BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig6151
         (799 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|F86296|F86296 hypothetical protein T24D18.26 - Arabidopsis t...   329   4e-89   Arabidopsis thaliana [mouse-ear cress]
gb:AP004054_1837008 Oryza sativa (japonica cultivar-group) genom...   296   4e-79   
gb:AC137925_1743814 Oryza sativa chromosome 3 BAC OSJNBb0047D08 ...   224   1e-57   
gb:ATAC018907_1543705 Arabidopsis thaliana chromosome III BAC F2...   143   3e-33   
gb:CR861044_1185072 Pongo pygmaeus mRNA; cDNA DKFZp459N1015 (fro...    71   3e-11   
gb:CR382127_1659892 Yarrowia lipolytica chromosome A of strain C...    67   3e-10   
gb:AY064147_1566027 Arabidopsis thaliana AT3g24470/MXP5_4 mRNA, ...    67   3e-10   
gb:AF153979_1886580 Homo sapiens transmembrane protein SBBI99 mR...    67   4e-10   
sp|Q13530|TDE1_HUMAN|TDE1_HUMAN Tumor differentially expressed protein 1 (T...    67   4e-10   Homo sapiens [man]
gb:AY059783_1564631 Arabidopsis thaliana unknown protein (At4g13...    66   9e-10   
gb:AE017347_1757927 Cryptococcus neoformans var. neoformans JEC2...    65   1e-09   
gb:BC073465_2557304 Xenopus laevis MGC80979 protein, mRNA (cDNA ...    65   1e-09   
gb:BC046718_2549707 Xenopus laevis similar to tumor differential...    65   1e-09   
gb:BC085853_2109412 Rattus norvegicus tumor differentially expre...    64   3e-09   
gb:AP002524_1822397 Oryza sativa (japonica cultivar-group) genom...    64   3e-09   
gb:AJ719439_2501626 Gallus gallus mRNA for hypothetical protein,...    63   6e-09   
gb:BC011295_2091364 Mus musculus tumor differentially expressed ...    63   7e-09   
gb:AF181684_2058081 Mus musculus membrane protein TMS-1 mRNA, co...    63   7e-09   
pir|I53063|I53063 testicular tumor protein [imported] - mouse>gb...    63   7e-09   Mus musculus [mouse]
sp|Q9QZI9|TDE1_MOUSE|TDE1_MOUSE Tumor differentially expressed protein 1 (M...    63   7e-09   Mus musculus [mouse]
gb:AY358429_1947308 Homo sapiens clone DNA48334 GSVL396 (UNQ396)...    62   1e-08   
gb:AF087902_1881916 Homo sapiens TDE2 mRNA, complete cds.>gb:AF0...    62   1e-08   
gb:AB033079_1866259 Homo sapiens mRNA for KIAA1253 protein, part...    62   1e-08   
gb:CR861286_1185292 Pongo pygmaeus mRNA; cDNA DKFZp459I033 (from...    62   1e-08   
gb:CR859032_1183172 Pongo pygmaeus mRNA; cDNA DKFZp459N2229 (fro...    62   1e-08   
gb:CR858232_1182417 Pongo pygmaeus mRNA; cDNA DKFZp459P1119 (fro...    62   1e-08   
pir|T46332|T46332 hypothetical protein DKFZp434H0413.1 - human (...    62   1e-08   Homo sapiens [man]
sp|Q9NRX5|TDE2_HUMAN|TDE2_HUMAN Tumor differentially expressed protein 2 (T...    62   1e-08   Homo sapiens [man]
sp|Q9QZI8|TDE2_MOUSE|TDE2_MOUSE Tumor differentially expressed protein 2 (T...    62   1e-08   Mus musculus [mouse]
gb:BC088606_2565735 Xenopus tropicalis hypothetical LOC496872, m...    62   2e-08   
gb:BC070534_2555516 Xenopus laevis cDNA clone MGC:78840 IMAGE:34...    62   2e-08   
gb:AY339894_2083881 Rattus norvegicus tumor differentially expre...    61   2e-08   
gb:BC028607_1979293 Homo sapiens tumor differentially expressed ...    61   2e-08   
gb:AX118871_1461493 Sequence 35 from Patent WO0129221.                 61   2e-08   
gb:AY539942_1178606 Rattus norvegicus LRRGT00191 mRNA, complete ...    61   2e-08   
gb:AF352325_1150849 Homo sapiens FKSG84 mRNA, complete cds.            61   2e-08   
sp|Q96SA4|TD2L_HUMAN|TD2L_HUMAN Tumor differentially expressed 2-like (FKSG...    61   2e-08   Homo sapiens [man]
gb:AJ720582_2502769 Gallus gallus mRNA for hypothetical protein,...    61   3e-08   
gb:BC045456_2549293 Danio rerio tumor differentially expressed 2...    60   4e-08   
gb:AL845365_2504652 Zebrafish DNA sequence from clone DKEY-150H1...    60   4e-08   
gb:AK031101_1162296 Mus musculus 13 days embryo forelimb cDNA, R...    60   4e-08   
gb:AX136091_1461925 Sequence 13 from Patent EP1067182.                 59   8e-08   
gb:YLI575660_1727998 Yarrowia lipolytica iah1, mts1, stl1, sip3,...    59   1e-07   
gb:AY358560_1947439 Homo sapiens clone DNA40625 GACL263 (UNQ263)...    57   3e-07   
gb:AF498273_1905296 Homo sapiens developmentally regulated prote...    57   4e-07   
gb:OSJN00271_1697722 Oryza sativa genomic DNA, chromosome 4, BAC...    57   4e-07   
gb:CR382137_1670273 Debaryomyces hansenii chromosome E of strain...    57   4e-07   
gb:AK075863_1171063 Mus musculus adult male tongue cDNA, RIKEN f...    57   4e-07   
sp|Q8K0E7|TD2L_MOUSE|TD2L_MOUSE Tumor differentially expressed 2-like.>gb:B...    57   4e-07   Mus musculus [mouse]
gb:AJ720286_2502473 Gallus gallus mRNA for hypothetical protein,...    57   5e-07   
gb:AF181686_1248326 Drosophila melanogaster membrane protein TMS...    57   5e-07   
gb:AE014296_1136583 Drosophila melanogaster chromosome 3L, compl...    57   5e-07   
gb:AK037699_1164896 Mus musculus 16 days neonate thymus cDNA, RI...    54   3e-06   
gb:BC071500_2556237 Danio rerio zgc:55396, mRNA (cDNA clone IMAG...    54   3e-06   
gb:RATDRP_2132093 Rattus norvegicus developmentally regulated pr...    54   3e-06   
gb:AP002048_1821661 Arabidopsis thaliana genomic DNA, chromosome...    54   4e-06   
gb:AB029501_2044568 Mus musculus AIGP-3 mRNA for axotomy induced...    53   8e-06   
gb:CR382126_1658885 Kluyveromyces lactis strain NRRL Y-1140 chro...    53   8e-06   
sp|Q12116|TMS1_YEAST|TMS1_YEAST Membrane protein TMS1.>pir|S51256|S51256 pr...    53   8e-06   Saccharomyces cerevisiae [brewer's yeast]
gb:BC072375_2556624 Xenopus laevis hypothetical protein LOC43211...    52   1e-05   
gb:AX497278_1469619 Sequence 45 from Patent WO0229058.>gb:AX4972...    52   1e-05   
gb:BC044159_2548548 Danio rerio zgc:55396, mRNA (cDNA clone MGC:...    52   2e-05   
gb:AX497286_1469623 Sequence 53 from Patent WO0229058.                 51   2e-05   
gb:AX497282_1469621 Sequence 49 from Patent WO0229058.                 51   2e-05   
sp|Q9HDY3|YK17_SCHPO|YK17_SCHPO Membrane protein PB1A10.07c.>gb:SPAPB1A10_1...    49   1e-04   Schizosaccharomyces pombe
gb:AC024832_1204897 Caenorhabditis elegans cosmid Y57E12AL, comp...    49   1e-04   
gb:AB027945_1517711 Schizosaccharomyces pombe gene for Hypotheti...    47   3e-04   
gb:CR380958_1653348 Candida glabrata strain CBS138 chromosome L ...    45   0.001   
gb:AK044479_1166991 Mus musculus adult retina cDNA, RIKEN full-l...    45   0.002   
pir|T24196|T24196 hypothetical protein R11H6.2 - Caenorhabditis ...    45   0.002   Caenorhabditis elegans [roundworm]
gb:BC083132_2108536 Mus musculus cDNA clone MGC:102317 IMAGE:646...    44   0.005   
gb:AE016820_1750054 Ashbya gossypii (= Eremothecium gossypii) AT...    42   0.010   
gb:BX571662_779173 Wolinella succinogenes, complete genome; segm...    35   1.2     
sp|Q58573|YB73_METJA|YB73_METJA Hypothetical protein MJ1173.>pir|D64446|D64...    35   1.6     Methanocaldococcus jannaschii
gb:AE017271_423418 Bacillus cereus ATCC 10987, section 8 of 18 o...    33   6.2     
gb:AY526248_1333109 Trypanosoma cruzi putative amino acid transp...    33   8.1     
gb:AGA439353_1281919 Anopheles gambiae BAC clone 30E5.                 33   8.1     
gb:BA000039_726697 Thermosynechococcus elongatus BP-1 DNA, compl...    33   8.1     


>pir|F86296|F86296 hypothetical protein T24D18.26 - Arabidopsis
           thaliana>gb:AE005172_890602 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:T24D18_1723867 Arabidopsis thaliana
           chromosome 1 BAC T24D18 sequence, complete sequence.
          Length = 412

 Score =  329 bits (843), Expect = 4e-89
 Identities = 151/190 (79%), Positives = 164/190 (86%)
 Frame = +2

Query: 224 RTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDA 403
           RTVVSGISRRSARIAYCGLF LSLIVSWILREVAAPLME +PWINHFHKTPDREWFETDA
Sbjct: 20  RTVVSGISRRSARIAYCGLFALSLIVSWILREVAAPLMEKLPWINHFHKTPDREWFETDA 79

Query: 404 VLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELIS 583
           VLRVSLGNF FF+ILS+MMIG+KNQKDPRD +HHGGWMMK+ICW +LVIFMFF+PNE+IS
Sbjct: 80  VLRVSLGNFLFFSILSVMMIGVKNQKDPRDGIHHGGWMMKIICWCILVIFMFFLPNEIIS 139

Query: 584 FYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITG 763
           FYES SKFG+G              HGWND WVGYDEQFWY ALLVVSLVCY+ATF  +G
Sbjct: 140 FYESMSKFGAGFFLLVQVVLLLDFVHGWNDTWVGYDEQFWYAALLVVSLVCYLATFVFSG 199

Query: 764 VLFHFFAPSG 793
            LFH+F PSG
Sbjct: 200 FLFHWFTPSG 209



>gb:AP004054_1837008 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1249_F12.>gb:AP005115_1848125 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0700F06.
          Length = 414

 Score =  296 bits (757), Expect = 4e-79
 Identities = 134/209 (64%), Positives = 154/209 (73%)
 Frame = +2

Query: 167 MWXXXXXXXXXXXXXXXXXRTVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENI 346
           MW                 RT V  I RRSARIAYCGLF LSL  SW LREVAAPL+++I
Sbjct: 1   MWAASCLASCCAACACEACRTAVGSIGRRSARIAYCGLFALSLFASWALREVAAPLLQSI 60

Query: 347 PWINHFHKTPDREWFETDAVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKV 526
           PWINHFHKTPDREWFETDAVLRVSLGNF FFTIL+I+M GIK+QKDPRD +HHGGWM K+
Sbjct: 61  PWINHFHKTPDREWFETDAVLRVSLGNFVFFTILAIIMAGIKDQKDPRDKIHHGGWMAKI 120

Query: 527 ICWFLLVIFMFFVPNELISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQFWY 706
            CW ++V  MFFVPN ++SFYES SKFGSG              HGWN+ WV  DEQFWY
Sbjct: 121 FCWVVIVFLMFFVPNGVVSFYESISKFGSGLFLLVQVVLLLDFVHGWNENWVAKDEQFWY 180

Query: 707 VALLVVSLVCYVATFAITGVLFHFFAPSG 793
           +ALLVVS+VCY+ TF+ +G+LFH+F PSG
Sbjct: 181 MALLVVSVVCYIVTFSFSGLLFHWFTPSG 209



>gb:AC137925_1743814 Oryza sativa chromosome 3 BAC OSJNBb0047D08
           genomic sequence, complete sequence.
          Length = 417

 Score =  224 bits (571), Expect = 1e-57
 Identities = 102/189 (53%), Positives = 136/189 (71%)
 Frame = +2

Query: 227 TVVSGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAV 406
           + +S ISRRSAR+AYCGLF  SLI+S+++R+ A PL++ IPWIN F  T   EWF+ +AV
Sbjct: 21  SALSAISRRSARLAYCGLFAASLILSFLMRQFATPLLKQIPWINTFDYTQPDEWFQMNAV 80

Query: 407 LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF 586
           LRVSLGNF FF I ++MMIG+K+Q D RD  HHGGW+ K++ W +L++ MF VPN +I+ 
Sbjct: 81  LRVSLGNFLFFAIFALMMIGVKDQNDRRDAWHHGGWIAKIVVWVVLIVLMFCVPNVVITI 140

Query: 587 YESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGV 766
           YE  SKFGSG              + WND W+  DEQ W +ALLVV++VCY++TFA +G+
Sbjct: 141 YEVLSKFGSGLFLLVQVVMLLDFTNNWNDSWIEKDEQKWEIALLVVTVVCYLSTFAFSGL 200

Query: 767 LFHFFAPSG 793
           LF +F PSG
Sbjct: 201 LFTWFNPSG 209



>gb:ATAC018907_1543705 Arabidopsis thaliana chromosome III BAC F28L1
           genomic sequence, complete sequence.
          Length = 315

 Score =  143 bits (361), Expect = 3e-33
 Identities = 61/113 (53%), Positives = 80/113 (70%)
 Frame = +2

Query: 458 MIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGSGXXXXXXX 637
           MIG+K+Q D RD+ HHGGW +K+I WFLLV+ MFFVPN ++S Y + SKFG+G       
Sbjct: 1   MIGVKDQNDRRDSWHHGGWGLKMIVWFLLVVLMFFVPNVIVSLYGTLSKFGAGAFLLVQV 60

Query: 638 XXXXXXXHGWNDKWVGYDEQFWYVALLVVSLVCYVATFAITGVLFHFFAPSGQ 796
                  H WND WV  DE+ WY+ALLV+S+VCY+AT+  +G+LF +F PSGQ
Sbjct: 61  VLLLDATHNWNDSWVEKDEKKWYIALLVISIVCYIATYTFSGILFIWFNPSGQ 113



>gb:CR861044_1185072 Pongo pygmaeus mRNA; cDNA DKFZp459N1015 (from
           clone DKFZp459N1015).
          Length = 473

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 49/195 (25%), Positives = 83/195 (42%), Gaps = 17/195 (8%)
 Frame = +2

Query: 260 RIAYCGLFGLSLIVSWIL-REVAAPLMENIPWINH----FHKTPDREWFETD------AV 406
           R+ Y  +  LS +VS+I+ R+     ++ IP         H+       + D      AV
Sbjct: 39  RLIYAFILLLSTVVSYIMQRKEMETYLKKIPGFCEGGFKIHEADINADKDCDVLVGYKAV 98

Query: 407 LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELI-S 583
            R+S     FF + S++M  +K  KDPR  +H+G W  K+     +++  F++P     S
Sbjct: 99  YRISFAMAIFFFVFSLLMFKVKTSKDPRAAVHNGFWFFKIAALIGIMVGSFYIPGGYFSS 158

Query: 584 FYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCYVATF 751
            +      G+               H WN+ WV   E+     WY ALL  +   Y+ + 
Sbjct: 159 VWFVVGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFYILSI 218

Query: 752 AITGVLFHFFA-PSG 793
              G+L+ ++  P G
Sbjct: 219 ICVGLLYTYYTKPDG 233



>gb:CR382127_1659892 Yarrowia lipolytica chromosome A of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 463

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 43/186 (23%), Positives = 83/186 (44%), Gaps = 6/186 (3%)
 Frame = +2

Query: 254 SARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNF 430
           + R+ Y  LF ++ I+SWI L + A   +E         K    E     AV R++    
Sbjct: 46  ATRVGYAVLFLVNSILSWIMLTDWAVKKLERFTLDYMKFKCLGEECTGFVAVQRMNFALG 105

Query: 431 TFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES-TSKF 607
            F  I++++++G+ + K+PR  + +G W  K+  W  L++  F +P +    + +  +  
Sbjct: 106 VFHLIMALLLVGVHSTKNPRSKIQNGYWGFKIAAWLALIVLCFLIPEKFFVVWGNYFAMI 165

Query: 608 GSGXXXXXXXXXXXXXXHGWNDKWV----GYDEQFWYVALLVVSLVCYVATFAITGVLFH 775
           GS               H W ++ +      D   W   L+  ++  Y+A+  +T +++ 
Sbjct: 166 GSAIFILIGLVLLVDFAHSWAEQCLERIEETDSGTWKFILVGSTMSMYIASIVLTILMYV 225

Query: 776 FFAPSG 793
           FF  SG
Sbjct: 226 FFCTSG 231



>gb:AY064147_1566027 Arabidopsis thaliana AT3g24470/MXP5_4 mRNA,
           complete cds.>gb:BT010591_1640537 Arabidopsis thaliana
           At3g24470/MXP5_4 gene, complete cds.
          Length = 409

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 45/186 (24%), Positives = 80/186 (43%), Gaps = 2/186 (1%)
 Frame = +2

Query: 236 SGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE-WFETDAVLR 412
           +G +   AR  Y  +F ++ +++W  R+     +  +     F      E    TD VLR
Sbjct: 33  NGCNPWMARYVYGLIFLIANLLAWAARDYGRGALRKV---TRFKNCKGGENCLGTDGVLR 89

Query: 413 VSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYE 592
           VSLG F F+ ++ +  +G       RD  H G W +K+I W  L I  F +P+ +I  Y 
Sbjct: 90  VSLGCFLFYFVMFLSTLGTSKTHSSRDRWHSGWWFVKLIMWPALTIIPFLLPSSIIHLYG 149

Query: 593 STSKFGSGXXXXXXXXXXXXXXHGWNDKWVGY-DEQFWYVALLVVSLVCYVATFAITGVL 769
             + FG+G                 N+ +    D +   V ++++S   Y        ++
Sbjct: 150 EIAHFGAGVFLLIQLISVISFIQWLNECYQSQKDAERCRVYVMLLSTTSYTVCIVGVILM 209

Query: 770 FHFFAP 787
           + ++AP
Sbjct: 210 YIWYAP 215



>gb:AF153979_1886580 Homo sapiens transmembrane protein SBBI99 mRNA,
           complete cds.>gb:HSU49188_2024570 Human placenta
           (Diff33) mRNA, complete cds.
          Length = 494

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 48/195 (24%), Positives = 82/195 (42%), Gaps = 17/195 (8%)
 Frame = +2

Query: 260 RIAYCGLFGLSLIVSWIL-REVAAPLMENIPWINH----FHKTPDREWFETD------AV 406
           R+ Y  +  LS +VS+I+ R+     ++ IP         H+       + D      AV
Sbjct: 39  RLIYAFILLLSTVVSYIMQRKEMETYLKKIPGFCEGGFKIHEADINADKDCDVLVGYKAV 98

Query: 407 LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELI-S 583
            R+S     FF + S++M  +K  KD R  +H+G W  K+     +++  F++P     S
Sbjct: 99  YRISFAMAIFFFVFSLLMFKVKTSKDLRAAVHNGFWFFKIAALIGIMVGSFYIPGGYFSS 158

Query: 584 FYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCYVATF 751
            +      G+               H WN+ WV   E+     WY ALL  +   Y+ + 
Sbjct: 159 VWFVVGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFYILSI 218

Query: 752 AITGVLFHFFA-PSG 793
              G+L+ ++  P G
Sbjct: 219 ICVGLLYTYYTKPDG 233



>sp|Q13530|TDE1_HUMAN Tumor differentially expressed protein 1
           (Transmembrane protein SBBI99).>gb:AF112227_1884383 Homo
           sapiens TDE homolog mRNA, complete
           cds.>gb:BC006088_1970014 Homo sapiens tumor
           differentially expressed 1, transcript variant 1, mRNA
           (cDNA clone MGC:12658 IMAGE:3641108), complete
           cds.>gb:HS179M20_1997305 Human DNA sequence from clone
           RP1-179M20 on chromosome 20 Contains the 3' end of the
           C20orf121 gene for chromosome 20 open reading frame 121,
           the TDE1 gene for tumour differentially expressed 1, the
           PKIG gene for protein kinase (cAMP-dependent, catalytic)
           inhibitor gamma, the 3' end of the ADA gene for
           adenosine deaminase and two CpG islands, complete
           sequence.
          Length = 473

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 48/195 (24%), Positives = 82/195 (42%), Gaps = 17/195 (8%)
 Frame = +2

Query: 260 RIAYCGLFGLSLIVSWIL-REVAAPLMENIPWINH----FHKTPDREWFETD------AV 406
           R+ Y  +  LS +VS+I+ R+     ++ IP         H+       + D      AV
Sbjct: 39  RLIYAFILLLSTVVSYIMQRKEMETYLKKIPGFCEGGFKIHEADINADKDCDVLVGYKAV 98

Query: 407 LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELI-S 583
            R+S     FF + S++M  +K  KD R  +H+G W  K+     +++  F++P     S
Sbjct: 99  YRISFAMAIFFFVFSLLMFKVKTSKDLRAAVHNGFWFFKIAALIGIMVGSFYIPGGYFSS 158

Query: 584 FYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCYVATF 751
            +      G+               H WN+ WV   E+     WY ALL  +   Y+ + 
Sbjct: 159 VWFVVGMIGAALFILIQLVLLVDFAHSWNESWVNRMEEGNPRLWYAALLSFTSAFYILSI 218

Query: 752 AITGVLFHFFA-PSG 793
              G+L+ ++  P G
Sbjct: 219 ICVGLLYTYYTKPDG 233



>gb:AY059783_1564631 Arabidopsis thaliana unknown protein
           (At4g13345) mRNA, complete cds.>gb:AY117270_1579311
           Arabidopsis thaliana unknown protein (At4g13345) mRNA,
           complete cds.
          Length = 394

 Score = 65.9 bits (159), Expect = 9e-10
 Identities = 38/127 (29%), Positives = 61/127 (48%)
 Frame = +2

Query: 236 SGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRV 415
           +G +   AR  Y  +F L+ +++W LR+     +  +    +  +  D     T+ VLRV
Sbjct: 26  NGCNPWMARYVYGLIFLLANLLAWALRDYGRGALTEMRKFKNCKEGGD--CLGTEGVLRV 83

Query: 416 SLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES 595
           S G F F+ I+ +  +G       RD  H G W  K+     L IF F +P+ +I FY  
Sbjct: 84  SFGCFLFYFIMFLSTVGTSKTHSSRDKWHSGWWFAKLFMLLGLTIFPFLLPSSIIQFYGE 143

Query: 596 TSKFGSG 616
            + FG+G
Sbjct: 144 IAHFGAG 150



>gb:AE017347_1757927 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 513

 Score = 65.5 bits (158), Expect = 1e-09
 Identities = 47/196 (23%), Positives = 85/196 (43%), Gaps = 16/196 (8%)
 Frame = +2

Query: 254 SARIAYCGLFGLSLIVSWILR-EVAAPLMENIPWINHFHKTPDREWFETD---------- 400
           + R+ +  +F LS +++++ + ++A   +E + W          +W + D          
Sbjct: 48  ATRVGFGLIFALSSMLAYLSKTDIAIRQIEKLSW----------DWIKMDCSKGKCYGLL 97

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELI 580
           AV R       F  +LS ++IG+++ K  R  + +G W  K++ +FLL    F +PNE  
Sbjct: 98  AVHRFCFALTMFHLVLSAILIGVRSTKAKRAAIQNGWWGPKLLFYFLLCFLAFLIPNEFY 157

Query: 581 SFYES-TSKFGSGXXXXXXXXXXXXXXHGWN----DKWVGYDEQFWYVALLVVSLVCYVA 745
             Y S  +  G+               H W+    D W   +   W   L+  +   +V 
Sbjct: 158 MAYGSYIAPIGAFFFILIGLVLLVDFAHTWSETCLDNWEHSNSNLWQFILVGSTFGMFVT 217

Query: 746 TFAITGVLFHFFAPSG 793
           T  +T +L+ FFA SG
Sbjct: 218 TITVTILLYVFFAGSG 233



>gb:BC073465_2557304 Xenopus laevis MGC80979 protein, mRNA (cDNA
           clone MGC:80979 IMAGE:5536738), complete cds.
          Length = 470

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 39/135 (28%), Positives = 60/135 (44%), Gaps = 5/135 (3%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP-NEL 577
           AV RVS     FF  +SI M+G+K  KDPR  +H+G W  KV+    +++  F++P    
Sbjct: 97  AVYRVSFAMTMFFLAMSIFMLGVKTSKDPRAAIHNGFWFFKVLALAGIMVGAFYIPEGHF 156

Query: 578 ISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCYVA 745
            S +      G+               H  N+ WV   E+     WY  LL  +++CY  
Sbjct: 157 TSAWFWIGVCGACCFIVFQLILLVDFAHSLNENWVERMEEGNSKCWYAVLLSFTILCYSL 216

Query: 746 TFAITGVLFHFFAPS 790
           +      LF ++  S
Sbjct: 217 SLLFIVFLFLYYTKS 231



>gb:BC046718_2549707 Xenopus laevis similar to tumor differentially
           expressed 2, mRNA (cDNA clone IMAGE:4930096), partial
           cds.
          Length = 476

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 42/139 (30%), Positives = 64/139 (46%), Gaps = 8/139 (5%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN--- 571
           AV RV  G   FF + S++MI +K+ +DPR +LH+G W  K      + +  FF+P    
Sbjct: 113 AVYRVCFGMAMFFLLFSLLMIKVKSSQDPRASLHNGFWFFKFAAAVGITVGAFFIPEGPF 172

Query: 572 ELISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCY 739
             + FY      G+               H WN+ WV   E+     WYVALL  + + Y
Sbjct: 173 TTVWFYVGMG--GAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYVALLSATGLNY 230

Query: 740 VATFAITGVLFHFFA-PSG 793
           V +     +L+ ++  P G
Sbjct: 231 VLSLVAIVLLYVYYTHPEG 249



>gb:BC085853_2109412 Rattus norvegicus tumor differentially
           expressed 1 (predicted), mRNA (cDNA clone MGC:94574
           IMAGE:7190015), complete cds.
          Length = 472

 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 35/137 (25%), Positives = 60/137 (43%), Gaps = 6/137 (4%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP-NEL 577
           AV R++     FF    ++M+ +K  KDPR  +H+G W  K+     +++  F++P    
Sbjct: 97  AVYRINFAVAIFFFAFFLLMLKVKTSKDPRAAVHNGFWFFKIAAIIGIMVGSFYIPGGHF 156

Query: 578 ISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCYVA 745
              + S    G+               H WN+ WV   E+     WY ALL  + + Y+ 
Sbjct: 157 TKVWFSAGMLGATFFIFIQLVLLVDLAHSWNELWVNRMEEGNPRLWYAALLSFTSLFYIL 216

Query: 746 TFAITGVLFHFFA-PSG 793
           +     +L+ F+  P G
Sbjct: 217 SIVFAALLYIFYTKPDG 233



>gb:AP002524_1822397 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0406H10.>gb:AP003118_1824786 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OJ1174_D05.
          Length = 421

 Score = 64.3 bits (155), Expect = 3e-09
 Identities = 42/178 (23%), Positives = 79/178 (44%), Gaps = 1/178 (0%)
 Frame = +2

Query: 257 ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTF 436
           AR  Y  +F  + +++W LR+   P++  +  +    +         + VLRVSLG F F
Sbjct: 51  ARYVYAFVFLATNLLAWTLRDFGHPVLAELRRLRGSCQGAGY-CLGAEGVLRVSLGCFLF 109

Query: 437 FTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGSG 616
           F ++ +  +  +   D R++ H   W  K++ W    +  FF+P+ LI  Y   + FG+G
Sbjct: 110 FFVMFLSTVRTRKTHDRRNSWHSEWWPAKIVLWMGFTVVPFFLPSPLIQLYGKIAHFGAG 169

Query: 617 XXXXXXXXXXXXXXHGWNDKWVGYDE-QFWYVALLVVSLVCYVATFAITGVLFHFFAP 787
                            ND        +  ++ + VVS+  YV +     +++ ++AP
Sbjct: 170 AFLVIQLVSVTRFITWLNDCCRSETNLKRCHMQVQVVSIAAYVGSILGVVLMYVWYAP 227



>gb:AJ719439_2501626 Gallus gallus mRNA for hypothetical protein,
           clone 2f12.
          Length = 461

 Score = 63.2 bits (152), Expect = 6e-09
 Identities = 41/134 (30%), Positives = 61/134 (45%), Gaps = 7/134 (5%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN--- 571
           AV RV  G   FF + S++MI +K+  DPR  +H+G W  K      + +  FF+P    
Sbjct: 97  AVYRVCFGMAMFFLLFSLLMIKVKSSNDPRAAVHNGFWFFKFATALAISVGAFFIPEGPF 156

Query: 572 ELISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCY 739
             + FY   S  G+               H WN+ WV   E+     WY ALL  + V Y
Sbjct: 157 TTVWFYVGMS--GAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATAVNY 214

Query: 740 VATFAITGVLFHFF 781
           + +  +  VLF+ +
Sbjct: 215 LLSL-VAIVLFYVY 227



>gb:BC011295_2091364 Mus musculus tumor differentially expressed 1,
           mRNA (cDNA clone MGC:18455 IMAGE:3487943), complete
           cds.>gb:BC022901_2093920 Mus musculus tumor
           differentially expressed 1, mRNA (cDNA clone MGC:30210
           IMAGE:5068196), complete cds.>gb:BC029026_2096448 Mus
           musculus tumor differentially expressed 1, mRNA (cDNA
           clone MGC:31028 IMAGE:5039323), complete cds.
          Length = 472

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 33/132 (25%), Positives = 57/132 (43%), Gaps = 5/132 (3%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP-NEL 577
           AV R++     FF    ++M+ +K  KDPR  +H+G W  K+     ++I  F++P    
Sbjct: 97  AVYRINFAVAIFFFAFFLLMLKVKTSKDPRAAVHNGFWFFKIAAIIGIMIGSFYIPGGSF 156

Query: 578 ISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCYVA 745
              +      G+               H WN+ WV   E+     WY ALL  + + Y+ 
Sbjct: 157 TEVWFFAGMLGASFFIIIQLVLLVDMAHSWNELWVNRMEEGNPRLWYAALLSFTSLFYIL 216

Query: 746 TFAITGVLFHFF 781
           +     +L+ F+
Sbjct: 217 SIVFAALLYVFY 228



>gb:AF181684_2058081 Mus musculus membrane protein TMS-1 mRNA,
           complete cds.
          Length = 472

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 33/132 (25%), Positives = 57/132 (43%), Gaps = 5/132 (3%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP-NEL 577
           AV R++     FF    ++M+ +K  KDPR  +H+G W  K+     ++I  F++P    
Sbjct: 97  AVYRINFAVAIFFFAFFLLMLKVKTSKDPRAAVHNGFWFFKIAAIIGIMIGSFYIPGGSF 156

Query: 578 ISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCYVA 745
              +      G+               H WN+ WV   E+     WY ALL  + + Y+ 
Sbjct: 157 TEVWFVAGMLGASFFIIIQLVLLVDMAHSWNELWVNRMEEGNPRLWYAALLSFTSLFYIL 216

Query: 746 TFAITGVLFHFF 781
           +     +L+ F+
Sbjct: 217 SIVFAALLYVFY 228



>pir|I53063|I53063 testicular tumor protein [imported] -
           mouse>gb:MUSTETU_2130584 Mus musculus mRNA, complete
           cds.
          Length = 393

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 33/132 (25%), Positives = 57/132 (43%), Gaps = 5/132 (3%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP-NEL 577
           AV R++     FF    ++M+ +K  KDPR  +H+G W  K+     ++I  F++P    
Sbjct: 18  AVYRINFAVAIFFFAFFLLMLKVKTSKDPRAAVHNGFWFFKIAAIIGIMIGSFYIPGGSF 77

Query: 578 ISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCYVA 745
              +      G+               H WN+ WV   E+     WY ALL  + + Y+ 
Sbjct: 78  TEVWFVAGMLGASFFIIIQLVLLVDMAHSWNELWVNRMEEGNPRLWYAALLSFTSLFYIL 137

Query: 746 TFAITGVLFHFF 781
           +     +L+ F+
Sbjct: 138 SIVFAALLYVFY 149



>sp|Q9QZI9|TDE1_MOUSE Tumor differentially expressed protein 1
           (Membrane protein TMS-1) (Axotomy induced glycoprotein
           1) (Axotomy induced glyco/Golgi protein 1)
           (AIGP-1).>gb:AB029499_2044567 Mus musculus AIGP-1 mRNA
           for axotomy Induced glycoprotein 1, complete
           cds.>gb:AB078029_2047638 Mus musculus AIGP1 gene for
           axotomy induced glyco/golgi protein 1, complete cds.
          Length = 472

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 33/132 (25%), Positives = 57/132 (43%), Gaps = 5/132 (3%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP-NEL 577
           AV R++     FF    ++M+ +K  KDPR  +H+G W  K+     ++I  F++P    
Sbjct: 97  AVYRINFAVAIFFFAFFLLMLKVKTSKDPRAAVHNGFWFFKIAAIIGIMIGSFYIPGGSF 156

Query: 578 ISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCYVA 745
              +      G+               H WN+ WV   E+     WY ALL  + + Y+ 
Sbjct: 157 TEVWFVAGMLGASFFIIIQLVLLVDMAHSWNELWVNRMEEGNPRLWYAALLSFTSLFYIL 216

Query: 746 TFAITGVLFHFF 781
           +     +L+ F+
Sbjct: 217 SIVFAALLYVFY 228



>gb:AY358429_1947308 Homo sapiens clone DNA48334 GSVL396 (UNQ396)
           mRNA, complete cds.
          Length = 453

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 7/134 (5%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN--- 571
           AV R+  G   F+ +LS++MI +K+  DPR  +H+G W  K      ++I  FF+P    
Sbjct: 89  AVYRLCFGLAMFYLLLSLLMIKVKSSSDPRAAVHNGFWFFKFAAAIAIIIGAFFIPEGTF 148

Query: 572 ELISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCY 739
             + FY   +  G+               H WN+ WV   E+     WY ALL  + + Y
Sbjct: 149 TTVWFYVGMA--GAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATALNY 206

Query: 740 VATFAITGVLFHFF 781
           + +     + F ++
Sbjct: 207 LLSLVAIVLFFVYY 220



>gb:AF087902_1881916 Homo sapiens TDE2 mRNA, complete
           cds.>gb:AF092436_1882628 Homo sapiens TDE2 gene,
           complete cds.
          Length = 453

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 7/134 (5%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN--- 571
           AV R+  G   F+ +LS++MI +K+  DPR  +H+G W  K      ++I  FF+P    
Sbjct: 89  AVYRLCFGLAMFYLLLSLLMIKVKSSSDPRAAVHNGFWFFKFAAAIAIIIGAFFIPEGTF 148

Query: 572 ELISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCY 739
             + FY   +  G+               H WN+ WV   E+     WY ALL  + + Y
Sbjct: 149 TTVWFYVGMA--GAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATALNY 206

Query: 740 VATFAITGVLFHFF 781
           + +     + F ++
Sbjct: 207 LLSLVAIVLFFVYY 220



>gb:AB033079_1866259 Homo sapiens mRNA for KIAA1253 protein, partial
           cds.
          Length = 472

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 7/134 (5%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN--- 571
           AV R+  G   F+ +LS++MI +K+  DPR  +H+G W  K      ++I  FF+P    
Sbjct: 108 AVYRLCFGLAMFYLLLSLLMIKVKSSSDPRAAVHNGFWFFKFAAAIAIIIGAFFIPEGTF 167

Query: 572 ELISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCY 739
             + FY   +  G+               H WN+ WV   E+     WY ALL  + + Y
Sbjct: 168 TTVWFYVGMA--GAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATALNY 225

Query: 740 VATFAITGVLFHFF 781
           + +     + F ++
Sbjct: 226 LLSLVAIVLFFVYY 239



>gb:CR861286_1185292 Pongo pygmaeus mRNA; cDNA DKFZp459I033 (from
           clone DKFZp459I033).
          Length = 453

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 7/134 (5%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN--- 571
           AV R+  G   F+ +LS++MI +K+  DPR  +H+G W  K      ++I  FF+P    
Sbjct: 89  AVYRLCFGLAMFYLLLSLLMIKVKSSSDPRAAVHNGFWFFKFAAAIAIIIGAFFIPEGTF 148

Query: 572 ELISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCY 739
             + FY   +  G+               H WN+ WV   E+     WY ALL  + + Y
Sbjct: 149 TTVWFYVGMA--GAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATALNY 206

Query: 740 VATFAITGVLFHFF 781
           + +     + F ++
Sbjct: 207 LLSLVAIVLFFVYY 220



>gb:CR859032_1183172 Pongo pygmaeus mRNA; cDNA DKFZp459N2229 (from
           clone DKFZp459N2229).>gb:CR861441_1185436 Pongo pygmaeus
           mRNA; cDNA DKFZp459J102 (from clone DKFZp459J102).
          Length = 453

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 7/134 (5%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN--- 571
           AV R+  G   F+ +LS++MI +K+  DPR  +H+G W  K      ++I  FF+P    
Sbjct: 89  AVYRLCFGLAMFYLLLSLLMIKVKSSSDPRAAVHNGFWFFKFAAAIAIIIGAFFIPEGTF 148

Query: 572 ELISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCY 739
             + FY   +  G+               H WN+ WV   E+     WY ALL  + + Y
Sbjct: 149 TTVWFYVGMA--GAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATALNY 206

Query: 740 VATFAITGVLFHFF 781
           + +     + F ++
Sbjct: 207 LLSLVAIVLFFVYY 220



>gb:CR858232_1182417 Pongo pygmaeus mRNA; cDNA DKFZp459P1119 (from
           clone DKFZp459P1119).
          Length = 453

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 7/134 (5%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN--- 571
           AV R+  G   F+ +LS++MI +K+  DPR  +H+G W  K      ++I  FF+P    
Sbjct: 89  AVYRLCFGLAMFYLLLSLLMIKVKSSSDPRAAVHNGFWFFKFAAAIAIIIGAFFIPEGTF 148

Query: 572 ELISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCY 739
             + FY   +  G+               H WN+ WV   E+     WY ALL  + + Y
Sbjct: 149 TTVWFYVGMA--GAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATALNY 206

Query: 740 VATFAITGVLFHFF 781
           + +     + F ++
Sbjct: 207 LLSLVAIVLFFVYY 220



>pir|T46332|T46332 hypothetical protein DKFZp434H0413.1 - human
           (fragment)
          Length = 457

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 7/134 (5%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN--- 571
           AV R+  G   F+ +LS++MI +K+  DPR  +H+G W  K      ++I  FF+P    
Sbjct: 93  AVYRLCFGLAMFYLLLSLLMIKVKSSSDPRAAVHNGFWFFKFAAAIAIIIGAFFIPEGTF 152

Query: 572 ELISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCY 739
             + FY   +  G+               H WN+ WV   E+     WY ALL  + + Y
Sbjct: 153 TTVWFYVGMA--GAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATALNY 210

Query: 740 VATFAITGVLFHFF 781
           + +     + F ++
Sbjct: 211 LLSLVAIVLFFVYY 224



>sp|Q9NRX5|TDE2_HUMAN Tumor differentially expressed protein 2
           (Tumor differentially expressed 1 protein like)
           (UNQ396/PRO732).>gb:HSM801917_1186562 Homo sapiens mRNA;
           cDNA DKFZp434H0413 (from clone
           DKFZp434H0413).>gb:AF164794_1887197 Homo sapiens Diff33
           protein homolog mRNA, complete cds.>gb:BC033029_1980761
           Homo sapiens tumor differentially expressed 2, mRNA
           (cDNA clone MGC:33018 IMAGE:4831122), complete
           cds.>gb:HS425C14_1998579 Human DNA sequence from clone
           RP3-425C14 on chromosome 6q22 Contains the 3' end of the
           HSF2 gene for Heat Shock Transcription Factor 2 and the
           3' end of a novel gene for KIAA1253 protein (similar to
           tumor differentially expressed TDE1), complete sequence.
          Length = 453

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 7/134 (5%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN--- 571
           AV R+  G   F+ +LS++MI +K+  DPR  +H+G W  K      ++I  FF+P    
Sbjct: 89  AVYRLCFGLAMFYLLLSLLMIKVKSSSDPRAAVHNGFWFFKFAAAIAIIIGAFFIPEGTF 148

Query: 572 ELISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCY 739
             + FY   +  G+               H WN+ WV   E+     WY ALL  + + Y
Sbjct: 149 TTVWFYVGMA--GAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATALNY 206

Query: 740 VATFAITGVLFHFF 781
           + +     + F ++
Sbjct: 207 LLSLVAIVLFFVYY 220



>sp|Q9QZI8|TDE2_MOUSE Tumor differentially expressed protein 2
           (Tumor differentially expressed 1 protein like)
           (Membrane protein TMS-2) (Axotomy induced glyco/Golgi
           protein 2).>gb:AK002847_1151486 Mus musculus adult male
           kidney cDNA, RIKEN full-length enriched library,
           clone:0610039M12 product:tumor differentially expressed
           1, like, full insert sequence.>gb:AK005203_1152885 Mus
           musculus adult male cerebellum cDNA, RIKEN full-length
           enriched library, clone:1500011D18 product:tumor
           differentially expressed 1, like, full insert
           sequence.>gb:AK088340_1175344 Mus musculus 2 days
           neonate thymus thymic cells cDNA, RIKEN full-length
           enriched library, clone:E430013H12 product:tumor
           differentially expressed 1, like, full insert
           sequence.>gb:AB078030_2047639 Mus musculus AIGP2 gene
           for axotomy induced glyco/golgi protein 2, complete
           cds.>gb:AF181685_2058082 Mus musculus membrane protein
           TMS-2 mRNA, complete cds.>gb:BC017148_2092449 Mus
           musculus tumor differentially expressed 2, mRNA (cDNA
           clone MGC:28838 IMAGE:4506673), complete cds.
          Length = 453

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 7/134 (5%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN--- 571
           AV R+  G   F+ +LS++MI +K+  DPR  +H+G W  K      ++I  FF+P    
Sbjct: 89  AVYRLCFGLAMFYLLLSLLMIKVKSSSDPRAAVHNGFWFFKFATAVAIIIGAFFIPEGTF 148

Query: 572 ELISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCY 739
             + FY   +  G+               H WN+ WV   E+     WY ALL  + + Y
Sbjct: 149 TTVWFYVGMA--GAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATALNY 206

Query: 740 VATFAITGVLFHFF 781
           + +     + F ++
Sbjct: 207 LLSLVAVVLFFVYY 220



>gb:BC088606_2565735 Xenopus tropicalis hypothetical LOC496872, mRNA
           (cDNA clone MGC:97860 IMAGE:6994069), complete cds.
          Length = 460

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 40/134 (29%), Positives = 62/134 (46%), Gaps = 7/134 (5%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN--- 571
           AV RV  G   FF + S++MI +K+ +DPR ++H+G W  K      + +  FF+P    
Sbjct: 97  AVYRVCFGMAMFFLLFSLLMIKVKSSQDPRASVHNGFWFFKFAAAVGITVGAFFIPEGPF 156

Query: 572 ELISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCY 739
             + FY      G+               H WN+ WV   E+     WY ALL  + + Y
Sbjct: 157 TTVWFYVGMG--GAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATGMNY 214

Query: 740 VATFAITGVLFHFF 781
           V +  +  VLF+ +
Sbjct: 215 VLSL-VAIVLFYVY 227



>gb:BC070534_2555516 Xenopus laevis cDNA clone MGC:78840
           IMAGE:3402765, complete cds.
          Length = 460

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 40/134 (29%), Positives = 62/134 (46%), Gaps = 7/134 (5%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN--- 571
           AV RV  G   FF + S++MI +K+ +DPR ++H+G W  K      + +  FF+P    
Sbjct: 97  AVYRVCFGMAMFFLLFSLLMIKVKSSQDPRASVHNGFWFFKFAAAVGITVGAFFIPEGPF 156

Query: 572 ELISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCY 739
             + FY      G+               H WN+ WV   E+     WY ALL  + + Y
Sbjct: 157 TTVWFYVGMG--GAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATGLNY 214

Query: 740 VATFAITGVLFHFF 781
           V +  +  VLF+ +
Sbjct: 215 VLSL-VAIVLFYVY 227



>gb:AY339894_2083881 Rattus norvegicus tumor differentially
           expressed 1-like protein mRNA, complete
           cds.>gb:BC088852_2110630 Rattus norvegicus tumor
           differentially expressed 1, like, mRNA (cDNA clone
           MGC:105269 IMAGE:7315523), complete cds.
          Length = 453

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 7/134 (5%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN--- 571
           AV R+  G   F+ +LS++MI +K+  DPR  +H+G W  K      ++I  FF+P    
Sbjct: 89  AVYRLCFGLAMFYLLLSLLMIKVKSSSDPRAAVHNGFWFFKFATAVAIIIGAFFIPEGTF 148

Query: 572 ELISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCY 739
             + FY   +  G+               H WN+ WV   E+     WY ALL  + + Y
Sbjct: 149 TTVWFYVGMA--GAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATALNY 206

Query: 740 VATFAITGVLFHFF 781
           + +     + F ++
Sbjct: 207 LLSLVAIILFFVYY 220



>gb:BC028607_1979293 Homo sapiens tumor differentially expressed 2,
           mRNA (cDNA clone MGC:33244 IMAGE:4794962), complete cds.
          Length = 453

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 36/134 (26%), Positives = 61/134 (45%), Gaps = 7/134 (5%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN--- 571
           +V R+  G   F+ +LS++MI +K+  DPR  +H+G W  K      ++I  FF+P    
Sbjct: 89  SVYRLCFGLAMFYLLLSLLMIKVKSSSDPRAAVHNGFWFFKFAAAIAIIIGAFFIPEGTF 148

Query: 572 ELISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCY 739
             + FY   +  G+               H WN+ WV   E+     WY ALL  + + Y
Sbjct: 149 TTVWFYVGMA--GAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATALNY 206

Query: 740 VATFAITGVLFHFF 781
           + +     + F ++
Sbjct: 207 LLSLVAIVLFFVYY 220



>gb:AX118871_1461493 Sequence 35 from Patent WO0129221.
          Length = 456

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 33/137 (24%), Positives = 61/137 (44%), Gaps = 6/137 (4%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN-EL 577
           AV R+      FF   +++M+ + + +DPR  + +G W  K +    L +  F++P+   
Sbjct: 96  AVYRMCFATAAFFFFFTLLMLCVSSSRDPRAAIQNGFWFFKFLILVGLTVGAFYIPDGSF 155

Query: 578 ISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVG----YDEQFWYVALLVVSLVCYVA 745
            + +      GS               H WN +W+G     D + WY  L   +L+ Y+ 
Sbjct: 156 TNIWFYFGVVGSFLFILIQLVLLIDFAHSWNQRWLGKAEECDSRAWYAGLFFFTLLFYLL 215

Query: 746 TFAITGVLFHFFA-PSG 793
           + A   ++F ++  PSG
Sbjct: 216 SIAAVALMFMYYTEPSG 232



>gb:AY539942_1178606 Rattus norvegicus LRRGT00191 mRNA, complete cds.
          Length = 1687

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 7/134 (5%)
 Frame = +2

Query: 401  AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN--- 571
            AV R+  G   F+ +LS++MI +K+  DPR  +H+G W  K      ++I  FF+P    
Sbjct: 1323 AVYRLCFGLAMFYLLLSLLMIKVKSSSDPRAAVHNGFWFFKFATAVAIIIGAFFIPEGTF 1382

Query: 572  ELISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCY 739
              + FY   +  G+               H WN+ WV   E+     WY ALL  + + Y
Sbjct: 1383 TTVWFYVGMA--GAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATALNY 1440

Query: 740  VATFAITGVLFHFF 781
            + +     + F ++
Sbjct: 1441 LLSLVAIILFFVYY 1454



>gb:AF352325_1150849 Homo sapiens FKSG84 mRNA, complete cds.
          Length = 456

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 33/137 (24%), Positives = 61/137 (44%), Gaps = 6/137 (4%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN-EL 577
           AV R+      FF   +++M+ + + +DPR  + +G W  K +    L +  F++P+   
Sbjct: 96  AVYRMCFATAAFFFFFTLLMLCVSSSRDPRAAIQNGFWFFKFLILVGLTVGAFYIPDGSF 155

Query: 578 ISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVG----YDEQFWYVALLVVSLVCYVA 745
            + +      GS               H WN +W+G     D + WY  L   +L+ Y+ 
Sbjct: 156 TNIWFYFGVVGSFLFILIQLVLLIDFAHSWNQRWLGKAEECDSRAWYAGLFFFTLLFYLL 215

Query: 746 TFAITGVLFHFFA-PSG 793
           + A   ++F ++  PSG
Sbjct: 216 SIAAVALMFMYYTEPSG 232



>sp|Q96SA4|TD2L_HUMAN Tumor differentially expressed 2-like (FKSG84
           protein) (UNQ263/PRO300).>gb:AY094595_1936365 Homo
           sapiens tumor differentially expressed protein 2 (TDE2)
           mRNA, complete cds.>gb:BC084580_1989900 Homo sapiens
           tumor differentially expressed 2-like, mRNA (cDNA clone
           MGC:90340 IMAGE:6500683), complete cds.
          Length = 456

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 33/137 (24%), Positives = 61/137 (44%), Gaps = 6/137 (4%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN-EL 577
           AV R+      FF   +++M+ + + +DPR  + +G W  K +    L +  F++P+   
Sbjct: 96  AVYRMCFATAAFFFFFTLLMLCVSSSRDPRAAIQNGFWFFKFLILVGLTVGAFYIPDGSF 155

Query: 578 ISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVG----YDEQFWYVALLVVSLVCYVA 745
            + +      GS               H WN +W+G     D + WY  L   +L+ Y+ 
Sbjct: 156 TNIWFYFGVVGSFLFILIQLVLLIDFAHSWNQRWLGKAEECDSRAWYAGLFFFTLLFYLL 215

Query: 746 TFAITGVLFHFFA-PSG 793
           + A   ++F ++  PSG
Sbjct: 216 SIAAVALMFMYYTEPSG 232



>gb:AJ720582_2502769 Gallus gallus mRNA for hypothetical protein,
           clone 20k12.
          Length = 472

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 36/132 (27%), Positives = 59/132 (44%), Gaps = 5/132 (3%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP-NEL 577
           AV R+S     FF + S++MI ++   DPR  +H+G W  K+     +++  F++P    
Sbjct: 97  AVYRISFAMAVFFFVFSLLMIAVRTSNDPRAAVHNGFWFFKIAAIVGIMVGAFYIPEGPF 156

Query: 578 ISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCYVA 745
              + +    G+               H WN+ WVG  E+     WY ALL  + + Y  
Sbjct: 157 TRAWFAIGVCGAFCFILIQLVFLVDFAHSWNESWVGRMEEGNSKCWYAALLSCTSLFYGL 216

Query: 746 TFAITGVLFHFF 781
           +     VLF+ F
Sbjct: 217 SVVFV-VLFYVF 227



>gb:BC045456_2549293 Danio rerio tumor differentially expressed 2,
           mRNA (cDNA clone IMAGE:3817550), partial cds.
          Length = 478

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 39/134 (29%), Positives = 62/134 (46%), Gaps = 7/134 (5%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN--- 571
           AV RV  G   FF + S++M+ +K+ +DPR  +H+G W  K      + +  FF+P    
Sbjct: 116 AVYRVCFGMAMFFLLFSLIMVKVKSSQDPRAAVHNGFWFFKFAAATAITVGAFFIPEGPF 175

Query: 572 ELISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCY 739
             + FY   +  G+               H WN+ WV   E+     WY ALL  + + Y
Sbjct: 176 TTVWFYIGMA--GAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATAINY 233

Query: 740 VATFAITGVLFHFF 781
            A   ++ VLF+ +
Sbjct: 234 -ALSLMSLVLFYVY 246



>gb:AL845365_2504652 Zebrafish DNA sequence from clone DKEY-150H13
           in linkage group 20 Contains the zebrafish hsf2 gene for
           heat shock factor 2, a novel gene similar to human TDE1
           (tumor differentially expressed 1), the 5' end of a
           novel gene and a CpG island, complete
           sequence.>gb:BC062825_2553414 Danio rerio tumor
           differentially expressed 2, mRNA (cDNA clone MGC:77597
           IMAGE:6996368), complete cds.
          Length = 459

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 39/134 (29%), Positives = 62/134 (46%), Gaps = 7/134 (5%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN--- 571
           AV RV  G   FF + S++M+ +K+ +DPR  +H+G W  K      + +  FF+P    
Sbjct: 97  AVYRVCFGMAMFFLLFSLIMVKVKSSQDPRAAVHNGFWFFKFAAATAITVGAFFIPEGPF 156

Query: 572 ELISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCY 739
             + FY   +  G+               H WN+ WV   E+     WY ALL  + + Y
Sbjct: 157 TTVWFYIGMA--GAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATAINY 214

Query: 740 VATFAITGVLFHFF 781
            A   ++ VLF+ +
Sbjct: 215 -ALSLMSLVLFYVY 227



>gb:AK031101_1162296 Mus musculus 13 days embryo forelimb cDNA,
           RIKEN full-length enriched library, clone:5930404O10
           product:tumor differentially expressed 1, full insert
           sequence.
          Length = 472

 Score = 60.5 bits (145), Expect = 4e-08
 Identities = 32/132 (24%), Positives = 56/132 (42%), Gaps = 5/132 (3%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVP-NEL 577
           AV R++      F    ++M+ +K  KDPR  +H+G W  K+     ++I  F++P    
Sbjct: 97  AVYRINFAVAIIFFAFFLLMLKVKTSKDPRAAVHNGFWFFKIAAIIGIMIGSFYIPGGSF 156

Query: 578 ISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCYVA 745
              +      G+               H WN+ WV   E+     WY ALL  + + Y+ 
Sbjct: 157 TEVWFVAGMLGASFFIIIQLVLLVDMAHSWNELWVNRMEEGNPRLWYAALLSFTSLFYIL 216

Query: 746 TFAITGVLFHFF 781
           +     +L+ F+
Sbjct: 217 SIVFAALLYVFY 228



>gb:AX136091_1461925 Sequence 13 from Patent EP1067182.
          Length = 273

 Score = 59.3 bits (142), Expect = 8e-08
 Identities = 36/134 (26%), Positives = 60/134 (44%), Gaps = 7/134 (5%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN--- 571
           AV R+  G    + +LS++MI +K+  DPR  +H+G W  K      ++I  FF+P    
Sbjct: 89  AVYRLCFGLAMSYLLLSLLMIKVKSSSDPRAAVHNGFWFFKFAAAIAIIIGAFFIPEGTF 148

Query: 572 ELISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQ----FWYVALLVVSLVCY 739
             + FY   +  G+               H WN+ WV   E+     WY ALL  + + Y
Sbjct: 149 TTVWFYVGMA--GAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATALNY 206

Query: 740 VATFAITGVLFHFF 781
           + +     + F ++
Sbjct: 207 LLSLVAIVLFFVYY 220



>gb:YLI575660_1727998 Yarrowia lipolytica iah1, mts1, stl1, sip3,
           coq6, cdc37, aep2, tRNA-Gly, tRNA-Thr and 5S rRNA genes
           and ORF1, ORF2, ORFX, ORF6, ORF7, ORF12, ORF13, ORF15,
           ORFY, ORF18 and retrotransposon Ylt1.
          Length = 463

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 42/186 (22%), Positives = 80/186 (43%), Gaps = 6/186 (3%)
 Frame = +2

Query: 254 SARIAYCGLFGLSLIVSWI-LREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNF 430
           + R+ Y  LF ++ I+SWI L + A   +E         K    E     AV R++    
Sbjct: 46  ATRVGYAVLFLVNSILSWIMLTDWAVKKLERFTLDYMKFKCLGEECTGFVAVQRMNFALG 105

Query: 431 TFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES-TSKF 607
            F  I+++  +G+ + K+PR  + +G W  K+     L++  F +P +    + +  +  
Sbjct: 106 VFHLIMALCWVGVHSTKNPRSKIQNGYWGFKIALGLALIVLCFLIPEKFFWCWGNYFAMI 165

Query: 608 GSGXXXXXXXXXXXXXXHGWNDKWV----GYDEQFWYVALLVVSLVCYVATFAITGVLFH 775
           GS               H W ++ +      D   W   L+  ++  Y+A+  +T +++ 
Sbjct: 166 GSAIFILIGLVLLVDFAHSWAEQCLERIEETDSGTWKFILVGSTMSMYIASIVLTILMYV 225

Query: 776 FFAPSG 793
           FF  SG
Sbjct: 226 FFCTSG 231



>gb:AY358560_1947439 Homo sapiens clone DNA40625 GACL263 (UNQ263)
           mRNA, complete cds.
          Length = 457

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 30/126 (23%), Positives = 57/126 (45%), Gaps = 6/126 (4%)
 Frame = +2

Query: 434 FFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN-ELISFYESTSKFG 610
           FF   +++M+ + + +DPR  + +G W  K +    L +  F++P+    + +      G
Sbjct: 108 FFFFFTLLMLCVSSSRDPRAAIQNGFWFFKFLILVGLTVGAFYIPDGSFTNIWFYFGVVG 167

Query: 611 SGXXXXXXXXXXXXXXHGWNDKWVG----YDEQFWYVALLVVSLVCYVATFAITGVLFHF 778
           S               H WN +W+G     D + WY  L   +L+ Y+ + A   ++F +
Sbjct: 168 SFLFILIQLVLLIDFAHSWNQRWLGKAEECDSRAWYAGLFFFTLLFYLLSIAAVALMFMY 227

Query: 779 FA-PSG 793
           +  PSG
Sbjct: 228 YTEPSG 233



>gb:AF498273_1905296 Homo sapiens developmentally regulated protein
           TPO1 mRNA, complete cds.
          Length = 423

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 42/173 (24%), Positives = 70/173 (40%), Gaps = 11/173 (6%)
 Frame = +2

Query: 254 SARIAYCGLFGLSLIVSWILRE--VAAPLMENIPWINHFHK-----TPDREWFETDAVLR 412
           S R  Y   F L +++  I+    VA  + E+IP+     K         +     AV R
Sbjct: 34  STRFMYALYFILVVVLCCIMMSTTVAHKMKEHIPFFEDMCKGIKAGDTCEKLVGYSAVYR 93

Query: 413 VSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE--LISF 586
           V  G   FF I  ++ + I N K  R ++H+G W  K++    +    FF+P++   ++ 
Sbjct: 94  VCFGMACFFFIFCLLTLKINNSKSCRAHIHNGFWFFKLLLLGAMCSGAFFIPDQDTFLNA 153

Query: 587 YESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVG--YDEQFWYVALLVVSLVCY 739
           +      G                H WN  W       + WY +L +V+L+ Y
Sbjct: 154 WRYVGAVGGFLFIGIQLLLLVEFAHKWNKNWTAGTASNKLWYASLALVTLIMY 206



>gb:OSJN00271_1697722 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0002J11, complete sequence.
          Length = 477

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 36/130 (27%), Positives = 64/130 (49%), Gaps = 7/130 (5%)
 Frame = +2

Query: 248 RRS--ARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTP-----DREWFETDAV 406
           RRS  AR AY  +F  + +++W +R+  A L+  +      H  P     D + F++  V
Sbjct: 22  RRSLRARYAYGLIFFATNLLAWFVRDYGAKLLRGL------HHVPVCGAGDSKCFQSGGV 75

Query: 407 LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISF 586
           LR+      FF ++     G +   + R++ H G W++K + + + +I  F VPN  I  
Sbjct: 76  LRI------FFWVMFATTFGTRKLHEVRNSWHSGCWILKFLVYAVSIIIPFIVPNIFIQL 129

Query: 587 YESTSKFGSG 616
           Y   ++ G+G
Sbjct: 130 YGEIARMGAG 139



>gb:CR382137_1670273 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 479

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 45/195 (23%), Positives = 82/195 (42%), Gaps = 17/195 (8%)
 Frame = +2

Query: 260 RIAYCGLFGLSLIVSWI-LREVAAPLME--NIPWINHFHKTPDREWFETDAVLRVSLGNF 430
           RI Y  +  L+ + SWI L       +E  +  +IN+       E     +V R++    
Sbjct: 42  RITYAFILLLNSLFSWIALSPFIVHKLEKASFGFINNKCGPDGSECISFTSVYRINFALG 101

Query: 431 TFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMF-FVPNELISFY-ESTSK 604
            F  IL+ +++ +K+  +PR  + +G W MK+  W  L+   F  +P+    FY  + + 
Sbjct: 102 IFHLILAGLLVNVKSTSNPRAVIQNGCWKMKIFAWLSLITVNFLLIPDNFFIFYGNNIAI 161

Query: 605 FGSGXXXXXXXXXXXXXXHGWNDKWV------------GYDEQFWYVALLVVSLVCYVAT 748
             S               H W +  +             Y+  FW   L+  +L  Y+++
Sbjct: 162 IFSTIFLGIGLILLVDFAHAWAETCLEKIEMEDLTGEGEYNAGFWKKLLIGGTLTMYISS 221

Query: 749 FAITGVLFHFFAPSG 793
             +T +++ FFA SG
Sbjct: 222 IVLTIIMYWFFAGSG 236



>gb:AK075863_1171063 Mus musculus adult male tongue cDNA, RIKEN
           full-length enriched library, clone:2310004K20
           product:FKSG84 homolog [Homo sapiens], full insert
           sequence.
          Length = 500

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 33/138 (23%), Positives = 58/138 (42%), Gaps = 7/138 (5%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN--- 571
           AV R+      FF    ++MI +++ +DPR  + +G W  K +    + +  F++P+   
Sbjct: 96  AVYRMCFATAAFFFFFMLLMICVRSSRDPRAAIQNGFWFFKFLILVGITVGAFYIPDGSF 155

Query: 572 ELISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWV----GYDEQFWYVALLVVSLVCY 739
             I FY      GS               H WN +W+      D   WY  L   + + Y
Sbjct: 156 PKIWFYFGV--VGSFLFILIQLILFVDFAHSWNQRWLCKAEECDSPAWYAGLFFFTFLFY 213

Query: 740 VATFAITGVLFHFFAPSG 793
           + + A   ++F ++  SG
Sbjct: 214 LLSIAAVALMFVYYTESG 231



>sp|Q8K0E7|TD2L_MOUSE Tumor differentially expressed
           2-like.>gb:BC031720_2097187 Mus musculus RIKEN cDNA
           2310004K20 gene, mRNA (cDNA clone MGC:25877
           IMAGE:4209575), complete cds.
          Length = 450

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 33/138 (23%), Positives = 58/138 (42%), Gaps = 7/138 (5%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN--- 571
           AV R+      FF    ++MI +++ +DPR  + +G W  K +    + +  F++P+   
Sbjct: 96  AVYRMCFATAAFFFFFMLLMICVRSSRDPRAAIQNGFWFFKFLILVGITVGAFYIPDGSF 155

Query: 572 ELISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWV----GYDEQFWYVALLVVSLVCY 739
             I FY      GS               H WN +W+      D   WY  L   + + Y
Sbjct: 156 PKIWFYFGV--VGSFLFILIQLILFVDFAHSWNQRWLCKAEECDSPAWYAGLFFFTFLFY 213

Query: 740 VATFAITGVLFHFFAPSG 793
           + + A   ++F ++  SG
Sbjct: 214 LLSIAAVALMFVYYTESG 231



>gb:AJ720286_2502473 Gallus gallus mRNA for hypothetical protein,
           clone 14b10.
          Length = 450

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 34/139 (24%), Positives = 62/139 (44%), Gaps = 8/139 (5%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN--- 571
           AV R+      FF + +++M+ +++ KDPR  + +G W  K +    L +  F++P+   
Sbjct: 95  AVYRMGFATAAFFFLFAMLMVCVRSSKDPRAAIQNGFWFFKFLLLVGLTVGAFYIPDGSF 154

Query: 572 ELISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWV----GYDEQFWYVALLVVSLVCY 739
             + FY      GS               H W+  W+      + + WY AL  V+ + Y
Sbjct: 155 TAVWFYFGV--VGSFLFILIQLILLIDFAHSWSQLWLRNAGESNAKGWYAALCTVTFIFY 212

Query: 740 VATFAITGVLFHFFA-PSG 793
            A+ A   +L+ ++  P G
Sbjct: 213 AASIAAIALLYVYYTKPQG 231



>gb:AF181686_1248326 Drosophila melanogaster membrane protein TMS1d
           mRNA, complete cds.
          Length = 465

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 35/135 (25%), Positives = 63/135 (46%), Gaps = 5/135 (3%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELI 580
           AV RV  G   FF ++S++M+G+K+ +DPR ++ +  W +K +  F   I   F+P+   
Sbjct: 103 AVYRVCFGMACFFALMSLIMLGVKSSRDPRSHIQNNFWPLKFLICFGAAIGAIFIPDG-- 160

Query: 581 SFYES---TSKFGSGXXXXXXXXXXXXXXHGWNDKWV--GYDEQFWYVALLVVSLVCYVA 745
           SF  +       G                H   + W+    + + +Y AL  V+L+CY+ 
Sbjct: 161 SFGPAMMWVGLIGGLAFILVQLVIIVDFAHSLAENWIESAENSRGYYYALAGVTLLCYIL 220

Query: 746 TFAITGVLFHFFAPS 790
           +     +L+ +F  S
Sbjct: 221 SLTGITLLYIYFTTS 235



>gb:AE014296_1136583 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003527_1214129 Drosophila melanogaster
           chromosome 3L, section 58 of 83 of the complete
           sequence.>gb:AY058257_1291411 Drosophila melanogaster
           GH01515 full length cDNA.
          Length = 465

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 35/135 (25%), Positives = 63/135 (46%), Gaps = 5/135 (3%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELI 580
           AV RV  G   FF ++S++M+G+K+ +DPR ++ +  W +K +  F   I   F+P+   
Sbjct: 103 AVYRVCFGMACFFALMSLIMLGVKSSRDPRSHIQNNFWPLKFLICFGAAIGAIFIPDG-- 160

Query: 581 SFYES---TSKFGSGXXXXXXXXXXXXXXHGWNDKWV--GYDEQFWYVALLVVSLVCYVA 745
           SF  +       G                H   + W+    + + +Y AL  V+L+CY+ 
Sbjct: 161 SFGPAMMWVGLIGGLAFILVQLVIIVDFAHSLAENWIESAENSRGYYYALAGVTLLCYIL 220

Query: 746 TFAITGVLFHFFAPS 790
           +     +L+ +F  S
Sbjct: 221 SLTGITLLYIYFTTS 235



>gb:AK037699_1164896 Mus musculus 16 days neonate thymus cDNA, RIKEN
           full-length enriched library, clone:A130038L21
           product:DEVELOPMENTALLY REGULATED PROTEIN homolog
           [Rattus norvegicus], full insert
           sequence.>gb:AK054475_1170842 Mus musculus 2 days
           pregnant adult female ovary cDNA, RIKEN full-length
           enriched library, clone:E330028O20
           product:DEVELOPMENTALLY REGULATED PROTEIN homolog
           [Rattus norvegicus], full insert
           sequence.>gb:BC049189_2099973 Mus musculus RIKEN cDNA
           A130038L21 gene, mRNA (cDNA clone MGC:54870
           IMAGE:6311617), complete cds.>gb:BC062131_2104886 Mus
           musculus RIKEN cDNA A130038L21 gene, mRNA (cDNA clone
           MGC:69958 IMAGE:6514513), complete cds.
          Length = 461

 Score = 54.3 bits (129), Expect = 3e-06
 Identities = 39/175 (22%), Positives = 68/175 (38%), Gaps = 12/175 (6%)
 Frame = +2

Query: 251 RSARIAYCGLFGLSLIVSWILR--EVAAPLMENIPWINHFHKTPD------REWFETDAV 406
           R+ R  Y   F L + +  ++    V   + ++IP+   F K                AV
Sbjct: 33  RTTRFMYLFYFILVIALCCVMMTPSVMKQVKDHIPFFEEFCKKTQAGGDACENLVGYSAV 92

Query: 407 LRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE--LI 580
            RV  G   FF +  ++ + + N K  R  +H+G W  K++    +    FF+P++   +
Sbjct: 93  YRVCFGMACFFALFCLLTLKVNNSKSCRAYIHNGFWFFKLLLLGAMCSGAFFIPDQETFL 152

Query: 581 SFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVG--YDEQFWYVALLVVSLVCY 739
             +      GS               H WN  W       + WY +L +V+L+ Y
Sbjct: 153 KVWRYVGAGGSFLFICIQLLLIVQFAHKWNKNWTAGTVRNKLWYASLSLVTLIMY 207



>gb:BC071500_2556237 Danio rerio zgc:55396, mRNA (cDNA clone
           IMAGE:6903035), partial cds.
          Length = 441

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 35/131 (26%), Positives = 57/131 (43%), Gaps = 5/131 (3%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN--E 574
           AV +V  G   FF   ++  I ++N    R  +H+G W  K +         FF+PN  +
Sbjct: 90  AVYKVCFGMACFFFFFAVFTIRVQNSTGCRAAVHNGFWFFKFVALLACCAGGFFLPNQDQ 149

Query: 575 LISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKW---VGYDEQFWYVALLVVSLVCYVA 745
            +  +      G                H WN  W   V Y+ + WY AL++V+LV +  
Sbjct: 150 FLEVWRYVGAAGGFLFIIIQLMLLVQFAHRWNQNWSSGVTYN-KLWYAALVLVTLVLF-- 206

Query: 746 TFAITGVLFHF 778
           + A+ G++F F
Sbjct: 207 SVAVGGMVFMF 217



>gb:RATDRP_2132093 Rattus norvegicus developmentally regulated
           protein (TPO1) mRNA, complete cds.
          Length = 460

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 43/183 (23%), Positives = 71/183 (38%), Gaps = 11/183 (6%)
 Frame = +2

Query: 251 RSARIAYCGLFGLSLIVSWILRE--VAAPLMENIPWINHFHK-----TPDREWFETDAVL 409
           RS R  Y   F L +I   ++    V   + E+IP+   F K               AV 
Sbjct: 33  RSTRFMYLFYFTLVIIPCCVMMSPSVMKQMTEHIPFFEDFCKGIKAGDTCENLVGYSAVY 92

Query: 410 RVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE--LIS 583
           RV  G   FF +  ++   + N K  R ++H+G W  K++    +    FF+P++   ++
Sbjct: 93  RVCFGMACFFFVFCVLTFKVNNSKSCRASIHNGFWFFKLLLLGAMCSGAFFIPDQETFLN 152

Query: 584 FYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVG--YDEQFWYVALLVVSLVCYVATFAI 757
            +      GS               H WN  W       + WY +L   SL   + + A+
Sbjct: 153 VWRYVGAVGSFFFICIQLLLIVEFAHKWNKNWTAGTVRNKLWYASL---SLALIMYSIAV 209

Query: 758 TGV 766
            G+
Sbjct: 210 GGL 212



>gb:AP002048_1821661 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MXP5.
          Length = 528

 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 40/186 (21%), Positives = 76/186 (40%), Gaps = 2/186 (1%)
 Frame = +2

Query: 236 SGISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDRE-WFETDAVLR 412
           +G +   AR  Y  +F ++ +++W  R+     +  +     F      E    TD VLR
Sbjct: 33  NGCNPWMARYVYGLIFLIANLLAWAARDYGRGALRKV---TRFKNCKGGENCLGTDGVLR 89

Query: 413 VSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYE 592
           +      F+ ++ +  +G       RD  H G W +K+I W  L I  F +P+ +I  Y 
Sbjct: 90  L------FYFVMFLSTLGTSKTHSSRDRWHSGWWFVKLIMWPALTIIPFLLPSSIIHLYG 143

Query: 593 STSKFGSGXXXXXXXXXXXXXXHGWNDKWVGY-DEQFWYVALLVVSLVCYVATFAITGVL 769
             + FG+G                 N+ +    D +   V ++++S   Y        ++
Sbjct: 144 EIAHFGAGVFLLIQLISVISFIQWLNECYQSQKDAERCRVYVMLLSTTSYTVCIVGVILM 203

Query: 770 FHFFAP 787
           + ++AP
Sbjct: 204 YIWYAP 209



>gb:AB029501_2044568 Mus musculus AIGP-3 mRNA for axotomy induced
           glycoprotein 3, complete cds.
          Length = 461

 Score = 52.8 bits (125), Expect = 8e-06
 Identities = 29/117 (24%), Positives = 49/117 (41%), Gaps = 4/117 (3%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE-- 574
           AV RV  G   FF +  ++ + + N K  R  +H+G W  K++    +    FF+P++  
Sbjct: 91  AVYRVCFGMACFFALFCLLTLKVNNSKSCRAYIHNGFWFFKLLLLGAMCSGAFFIPDQET 150

Query: 575 LISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVG--YDEQFWYVALLVVSLVCY 739
            +  +      GS               H WN  W       + WY +L +V+L+ Y
Sbjct: 151 FLKVWRYVGAGGSFLFICIQLLLIVQFAHKWNKNWTAGTVRNKLWYASLSLVTLIMY 207



>gb:CR382126_1658885 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 470

 Score = 52.8 bits (125), Expect = 8e-06
 Identities = 42/178 (23%), Positives = 74/178 (41%), Gaps = 7/178 (3%)
 Frame = +2

Query: 281 FGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVSLGNFTFFTILSIMM 460
           + L L+V+ ++  V+    ++I W +    +     F T   L  +LG      IL+ +M
Sbjct: 45  YALWLLVNSVISWVSMSTNKSILWPDKSCTSTGECGFFTVHRLNFALG--MMHIILAFIM 102

Query: 461 IGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGSG-XXXXXXX 637
           I IK+  D R  L +G W  K I + LL++F +++PNE   ++       SG        
Sbjct: 103 INIKSTADARAKLQNGAWSFKFIFYLLLILFAYWIPNEFYIWFSKWVSVPSGFVFILIGL 162

Query: 638 XXXXXXXHGWNDKWVGYDE------QFWYVALLVVSLVCYVATFAITGVLFHFFAPSG 793
                  H W +  +   E        W   L+  + + Y+ +  +  V+F  F   G
Sbjct: 163 VLLVDFAHEWAETCIQNVELEDERSSLWRKLLIGSTSLMYIGSAVMMVVMFTLFCHDG 220



>sp|Q12116|TMS1_YEAST Membrane protein TMS1.>pir|S51256|S51256
           probable membrane protein YDR105c - yeast (Saccharomyces
           cerevisiae)>gb:SC8557_1705715 S.cerevisiae chromosome IV
           cosmid 8557.>gb:SC9727_1706168 S.cerevisiae chromosome
           IV cosmid 9727.
          Length = 473

 Score = 52.8 bits (125), Expect = 8e-06
 Identities = 43/188 (22%), Positives = 75/188 (39%), Gaps = 7/188 (3%)
 Frame = +2

Query: 239 GISRRSARIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVLRVS 418
           G S    R+ Y     L+ ++SW    V+    ++I W            F T   L  +
Sbjct: 36  GSSSLGTRLLYAVWLLLNSLISW----VSYSANKSILWPGKTCTGTGECGFFTVHRLNFA 91

Query: 419 LGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYEST 598
           LG      IL++++ G+K+  D R  L +  W +K I +  L++  F +PN+   F+   
Sbjct: 92  LG--CLHLILALVLTGVKSTNDVRAALQNSWWSLKFILYLCLIVLSFVIPNDFYIFFSKW 149

Query: 599 SKFGSGX-XXXXXXXXXXXXXHGWNDKWVGY------DEQFWYVALLVVSLVCYVATFAI 757
               SG               H W +  + +      D  FW   L++ +   Y A+  +
Sbjct: 150 VSVPSGAIFILVGLILLVDFAHEWAETCISHVESEDEDSSFWQRFLVLGTTSMYTASIIM 209

Query: 758 TGVLFHFF 781
           T V++  F
Sbjct: 210 TVVMYVMF 217



>gb:BC072375_2556624 Xenopus laevis hypothetical protein LOC432116,
           mRNA (cDNA clone IMAGE:5078910), partial cds.
          Length = 355

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 29/137 (21%), Positives = 59/137 (43%), Gaps = 5/137 (3%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELI 580
           AV R+      FF +  I+MI +++ +DPR  + +G W  K +    + +  F++P+   
Sbjct: 110 AVYRMCFALAAFFFLFVILMICVRSSRDPRAAVQNGFWFFKFLILVGITVGAFYIPSGTF 169

Query: 581 SF-YESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDE----QFWYVALLVVSLVCYVA 745
           +  +      G                H W+  W+ + E    + WY AL++ + + Y A
Sbjct: 170 TIVWYYFGMVGGFLFILIQLILIIDLAHAWSQSWLQHAENGNSKCWYAALVICTFLLYTA 229

Query: 746 TFAITGVLFHFFAPSGQ 796
           +      L+ ++  S +
Sbjct: 230 SVIAIVFLYIYYTSSNE 246



>gb:AX497278_1469619 Sequence 45 from Patent
           WO0229058.>gb:AX497280_1469620 Sequence 47 from Patent
           WO0229058.>gb:AX497284_1469622 Sequence 51 from Patent
           WO0229058.
          Length = 457

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 32/136 (23%), Positives = 59/136 (43%), Gaps = 5/136 (3%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN-EL 577
           AV R+      FF   +++M+ + + +DPR  + +G W  K +    L +  F++P+   
Sbjct: 102 AVYRMCFATAAFFFFFTLLMLCVSSSRDPRAAIQNGFWFFKFLILVGLTVGAFYIPDGSF 161

Query: 578 ISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVG----YDEQFWYVALLVVSLVCYVA 745
            + +      GS               H WN +W+G     D + WY +L   S  C ++
Sbjct: 162 TNIWFYFGVVGSFLFILIQLVLLIDFAHSWNQRWLGKAEECDSRAWYASL--SSSTC-LS 218

Query: 746 TFAITGVLFHFFAPSG 793
             A+  +  ++  PSG
Sbjct: 219 IAAVALMFMYYTEPSG 234



>gb:BC044159_2548548 Danio rerio zgc:55396, mRNA (cDNA clone
           MGC:55396 IMAGE:2602344), complete cds.
          Length = 460

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 33/130 (25%), Positives = 53/130 (40%), Gaps = 4/130 (3%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN--E 574
           AV +V  G   FF   ++  I ++N    R  +H+G W  K +         FF+PN  +
Sbjct: 90  AVYKVCFGMACFFFFFAVFTIRVQNSTGCRAAVHNGFWFFKFVALLACCAGGFFLPNQDQ 149

Query: 575 LISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWV--GYDEQFWYVALLVVSLVCYVAT 748
            +  +      G                H WN  W       + WY AL +V+LV +  +
Sbjct: 150 FLEVWRYVGAAGGFLFIIIQLMLLVQFAHRWNQNWSSGATYNKLWYAALALVTLVLF--S 207

Query: 749 FAITGVLFHF 778
            A+ G++F F
Sbjct: 208 VAVGGMVFMF 217



>gb:AX497286_1469623 Sequence 53 from Patent WO0229058.
          Length = 457

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 33/137 (24%), Positives = 59/137 (43%), Gaps = 6/137 (4%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN-EL 577
           AV R+      FF   +++M+ + + +DPR  + +G W  K +    L +  F++P+   
Sbjct: 102 AVYRMCFATAAFFFFFTLLMLCVSSSRDPRAAIQNGFWFFKFLILVGLTVGAFYIPDGSF 161

Query: 578 ISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVG----YDEQFWYVALLVVSLVCYVA 745
            + +      GS               H WN +W+G     D + WY +L   S  C   
Sbjct: 162 TNIWFYFGVVGSFLFILIQLVLLIDFAHSWNQRWLGKAEECDSRAWYASL--SSSTC--L 217

Query: 746 TFAITGVLFHFFA-PSG 793
           + A   ++F ++  PSG
Sbjct: 218 SIAAAALMFMYYTEPSG 234



>gb:AX497282_1469621 Sequence 49 from Patent WO0229058.
          Length = 457

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 33/137 (24%), Positives = 59/137 (43%), Gaps = 6/137 (4%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPN-EL 577
           AV R+      FF   +++M+ + + +DPR  + +G W  K +    L +  F++P+   
Sbjct: 102 AVYRMCFATAAFFFFFTLLMLCVSSSRDPRAAIQNGFWFFKFLILVGLTVGAFYIPDGSF 161

Query: 578 ISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVG----YDEQFWYVALLVVSLVCYVA 745
            + +      GS               H WN +W+G     D + WY +L   S  C   
Sbjct: 162 TNIWFYFGVVGSFLFILIQLVLLIDFAHSWNQRWLGKAEECDSRAWYASL--SSSTC--P 217

Query: 746 TFAITGVLFHFFA-PSG 793
           + A   ++F ++  PSG
Sbjct: 218 SIAAVALMFMYYTEPSG 234



>sp|Q9HDY3|YK17_SCHPO Membrane protein
           PB1A10.07c.>gb:SPAPB1A10_1718648 S.pombe chromosome I
           BAC pB1A10.
          Length = 441

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 43/189 (22%), Positives = 77/189 (40%), Gaps = 7/189 (3%)
 Frame = +2

Query: 245 SRRSARIAYCGLFGLSLIVSWILRE--VAAPLMENIPWINHFHKTPDREWFETDAVLRVS 418
           S   A I+Y  L+ ++ ++SW +      + L +       F    D + +   AV R+S
Sbjct: 39  SNVGAVISYAVLYFVNSLLSWCMLSSWFNSKLSKLSAGYLQFDCQNDGKCYSVIAVHRLS 98

Query: 419 LGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES- 595
                F   L+ ++     +      + +G W  K++ WF+L IF FF+P + +SF+ + 
Sbjct: 99  FTLVMFHLFLAFILSLCNTRSRVAIKIQNGLWPFKIVLWFVLGIFSFFIPTKFLSFWGNI 158

Query: 596 TSKFGSGXXXXXXXXXXXXXXHGWNDKWVG----YDEQFWYVALLVVSLVCYVATFAITG 763
            S  GS               H W ++ V      D       L+  ++  YV    +T 
Sbjct: 159 ISVMGSALFIVYGLMLLVDFAHTWAERCVDRVLTSDSSSSKFYLIGSTVGMYVVGLVLTI 218

Query: 764 VLFHFFAPS 790
           + + FF  S
Sbjct: 219 LTYVFFCAS 227



>gb:AC024832_1204897 Caenorhabditis elegans cosmid Y57E12AL,
           complete sequence.
          Length = 459

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 32/133 (24%), Positives = 57/133 (42%), Gaps = 5/133 (3%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE-L 577
           AV RV     +F+ +  ++MIG+K+ KD R ++ +G W  K +    L++  FF+ +E L
Sbjct: 92  AVYRVCAATASFYLLFMLIMIGVKDSKDGRSSIQNGFWFFKYLILGALIVGFFFIRSESL 151

Query: 578 ISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWV-GYDE---QFWYVALLVVSLVCYVA 745
            +        G                HG  + WV  Y+E    + Y  LLV     +  
Sbjct: 152 ATPLMYIGLIGGFMFILIQLILIVDFAHGLAEAWVTSYEESESNYCYAGLLVTVFGGFAL 211

Query: 746 TFAITGVLFHFFA 784
                 +++ ++A
Sbjct: 212 ALTAVIIMYIYYA 224



>gb:AB027945_1517711 Schizosaccharomyces pombe gene for Hypothetical
           protein, partial cds, clone:TB35.
          Length = 188

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 35/149 (23%), Positives = 63/149 (42%), Gaps = 3/149 (2%)
 Frame = +2

Query: 245 SRRSARIAYCGLFGLSLIVSWILRE--VAAPLMENIPWINHFHKTPDREWFETDAVLRVS 418
           S   A I+Y  L+ ++ ++SW +      + L +       F    D + +   AV R+S
Sbjct: 39  SNVGAVISYAVLYFVNSLLSWCMLSSWFNSKLSKLSAGYLQFDCQNDGKCYSVIAVHRLS 98

Query: 419 LGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYES- 595
                F   L+ ++     +      + +G W  K++ WF+L IF FF+P + +SF+ + 
Sbjct: 99  FTLVMFHLFLAFILSLCNTRSRVAIKIQNGLWPFKIVLWFVLGIFSFFIPTKFLSFWGNI 158

Query: 596 TSKFGSGXXXXXXXXXXXXXXHGWNDKWV 682
            S  GS               H W ++ V
Sbjct: 159 ISVMGSALFIVYGLMLLVDFAHTWAERCV 187



>gb:CR380958_1653348 Candida glabrata strain CBS138 chromosome L
           complete sequence.
          Length = 477

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 29/120 (24%), Positives = 50/120 (41%), Gaps = 7/120 (5%)
 Frame = +2

Query: 443 ILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFYESTSKFGSG-X 619
           IL+  +I +K+ KD R  + +  W +K + + LL++  F +PNE   F+       SG  
Sbjct: 98  ILAGALIKVKSTKDARATIQNSWWSLKFLTYILLIVASFLIPNEFYIFFSKWVSVPSGVI 157

Query: 620 XXXXXXXXXXXXXHGWNDKWVGYDEQ------FWYVALLVVSLVCYVATFAITGVLFHFF 781
                        H W +  + + EQ      FW   L+  +   Y    A+T  ++  F
Sbjct: 158 FILVGLILLVDFAHEWAETCIFHVEQEDENSNFWKNFLVAGTASMYTGAIAMTIAMYIVF 217



>gb:AK044479_1166991 Mus musculus adult retina cDNA, RIKEN
           full-length enriched library, clone:A930015D22
           product:hypothetical TMS membrane protein/tumour
           differentially expressed protein (TDE) containing
           protein, full insert sequence.
          Length = 406

 Score = 45.1 bits (105), Expect = 0.002
 Identities = 30/135 (22%), Positives = 55/135 (40%), Gaps = 4/135 (2%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE-L 577
           AV RV  G  TF  + +++++ + +  +PR  LH+  W +K++    L +  F +P+E L
Sbjct: 27  AVYRVCAGTATFHLLQAVLLVRLHSPTNPRAQLHNSFWSLKLLFLLGLCVVAFCIPDEDL 86

Query: 578 ISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWV--GYDEQFWYVALLVVSLVCYVATF 751
              +      G                  WN  W      +  W++ + + +L  Y    
Sbjct: 87  FPAWHYIGICGGFTFILLQLVLITAFAQSWNKNWQTGAAQDCSWFLGVSLATLGFYSMAG 146

Query: 752 AITGVLFHFFA-PSG 793
               +LFH +  P G
Sbjct: 147 VGAVLLFHQYTHPDG 161



>pir|T24196|T24196 hypothetical protein R11H6.2 - Caenorhabditis
           elegans>gb:CER11H6_1366843 Caenorhabditis elegans cosmid
           R11H6, complete sequence.
          Length = 442

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 19/61 (31%), Positives = 35/61 (57%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELI 580
           AV RV  G  +FF +  ++M G+ + KD R ++ +G W  K +  F ++   FF+ +E +
Sbjct: 92  AVYRVCAGAASFFFLFMLLMFGVSSSKDGRSSIQNGFWFFKYLLMFGIIGGFFFIGSETL 151

Query: 581 S 583
           +
Sbjct: 152 A 152



>gb:BC083132_2108536 Mus musculus cDNA clone MGC:102317
           IMAGE:6466398, complete cds.
          Length = 492

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 30/135 (22%), Positives = 54/135 (40%), Gaps = 4/135 (2%)
 Frame = +2

Query: 401 AVLRVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNE-L 577
           AV RV  G  TF  + +++++ + +  +PR  LH+  W +K++    L +  F +P+E L
Sbjct: 113 AVYRVCAGTATFHLLQAVLLVRLHSPTNPRAQLHNSFWSLKLLFLLGLCVVAFCIPDEDL 172

Query: 578 ISFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWV--GYDEQFWYVALLVVSLVCYVATF 751
              +      G                  WN  W      +  W + + + +L  Y    
Sbjct: 173 FPAWHYIGICGGFTFILLQLVLITAFAQSWNKNWQTGAAQDCSWLLGVSLATLGFYSMAG 232

Query: 752 AITGVLFHFFA-PSG 793
               +LFH +  P G
Sbjct: 233 VGAVLLFHQYTHPDG 247



>gb:AE016820_1750054 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VII, complete sequence.
          Length = 475

 Score = 42.4 bits (98), Expect = 0.010
 Identities = 46/194 (23%), Positives = 79/194 (40%), Gaps = 11/194 (5%)
 Frame = +2

Query: 233 VSGISRRSA-RIAYCGLFGLSLIVSWILREVAAPLMENIPWINHFHKTPDREWFETDAVL 409
           VSG S   A R+ Y      + +VSWI       L+    W      +     F +   L
Sbjct: 35  VSGTSSSFATRLLYAVWLLFNSVVSWISMSSNHTLL----WPGQTCTSTGECGFFSVHRL 90

Query: 410 RVSLGNFTFFTILSIMMIGIKNQKDPRDNLHHGGWMMKVICWFLLVIFMFFVPNELISFY 589
             +LG      +L+ +++G+K+ K+PR  L +  W +KV  +  LV+  F +PN+   FY
Sbjct: 91  NFALG--MMHLLLAGVLVGVKSTKNPRAQLQNSWWWLKVAAYVGLVVAAFRIPND---FY 145

Query: 590 ESTSKFGS----GXXXXXXXXXXXXXXHGWNDKWVGYDEQ------FWYVALLVVSLVCY 739
            + S++ S                   H W +  + + E+      FW   L+V +   Y
Sbjct: 146 LTLSQWVSVPSGALFILIGLVLLVDFAHEWAEVCIQHVEEEDEHSTFWQRFLVVGTGALY 205

Query: 740 VATFAITGVLFHFF 781
           + T  +   +   F
Sbjct: 206 LVTILMNVAMIVLF 219



>gb:BX571662_779173 Wolinella succinogenes, complete genome; segment
           6/7.
          Length = 327

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%)
 Frame = +2

Query: 293 LIVSWILREVAAPLMENIPWINHFHKTP-DREWFETD 400
           L ++W++ E  APL+EN PWI+  +  P  R W   D
Sbjct: 31  LSITWVVDEAFAPLLENSPWIDTLYPLPLKRAWKSRD 67



>sp|Q58573|YB73_METJA Hypothetical protein MJ1173.>pir|D64446|D64446
           hypothetical protein MJ1173 - Methanococcus
           jannaschii>gb:U67559_207281 Methanocaldococcus
           jannaschii DSM 2661 section 101 of 150 of the complete
           genome.>gb:L77117_1100039 Methanocaldococcus jannaschii
           DSM 2661, complete genome.
          Length = 94

 Score = 35.0 bits (79), Expect = 1.6
 Identities = 24/82 (29%), Positives = 42/82 (51%), Gaps = 8/82 (9%)
 Frame = -1

Query: 673 VIPSMDKVQQKDNLNKKKQS*TKLRS*LIKADELIWNKKHKYY*KEPADDF---HHPSTM 503
           ++PS+DK+ QK +   KK    KL++ L K +E+  N  H    + P +DF   H   + 
Sbjct: 6   IMPSLDKILQKLSKRDKK----KLKAILKKMEEITQNPHHYKNLRHPLNDFKRVHIDKSF 61

Query: 502 VQIIT-----RVLLILYTNHHD 452
           V + T     + ++ +  +HHD
Sbjct: 62  VLVFTVDENNKTVIFVDFDHHD 83



>gb:AE017271_423418 Bacillus cereus ATCC 10987, section 8 of 18 of
           the complete genome.>gb:AE017194_1061837 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 648

 Score = 33.1 bits (74), Expect = 6.2
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 4/74 (5%)
 Frame = +2

Query: 533 WFLLVIFMFFVPNELI----SFYESTSKFGSGXXXXXXXXXXXXXXHGWNDKWVGYDEQF 700
           +FLL + M F+   LI    +F++  S    G              +  ++  VG D  F
Sbjct: 5   FFLLAVIMSFISGRLIGTKLNFFKQASAATLGVSLTSAMYWFLYLRYQ-DESIVGVDRYF 63

Query: 701 WYVALLVVSLVCYV 742
           W  + L+VS++CY+
Sbjct: 64  WLGSSLIVSMLCYL 77



>gb:AY526248_1333109 Trypanosoma cruzi putative amino acid
           transporter PAT7 gene, complete cds.
          Length = 448

 Score = 32.7 bits (73), Expect = 8.1
 Identities = 18/39 (46%), Positives = 23/39 (58%)
 Frame = -2

Query: 351 HGIFSMRGAATSRRIHETISDSPKRPQYAIRAERRLIPD 235
           HG +   G   SR I ET S++PK P   ++  RRLIPD
Sbjct: 13  HGAYEKDGDLNSR-IQET-SENPKEPNCIVKTTRRLIPD 49



>gb:AGA439353_1281919 Anopheles gambiae BAC clone 30E5.
          Length = 3325

 Score = 32.7 bits (73), Expect = 8.1
 Identities = 17/42 (40%), Positives = 23/42 (54%)
 Frame = -2

Query: 348  GIFSMRGAATSRRIHETISDSPKRPQYAIRAERRLIPDTTVR 223
            G   + G+  SRR    +SD P+  +  +  ERRLIP T VR
Sbjct: 1036 GTEDVGGSYFSRRSSLDVSDGPRESEVVVLKERRLIPITPVR 1077



>gb:BA000039_726697 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 389

 Score = 32.7 bits (73), Expect = 8.1
 Identities = 16/40 (40%), Positives = 21/40 (52%)
 Frame = -3

Query: 755 WQKLPHNIQVKQQARPHTRTAHHIQPICHSIHGQSPTKGQ 636
           WQ+L  + QV+Q   P  R  HH+  I    HGQ P  G+
Sbjct: 270 WQQLQDHPQVEQTGHPWQRLPHHLSLIVRDRHGQ-PLNGK 308


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 859,646,527
Number of Sequences: 1806583
Number of extensions: 18421626
Number of successful extensions: 53545
Number of sequences better than 10.0: 78
Number of HSP's better than 10.0 without gapping: 51737
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 53450
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 51696623407
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)