K+ F           S+ Q+    
Sbjct: 19   LTPFVTITCIVAAMGGLIFGYDIGISGGVTSMDPFLKKFFPAVYRKKNKDKSTNQYCQYD 78

Query: 891  XXXXXXXXXXXXASGKTSDMI--------GRRYTIVLAAATFIIGALLMGLAPTYGYLLA 1046
                         +   S ++        GR+ +++     F++GAL+ G A     L+ 
Sbjct: 79   SQTLTMFTSSLYLAALLSSLVASTITRRFGRKLSMLFGGLLFLVGALINGFANHVWMLIV 138

Query: 1047 GRVVAGIGVGYSLMIAPVYTSELSPAMTRGFLSSLPEVFINVGILIGFVSNILLSGLPAN 1226
            GR++ G G+G++    P+Y SE++P   RG L+   ++ I +GIL+  V N   + +   
Sbjct: 139  GRILLGFGIGFANQPVPLYLSEMAPYKYRGALNIGFQLSITIGILVANVLNYFFAKIKGG 198

Query: 1227 ISWRLMLG 1250
              WRL LG
Sbjct: 199  WGWRLSLG 206


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,359,898,416
Number of Sequences: 1806583
Number of extensions: 30449825
Number of successful extensions: 76368
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 71471
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 75816
length of database: 581,917,975
effective HSP length: 127
effective length of database: 352,481,934
effective search space used: 102924724728
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)