BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig6041
         (793 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T51100|T51100 protein phosphatase 2C homolog [imported] - co...   184   1e-45   Mesembryanthemum crystallinum
gb:AC091774_1735049 Oryza sativa chromosome 6 BAC OJ1540_H01 gen...   179   4e-44   
pir|T45768|T45768 protein phosphatase 2C-like protein - Arabidop...   171   1e-41   Arabidopsis thaliana [mouse-ear cress]
gb:FSY277744_1679409 Fagus sylvatica mRNA for ABA and calcium in...   169   4e-41   
gb:AF499718_1806141 Thellungiella halophila protein phosphatase ...   167   2e-40   
gb:BT020368_1642763 Arabidopsis thaliana At4g38520 gene, complet...   162   7e-39   
gb:AY062454_1565110 Arabidopsis thaliana putative protein phosph...   161   1e-38   
gb:AB011474_1511352 Arabidopsis thaliana genomic DNA, chromosome...   157   2e-37   
pir|T05680|T05680 hypothetical protein F20M13.80 - Arabidopsis t...   156   4e-37   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1023691 Oryza sativa (japonica cultivar-group) chrom...   145   6e-34   
gb:AC025783_1539526 Oryza sativa chromosome 10 BAC OSJNBa0001O14...   141   1e-32   
gb:BT004824_1637858 Arabidopsis thaliana At3g12620 gene, complet...   134   3e-30   
gb:AC069474_1540911 Arabidopsis thaliana chromosome 3 BAC T2E22 ...   132   6e-30   
gb:ATH302053_1552428 Arabidopsis thaliana PP2C6 gene for Ser/Thr...   132   1e-29   
pir|T47644|T47644 protein phosphatase 2C-like protein - Arabidop...   131   1e-29   Arabidopsis thaliana [mouse-ear cress]
gb:AP003228_1825694 Oryza sativa (japonica cultivar-group) genom...   108   9e-23   
pir|T48297|T48297 protein phosphatase-like protein - Arabidopsis...   106   4e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AB026636_1517062 Arabidopsis thaliana genomic DNA, chromosome...   102   1e-20   
gb:AY085196_1570275 Arabidopsis thaliana clone 13755 mRNA, compl...   101   1e-20   
gb:AP004071_1837263 Oryza sativa (japonica cultivar-group) genom...    95   1e-18   
gb:AP002032_1821486 Arabidopsis thaliana genomic DNA, chromosome...    93   5e-18   
gb:BT004178_1637275 Arabidopsis thaliana clone RAFL16-03-H10 (R2...    93   5e-18   
gb:AY084703_1569789 Arabidopsis thaliana clone 115504 mRNA, comp...    93   5e-18   
pir|T05220|T05220 hypothetical protein F17I5.110 - Arabidopsis t...    87   4e-16   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00188_1696448 Oryza sativa genomic DNA, chromosome 4, BAC...    86   1e-15   
gb:AC084282_1733427 Oryza sativa chromosome 3 BAC OSJNBb0048A17 ...    84   4e-15   
gb:AY831391_1629358 Oryza sativa (indica cultivar-group) BTH-ind...    79   7e-14   
gb:AY831390_1629357 Oryza sativa (indica cultivar-group) BTH-ind...    79   7e-14   
gb:AC105928_1738271 Oryza sativa (japonica cultivar-group) chrom...    77   4e-13   
gb:AC133339_1741424 Oryza sativa chromosome 3 BAC OSJNBa0078D06 ...    76   6e-13   
gb:AP005244_1849424 Oryza sativa (japonica cultivar-group) genom...    74   4e-12   
gb:AF079355_1766378 Mesembryanthemum crystallinum protein phosph...    61   3e-08   
pir|T51101|T51101 protein phosphatase-2c [imported] - common ice...    61   3e-08   Mesembryanthemum crystallinum
gb:FSY298988_1679422 Fagus sylvatica partial mRNA for protein ph...    46   7e-04   
gb:AP003228_1825695 Oryza sativa (japonica cultivar-group) genom...    44   0.003   
gb:AP004745_1844247 Oryza sativa (japonica cultivar-group) genom...    37   0.42    
pir|T45059|T45059 hypothetical protein Y39B6B.gg [imported] - Ca...    23   0.42    Caenorhabditis elegans [roundworm]
gb:OSJN00056_1694016 Oryza sativa genomic DNA, chromosome 4, BAC...    37   0.55    
gb:BC066440_2554330 Danio rerio zgc:55836, mRNA (cDNA clone MGC:...    36   0.94    
gb:BC045471_2549308 Danio rerio zgc:55836, mRNA (cDNA clone MGC:...    36   0.94    
gb:AP006844_1863015 Oryza sativa (japonica cultivar-group) genom...    36   0.94    
gb:AF480497_1803763 Oryza sativa clone BAC 24K23, complete seque...    36   0.94    
gb:AF260827_1781483 Ipomoea batatas cysteine protease mRNA, comp...    36   0.94    
gb:AY621066_1618344 Zea mays protein phosphatase 2C (PP2C) mRNA,...    35   1.2     
gb:AP003328_1827945 Oryza sativa (japonica cultivar-group) genom...    35   1.6     
pir|T06308|T06308 protein phosphatase 2C homolog F11C18.60 - Ara...    35   1.6     Arabidopsis thaliana [mouse-ear cress]
gb:BC044985_2548944 Xenopus laevis protein phosphatase 1D magnes...    35   2.1     
gb:AE013599_1130136 Drosophila melanogaster chromosome 2R, compl...    35   2.1     
pir|T05302|T05302 vacuolar processing enzyme (EC 3.4.22.-) isozy...    35   2.1     Arabidopsis thaliana [mouse-ear cress]
sp|Q39119|VPEG_ARATH|VPEG_ARATH Vacuolar processing enzyme, gamma-isozyme p...    35   2.1     Arabidopsis thaliana [mouse-ear cress]
gb:AY063973_1565918 Arabidopsis thaliana putative protein phosph...    34   2.7     
gb:AC006423_1534174 Arabidopsis thaliana chromosome I BAC F28H19...    34   2.7     
gb:AC116956_1206512 Dictyostelium discoideum chromosome 2 map 14...    34   2.7     
gb:AE005173_892584 Arabidopsis thaliana chromosome 1, bottom arm...    34   2.7     
gb:BC072934_2556858 Xenopus laevis MGC80458 protein, mRNA (cDNA ...    34   3.6     
gb:AC098598_1736781 Oryza sativa (japonica cultivar-group) chrom...    34   3.6     
gb:CR382130_1662592 Yarrowia lipolytica chromosome D of strain C...    33   4.7     
gb:AE014298_1125842 Drosophila melanogaster chromosome X, comple...    33   4.7     
gb:AP005445_1851901 Oryza sativa (japonica cultivar-group) genom...    33   6.1     
gb:AP005412_1851366 Oryza sativa (japonica cultivar-group) genom...    33   6.1     
gb:AF044219_1236071 Drosophila melanogaster HCG-1 protein (HCG-1...    33   6.1     
gb:AE014298_1124309 Drosophila melanogaster chromosome X, comple...    33   6.1     
pir|T13926|T13926 probable protein phosphatase 2C1 - fruit fly (...    33   6.1     Drosophila melanogaster
sp|P49044|VPE_VICSA|VPE_VICSA Vacuolar processing enzyme precursor (EC 3.4...    33   6.1     Vicia sativa [spring vetch]
gb:AB048336_1408446 Equus caballus DRPLA gene for atrophin-1, pa...    33   8.0     
gb:AC026301_1205237 Caenorhabditis elegans cosmid Y54F10BM, comp...    33   8.0     
gb:AE014296_1134029 Drosophila melanogaster chromosome 3L, compl...    33   8.0     
pir|H84643|H84643 probable protein phosphatase 2C [imported] - A...    33   8.0     Arabidopsis thaliana [mouse-ear cress]


>pir|T51100|T51100 protein phosphatase 2C homolog [imported] -
           common ice plant>gb:AF097667_1767893 Mesembryanthemum
           crystallinum protein phosphatase 2C homolog (PP2C) mRNA,
           complete cds.
          Length = 396

 Score =  184 bits (468), Expect = 1e-45
 Identities = 93/117 (79%), Positives = 100/117 (85%), Gaps = 1/117 (0%)
 Frame = +2

Query: 446 MLSRLINFLKTCWRSSSN-SHVRKGFDATCRQDGLLWYKDIGQHLLGDFSMAVVQANNLL 622
           MLSRLI+FLK CWR SS+ SH   G DA  RQDGLLWYKD GQH+ G+FSMAVVQANNLL
Sbjct: 1   MLSRLISFLKACWRPSSDRSH--SGSDAAGRQDGLLWYKDTGQHINGEFSMAVVQANNLL 58

Query: 623 EDQSQIESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPLFQHLQRFPTEQNSMT 793
           EDQSQIESG LSLLDSGPYGTFVGVYDGHGGPETSR+IND LF HL+RF  EQ SM+
Sbjct: 59  EDQSQIESGCLSLLDSGPYGTFVGVYDGHGGPETSRYINDHLFHHLKRFAAEQQSMS 115



>gb:AC091774_1735049 Oryza sativa chromosome 6 BAC OJ1540_H01
           genomic sequence, complete sequence.>gb:AP003769_1833296
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 6, PAC clone:P0541C02.
          Length = 392

 Score =  179 bits (455), Expect = 4e-44
 Identities = 84/116 (72%), Positives = 95/116 (81%)
 Frame = +2

Query: 446 MLSRLINFLKTCWRSSSNSHVRKGFDATCRQDGLLWYKDIGQHLLGDFSMAVVQANNLLE 625
           M+  L+N L+ CWR SSN H R G D   RQDGLLWYKD GQH+ G+FSMAVVQANNLLE
Sbjct: 1   MIVTLMNLLRACWRPSSNQHARAGSDVAGRQDGLLWYKDTGQHVNGEFSMAVVQANNLLE 60

Query: 626 DQSQIESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPLFQHLQRFPTEQNSMT 793
           DQ QIESG LS LDSGPYGTFVGVYDGHGGPET+ +IND LF HL+RF +EQNS++
Sbjct: 61  DQCQIESGPLSFLDSGPYGTFVGVYDGHGGPETACYINDHLFHHLKRFASEQNSIS 116



>pir|T45768|T45768 protein phosphatase 2C-like protein - Arabidopsis
           thaliana>gb:ATF26O13_1550138 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F26O13.
          Length = 379

 Score =  171 bits (434), Expect = 1e-41
 Identities = 84/117 (71%), Positives = 96/117 (82%), Gaps = 1/117 (0%)
 Frame = +2

Query: 446 MLSRLINFLKTC-WRSSSNSHVRKGFDATCRQDGLLWYKDIGQHLLGDFSMAVVQANNLL 622
           MLS L+  L  C W SSS+    K  D+T +QDGLLWYKD GQHL+G+FSMAVVQANNLL
Sbjct: 1   MLSTLMKLLSACLWPSSSSG---KSSDSTGKQDGLLWYKDFGQHLVGEFSMAVVQANNLL 57

Query: 623 EDQSQIESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPLFQHLQRFPTEQNSMT 793
           EDQSQ+ESG LS LDSGPYGTF+G+YDGHGGPETSRF+ND LFQHL+RF  EQ SM+
Sbjct: 58  EDQSQVESGPLSTLDSGPYGTFIGIYDGHGGPETSRFVNDHLFQHLKRFAAEQASMS 114



>gb:FSY277744_1679409 Fagus sylvatica mRNA for ABA and calcium
           induced protein phosphatase 2C (PP2C), (pp2C2 gene).
          Length = 397

 Score =  169 bits (429), Expect = 4e-41
 Identities = 79/116 (68%), Positives = 96/116 (82%)
 Frame = +2

Query: 446 MLSRLINFLKTCWRSSSNSHVRKGFDATCRQDGLLWYKDIGQHLLGDFSMAVVQANNLLE 625
           M S L+NFL+ C+R+ S+ HV  G +A  RQDGLLWYKD GQH  G+FS    QANNLLE
Sbjct: 1   MFSELMNFLRACFRAKSDRHVHTGSNARGRQDGLLWYKDSGQHFNGEFSYGCGQANNLLE 60

Query: 626 DQSQIESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPLFQHLQRFPTEQNSMT 793
           DQSQIESGSLSL ++GPYGTF+GVYDGHGGPETSR++N+ LFQHL+RF +EQ+SM+
Sbjct: 61  DQSQIESGSLSLNETGPYGTFIGVYDGHGGPETSRYVNNHLFQHLKRFTSEQHSMS 116



>gb:AF499718_1806141 Thellungiella halophila protein phosphatase
           2c-like protein mRNA, complete cds.
          Length = 378

 Score =  167 bits (424), Expect = 2e-40
 Identities = 83/117 (70%), Positives = 94/117 (80%), Gaps = 1/117 (0%)
 Frame = +2

Query: 446 MLSRLINFLKTC-WRSSSNSHVRKGFDATCRQDGLLWYKDIGQHLLGDFSMAVVQANNLL 622
           MLS L+  L  C W SSS     K  D+T +QDGLLWYKD GQHLLG+FSMAVVQANNLL
Sbjct: 1   MLSTLMKLLSACLWPSSSG----KSSDSTGKQDGLLWYKDSGQHLLGEFSMAVVQANNLL 56

Query: 623 EDQSQIESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPLFQHLQRFPTEQNSMT 793
           EDQSQ+ESG LS LDSGP+GTF+G+YDGHGGPETSRF+ND LFQHL+RF  E  SM+
Sbjct: 57  EDQSQVESGPLSTLDSGPFGTFIGIYDGHGGPETSRFVNDHLFQHLKRFAAEHASMS 113



>gb:BT020368_1642763 Arabidopsis thaliana At4g38520 gene, complete
           cds.
          Length = 400

 Score =  162 bits (410), Expect = 7e-39
 Identities = 78/116 (67%), Positives = 91/116 (78%)
 Frame = +2

Query: 446 MLSRLINFLKTCWRSSSNSHVRKGFDATCRQDGLLWYKDIGQHLLGDFSMAVVQANNLLE 625
           MLS L+NFL  C    S+   R   D+  RQ+GLLW++D GQH+ GDFSMAVVQAN+LLE
Sbjct: 1   MLSGLMNFLNACLWPRSDQQARSASDSGGRQEGLLWFRDSGQHVFGDFSMAVVQANSLLE 60

Query: 626 DQSQIESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPLFQHLQRFPTEQNSMT 793
           DQSQ+ESGSLS  DSGP+GTFVGVYDGHGGPETSRFIND +F HL+RF  EQ  M+
Sbjct: 61  DQSQLESGSLSSHDSGPFGTFVGVYDGHGGPETSRFINDHMFHHLKRFTAEQQCMS 116



>gb:AY062454_1565110 Arabidopsis thaliana putative protein
           phosphatase-2c (At4g38520; F20M13.80) mRNA, complete
           cds.
          Length = 400

 Score =  161 bits (408), Expect = 1e-38
 Identities = 78/116 (67%), Positives = 90/116 (77%)
 Frame = +2

Query: 446 MLSRLINFLKTCWRSSSNSHVRKGFDATCRQDGLLWYKDIGQHLLGDFSMAVVQANNLLE 625
           MLS L+NFL  C    S+   R   D+  RQ+GLLW+ D GQH+ GDFSMAVVQAN+LLE
Sbjct: 1   MLSGLMNFLNACLWPRSDQQARSASDSGGRQEGLLWFSDSGQHVFGDFSMAVVQANSLLE 60

Query: 626 DQSQIESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPLFQHLQRFPTEQNSMT 793
           DQSQ+ESGSLS  DSGP+GTFVGVYDGHGGPETSRFIND +F HL+RF  EQ  M+
Sbjct: 61  DQSQLESGSLSSHDSGPFGTFVGVYDGHGGPETSRFINDHMFHHLKRFTAEQQCMS 116



>gb:AB011474_1511352 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K2A18.>gb:AY062587_1565243 Arabidopsis
           thaliana protein phosphatase 2C-like protein (At5g66080;
           K2A18.16) mRNA, complete cds.>gb:BT001229_1635484
           Arabidopsis thaliana protein phosphatase 2C-like protein
           (At5g66080) mRNA, complete cds.
          Length = 385

 Score =  157 bits (398), Expect = 2e-37
 Identities = 79/117 (67%), Positives = 90/117 (76%), Gaps = 1/117 (0%)
 Frame = +2

Query: 446 MLSRLINFLKTCWRSSSNSHVRKGFDATCRQDGLLWYKDIGQHLLGDFSMAVVQANNLLE 625
           MLS   NFL +C   SS++      D+  +QDGLLWYKD   HL GDFSMAVVQANNLLE
Sbjct: 1   MLSLFFNFLTSCLWPSSSTTSHTYSDSKGKQDGLLWYKDSAHHLFGDFSMAVVQANNLLE 60

Query: 626 DQSQIESGSLSLL-DSGPYGTFVGVYDGHGGPETSRFINDPLFQHLQRFPTEQNSMT 793
           DQSQ+ESG L+ L  SGPYGTFVGVYDGHGGPETSRF+ND LF HL+RF  EQ+SM+
Sbjct: 61  DQSQVESGPLTTLSSSGPYGTFVGVYDGHGGPETSRFVNDHLFHHLKRFAAEQDSMS 117



>pir|T05680|T05680 hypothetical protein F20M13.80 - Arabidopsis
           thaliana>gb:ATCHRIV89_1547805 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           89.>gb:ATF20M13_1549511 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F20M13 (ESSA project).
          Length = 395

 Score =  156 bits (395), Expect = 4e-37
 Identities = 74/111 (66%), Positives = 87/111 (78%)
 Frame = +2

Query: 461 INFLKTCWRSSSNSHVRKGFDATCRQDGLLWYKDIGQHLLGDFSMAVVQANNLLEDQSQI 640
           +NFL  C    S+   R   D+  RQ+GLLW++D GQH+ GDFSMAVVQAN+LLEDQSQ+
Sbjct: 1   MNFLNACLWPRSDQQARSASDSGGRQEGLLWFRDSGQHVFGDFSMAVVQANSLLEDQSQL 60

Query: 641 ESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPLFQHLQRFPTEQNSMT 793
           ESGSLS  DSGP+GTFVGVYDGHGGPETSRFIND +F HL+RF  EQ  M+
Sbjct: 61  ESGSLSSHDSGPFGTFVGVYDGHGGPETSRFINDHMFHHLKRFTAEQQCMS 111



>gb:AE016959_1023691 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017116_1753510
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 70 of 77 of the complete sequence.
          Length = 393

 Score =  145 bits (367), Expect = 6e-34
 Identities = 73/118 (61%), Positives = 85/118 (72%), Gaps = 2/118 (1%)
 Frame = +2

Query: 446 MLSRLINFLKTCW--RSSSNSHVRKGFDATCRQDGLLWYKDIGQHLLGDFSMAVVQANNL 619
           MLS  + +L++CW   SS     RKG DA  RQDGLLWYKD GQ + G+FSMAVVQANNL
Sbjct: 1   MLSAAMEYLRSCWGPASSPAGRPRKGSDAAGRQDGLLWYKDAGQLVAGEFSMAVVQANNL 60

Query: 620 LEDQSQIESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPLFQHLQRFPTEQNSMT 793
           LED SQ+ESG LS  D    GT VGVYDGHGGPET+R+IND LF HL+ F +E   M+
Sbjct: 61  LEDHSQVESGPLSTTDPNLQGTLVGVYDGHGGPETARYINDHLFNHLRGFASEHKCMS 118



>gb:AC025783_1539526 Oryza sativa chromosome 10 BAC OSJNBa0001O14
           genomic sequence, complete sequence.
          Length = 388

 Score =  141 bits (356), Expect = 1e-32
 Identities = 70/113 (61%), Positives = 82/113 (72%), Gaps = 2/113 (1%)
 Frame = +2

Query: 461 INFLKTCW--RSSSNSHVRKGFDATCRQDGLLWYKDIGQHLLGDFSMAVVQANNLLEDQS 634
           + +L++CW   SS     RKG DA  RQDGLLWYKD GQ + G+FSMAVVQANNLLED S
Sbjct: 1   MEYLRSCWGPASSPAGRPRKGSDAAGRQDGLLWYKDAGQLVAGEFSMAVVQANNLLEDHS 60

Query: 635 QIESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPLFQHLQRFPTEQNSMT 793
           Q+ESG LS  D    GT VGVYDGHGGPET+R+IND LF HL+ F +E   M+
Sbjct: 61  QVESGPLSTTDPNLQGTLVGVYDGHGGPETARYINDHLFNHLRGFASEHKCMS 113



>gb:BT004824_1637858 Arabidopsis thaliana At3g12620 gene, complete
           cds.>gb:AP002044_1821615 Arabidopsis thaliana genomic
           DNA, chromosome 3, P1 clone: MMF12.
          Length = 385

 Score =  134 bits (336), Expect = 3e-30
 Identities = 60/112 (53%), Positives = 80/112 (71%)
 Frame = +2

Query: 458 LINFLKTCWRSSSNSHVRKGFDATCRQDGLLWYKDIGQHLLGDFSMAVVQANNLLEDQSQ 637
           ++  +  CWR  S        DA  R DGLLWYKD G H+ G+FSM+V+QANNLLED S+
Sbjct: 7   ILRMVAPCWRRPSVKGDHSTRDANGRCDGLLWYKDSGNHVAGEFSMSVIQANNLLEDHSK 66

Query: 638 IESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPLFQHLQRFPTEQNSMT 793
           +ESG +S+ DSGP  TFVGVYDGHGGPE +RF+N  LF ++++F +E + M+
Sbjct: 67  LESGPVSMFDSGPQATFVGVYDGHGGPEAARFVNKHLFDNIRKFTSENHGMS 118



>gb:AC069474_1540911 Arabidopsis thaliana chromosome 3 BAC T2E22
           genomic sequence, complete sequence.
          Length = 376

 Score =  132 bits (333), Expect = 6e-30
 Identities = 60/105 (57%), Positives = 77/105 (73%)
 Frame = +2

Query: 479 CWRSSSNSHVRKGFDATCRQDGLLWYKDIGQHLLGDFSMAVVQANNLLEDQSQIESGSLS 658
           CWR  S        DA  R DGLLWYKD G H+ G+FSM+V+QANNLLED S++ESG +S
Sbjct: 5   CWRRPSVKGDHSTRDANGRCDGLLWYKDSGNHVAGEFSMSVIQANNLLEDHSKLESGPVS 64

Query: 659 LLDSGPYGTFVGVYDGHGGPETSRFINDPLFQHLQRFPTEQNSMT 793
           + DSGP  TFVGVYDGHGGPE +RF+N  LF ++++F +E + M+
Sbjct: 65  MFDSGPQATFVGVYDGHGGPEAARFVNKHLFDNIRKFTSENHGMS 109



>gb:ATH302053_1552428 Arabidopsis thaliana PP2C6 gene for Ser/Thr
           protein phosphatase 2C, exons 1-2.>gb:BT014892_1641882
           Arabidopsis thaliana At3g55050 mRNA, complete cds.
          Length = 384

 Score =  132 bits (331), Expect = 1e-29
 Identities = 66/112 (58%), Positives = 79/112 (70%), Gaps = 7/112 (6%)
 Frame = +2

Query: 479 CWR-------SSSNSHVRKGFDATCRQDGLLWYKDIGQHLLGDFSMAVVQANNLLEDQSQ 637
           CWR       SS  S      D   R DGLLWYKD G H+ G+FSMAVVQANNLLED SQ
Sbjct: 13  CWRPFGIGEDSSPGSD-----DTNGRLDGLLWYKDSGNHITGEFSMAVVQANNLLEDHSQ 67

Query: 638 IESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPLFQHLQRFPTEQNSMT 793
           +ESG +SL +SGP  TFVGVYDGHGGPE +RF+ND LF +++R+ +EQ  M+
Sbjct: 68  LESGPISLHESGPEATFVGVYDGHGGPEAARFVNDRLFYNIKRYTSEQRGMS 119



>pir|T47644|T47644 protein phosphatase 2C-like protein - Arabidopsis
           thaliana>gb:ATT15C9_1554517 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T15C9.
          Length = 409

 Score =  131 bits (330), Expect = 1e-29
 Identities = 60/91 (65%), Positives = 73/91 (80%)
 Frame = +2

Query: 521 DATCRQDGLLWYKDIGQHLLGDFSMAVVQANNLLEDQSQIESGSLSLLDSGPYGTFVGVY 700
           D   R DGLLWYKD G H+ G+FSMAVVQANNLLED SQ+ESG +SL +SGP  TFVGVY
Sbjct: 54  DTNGRLDGLLWYKDSGNHITGEFSMAVVQANNLLEDHSQLESGPISLHESGPEATFVGVY 113

Query: 701 DGHGGPETSRFINDPLFQHLQRFPTEQNSMT 793
           DGHGGPE +RF+ND LF +++R+ +EQ  M+
Sbjct: 114 DGHGGPEAARFVNDRLFYNIKRYTSEQRGMS 144



>gb:AP003228_1825694 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0020E09.
          Length = 376

 Score =  108 bits (271), Expect = 9e-23
 Identities = 52/86 (60%), Positives = 65/86 (75%)
 Frame = +2

Query: 536 QDGLLWYKDIGQHLLGDFSMAVVQANNLLEDQSQIESGSLSLLDSGPYGTFVGVYDGHGG 715
           +DGLLWYKD G+H  GDFSMA+VQANNLLED SQ+E+  L LL      TFVG+YDGHGG
Sbjct: 26  RDGLLWYKDTGRHACGDFSMALVQANNLLEDASQVEAAPL-LLSHSSSTTFVGIYDGHGG 84

Query: 716 PETSRFINDPLFQHLQRFPTEQNSMT 793
           PET+ FI    F +L++F TEQ +++
Sbjct: 85  PETAHFIAQHFFPNLKKFATEQQTVS 110



>pir|T48297|T48297 protein phosphatase-like protein - Arabidopsis
           thaliana>gb:ATF9G14_1551379 Arabidopsis thaliana DNA
           chromosome 5, BAC clone F9G14 (ESSA project).
          Length = 361

 Score =  106 bits (265), Expect = 4e-22
 Identities = 52/94 (55%), Positives = 66/94 (70%)
 Frame = +2

Query: 470 LKTCWRSSSNSHVRKGFDATCRQDGLLWYKDIGQHLLGDFSMAVVQANNLLEDQSQIESG 649
           +K CWR  +    R   + T + DGL WYKD+G H  G+FSMA++QAN+++EDQ QIESG
Sbjct: 2   VKPCWRIGAGME-RSKINPT-KVDGLTWYKDLGLHTFGEFSMAMIQANSVMEDQCQIESG 59

Query: 650 SLSLLDSGPYGTFVGVYDGHGGPETSRFINDPLF 751
            L+  +    GTFVGVYDGHGGPE SRFI D +F
Sbjct: 60  PLTFNNPTVQGTFVGVYDGHGGPEASRFIADNIF 93



>gb:AB026636_1517062 Arabidopsis thaliana genomic DNA, chromosome 3,
           TAC clone:K14A17.
          Length = 379

 Score =  102 bits (253), Expect = 1e-20
 Identities = 46/81 (56%), Positives = 61/81 (75%)
 Frame = +2

Query: 536 QDGLLWYKDIGQHLLGDFSMAVVQANNLLEDQSQIESGSLSLLDSGPYGTFVGVYDGHGG 715
           +DGLLW++D+G++  GDFSMAV+QAN +LEDQSQ+ESG+        +GTFVGVYDGHGG
Sbjct: 37  KDGLLWFRDLGKYCGGDFSMAVIQANQVLEDQSQVESGN--------FGTFVGVYDGHGG 88

Query: 716 PETSRFINDPLFQHLQRFPTE 778
           PE +R++ D LF H +    E
Sbjct: 89  PEAARYVCDHLFNHFREISAE 109



>gb:AY085196_1570275 Arabidopsis thaliana clone 13755 mRNA, complete
           sequence.
          Length = 384

 Score =  101 bits (252), Expect = 1e-20
 Identities = 46/81 (56%), Positives = 61/81 (75%)
 Frame = +2

Query: 536 QDGLLWYKDIGQHLLGDFSMAVVQANNLLEDQSQIESGSLSLLDSGPYGTFVGVYDGHGG 715
           +DGLLW++D+G++  GDFSMAV+QAN +LEDQSQ+ESG+        +GTFVGVYDGHGG
Sbjct: 42  KDGLLWFRDLGKYCGGDFSMAVIQANQVLEDQSQVESGN--------FGTFVGVYDGHGG 93

Query: 716 PETSRFINDPLFQHLQRFPTE 778
           PE +R++ D LF H +    E
Sbjct: 94  PEAARYVCDHLFXHFREISAE 114



>gb:AP004071_1837263 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1717_A09.
          Length = 387

 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 46/85 (54%), Positives = 59/85 (69%)
 Frame = +2

Query: 539 DGLLWYKDIGQHLLGDFSMAVVQANNLLEDQSQIESGSLSLLDSGPYGTFVGVYDGHGGP 718
           DGLLW +D+G+H  G+FS AVVQAN  LED SQ+E+GS +        TFVGVYDGHGG 
Sbjct: 37  DGLLWSRDLGRHAAGEFSFAVVQANEALEDHSQVETGSAA--------TFVGVYDGHGGA 88

Query: 719 ETSRFINDPLFQHLQRFPTEQNSMT 793
           + +RFI+D LF HL R   E  +++
Sbjct: 89  DAARFISDHLFAHLIRLARESETVS 113



>gb:AP002032_1821486 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MPH15.
          Length = 386

 Score = 93.2 bits (230), Expect = 5e-18
 Identities = 44/91 (48%), Positives = 64/91 (70%)
 Frame = +2

Query: 521 DATCRQDGLLWYKDIGQHLLGDFSMAVVQANNLLEDQSQIESGSLSLLDSGPYGTFVGVY 700
           D++   D LLW +++ +H  GDFS+AVVQAN ++ED SQ+E+G+ ++        FVGVY
Sbjct: 28  DSSSSGDSLLWSRELERHSFGDFSIAVVQANEVIEDHSQVETGNGAV--------FVGVY 79

Query: 701 DGHGGPETSRFINDPLFQHLQRFPTEQNSMT 793
           DGHGGPE SR+I+D LF HL R   E++ ++
Sbjct: 80  DGHGGPEASRYISDHLFSHLMRVSRERSCIS 110



>gb:BT004178_1637275 Arabidopsis thaliana clone RAFL16-03-H10
           (R20953) putative protein phosphatase 2C (At5g06750)
           mRNA, complete cds.>gb:BT005462_1638402 Arabidopsis
           thaliana clone U20953 putative protein phosphatase 2C
           (At5g06750) mRNA, complete cds.
          Length = 393

 Score = 93.2 bits (230), Expect = 5e-18
 Identities = 44/91 (48%), Positives = 64/91 (70%)
 Frame = +2

Query: 521 DATCRQDGLLWYKDIGQHLLGDFSMAVVQANNLLEDQSQIESGSLSLLDSGPYGTFVGVY 700
           D++   D LLW +++ +H  GDFS+AVVQAN ++ED SQ+E+G+ ++        FVGVY
Sbjct: 35  DSSSSGDSLLWSRELERHSFGDFSIAVVQANEVIEDHSQVETGNGAV--------FVGVY 86

Query: 701 DGHGGPETSRFINDPLFQHLQRFPTEQNSMT 793
           DGHGGPE SR+I+D LF HL R   E++ ++
Sbjct: 87  DGHGGPEASRYISDHLFSHLMRVSRERSCIS 117



>gb:AY084703_1569789 Arabidopsis thaliana clone 115504 mRNA,
           complete sequence.
          Length = 393

 Score = 93.2 bits (230), Expect = 5e-18
 Identities = 44/91 (48%), Positives = 64/91 (70%)
 Frame = +2

Query: 521 DATCRQDGLLWYKDIGQHLLGDFSMAVVQANNLLEDQSQIESGSLSLLDSGPYGTFVGVY 700
           D++   D LLW +++ +H  GDFS+AVVQAN ++ED SQ+E+G+ ++        FVGVY
Sbjct: 35  DSSSSGDSLLWSRELERHSFGDFSIAVVQANEVIEDHSQVETGNGAV--------FVGVY 86

Query: 701 DGHGGPETSRFINDPLFQHLQRFPTEQNSMT 793
           DGHGGPE SR+I+D LF HL R   E++ ++
Sbjct: 87  DGHGGPEASRYISDHLFSHLMRVSRERSCIS 117



>pir|T05220|T05220 hypothetical protein F17I5.110 - Arabidopsis
           thaliana>gb:ATCHRIV80_1547353 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 80.>gb:ATF17I5_1548945
           Arabidopsis thaliana DNA chromosome 4, BAC clone F17I5
           (ESSA project).>gb:AY081718_1568978 Arabidopsis thaliana
           AT4g33920/F17I5_110 mRNA, complete
           cds.>gb:AY087982_1573006 Arabidopsis thaliana clone
           40123 mRNA, complete sequence.>gb:AF372953_1792667
           Arabidopsis thaliana AT4g33920/F17I5_110 mRNA, complete
           cds.
          Length = 380

 Score = 87.0 bits (214), Expect = 4e-16
 Identities = 42/85 (49%), Positives = 57/85 (67%)
 Frame = +2

Query: 539 DGLLWYKDIGQHLLGDFSMAVVQANNLLEDQSQIESGSLSLLDSGPYGTFVGVYDGHGGP 718
           DGLLW  ++  H  GD+S+AVVQAN+ LEDQSQ+ + S +        T+VGVYDGHGGP
Sbjct: 20  DGLLWQSELRPHAGGDYSIAVVQANSRLEDQSQVFTSSSA--------TYVGVYDGHGGP 71

Query: 719 ETSRFINDPLFQHLQRFPTEQNSMT 793
           E SRF+N  LF ++ +F  E   ++
Sbjct: 72  EASRFVNRHLFPYMHKFAREHGGLS 96



>gb:OSJN00188_1696448 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0088A01, complete sequence.
          Length = 388

 Score = 85.5 bits (210), Expect = 1e-15
 Identities = 42/85 (49%), Positives = 59/85 (69%)
 Frame = +2

Query: 539 DGLLWYKDIGQHLLGDFSMAVVQANNLLEDQSQIESGSLSLLDSGPYGTFVGVYDGHGGP 718
           D LLW +D+ +H  G+FS AVVQAN++LED SQ+E+G+ +        TF+GVYDGHGG 
Sbjct: 38  DLLLWSRDLVRHAAGEFSFAVVQANDVLEDHSQVETGAAA--------TFIGVYDGHGGA 89

Query: 719 ETSRFINDPLFQHLQRFPTEQNSMT 793
           E SRFI++ L  HL R   E+ +++
Sbjct: 90  EASRFISNHLAAHLVRLAQERGTIS 114



>gb:AC084282_1733427 Oryza sativa chromosome 3 BAC OSJNBb0048A17
           genomic sequence, complete sequence.
          Length = 380

 Score = 83.6 bits (205), Expect = 4e-15
 Identities = 40/85 (47%), Positives = 52/85 (61%)
 Frame = +2

Query: 539 DGLLWYKDIGQHLLGDFSMAVVQANNLLEDQSQIESGSLSLLDSGPYGTFVGVYDGHGGP 718
           DG+LW  ++  H  G+FSMA  QAN  +EDQ+Q+ +         P  T VGVYDGHGG 
Sbjct: 20  DGMLWQTELRPHAAGEFSMAAAQANLAMEDQAQVLAS--------PAATLVGVYDGHGGA 71

Query: 719 ETSRFINDPLFQHLQRFPTEQNSMT 793
           + SRF+   LF H+QRF  EQ  M+
Sbjct: 72  DASRFLRSRLFPHVQRFEKEQGGMS 96



>gb:AY831391_1629358 Oryza sativa (indica cultivar-group)
           BTH-induced protein phosphatase 2C 2 K3 form (BIPP2C2)
           mRNA, complete cds, alternatively spliced.
          Length = 255

 Score = 79.3 bits (194), Expect = 7e-14
 Identities = 39/85 (45%), Positives = 51/85 (60%)
 Frame = +2

Query: 539 DGLLWYKDIGQHLLGDFSMAVVQANNLLEDQSQIESGSLSLLDSGPYGTFVGVYDGHGGP 718
           DG+LW  ++  H  G+FSMA  QAN  +EDQ+Q+ +         P  T VGVYDGHGG 
Sbjct: 20  DGMLWQTELRPHAAGEFSMAAAQANLAMEDQAQVLAS--------PAATLVGVYDGHGGA 71

Query: 719 ETSRFINDPLFQHLQRFPTEQNSMT 793
           + SRF+   LF  +QRF  EQ  M+
Sbjct: 72  DASRFLRSRLFPLVQRFEKEQGGMS 96



>gb:AY831390_1629357 Oryza sativa (indica cultivar-group)
           BTH-induced protein phosphatase 2C 2 K2 form (BIPP2C2)
           mRNA, complete cds, alternatively spliced.
          Length = 380

 Score = 79.3 bits (194), Expect = 7e-14
 Identities = 39/85 (45%), Positives = 51/85 (60%)
 Frame = +2

Query: 539 DGLLWYKDIGQHLLGDFSMAVVQANNLLEDQSQIESGSLSLLDSGPYGTFVGVYDGHGGP 718
           DG+LW  ++  H  G+FSMA  QAN  +EDQ+Q+ +         P  T VGVYDGHGG 
Sbjct: 20  DGMLWQTELRPHAAGEFSMAAAQANLAMEDQAQVLAS--------PAATLVGVYDGHGGA 71

Query: 719 ETSRFINDPLFQHLQRFPTEQNSMT 793
           + SRF+   LF  +QRF  EQ  M+
Sbjct: 72  DASRFLRSRLFPLVQRFEKEQGGMS 96



>gb:AC105928_1738271 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0014O06, complete sequence.
          Length = 392

 Score = 77.0 bits (188), Expect = 4e-13
 Identities = 38/85 (44%), Positives = 50/85 (58%)
 Frame = +2

Query: 539 DGLLWYKDIGQHLLGDFSMAVVQANNLLEDQSQIESGSLSLLDSGPYGTFVGVYDGHGGP 718
           DGL+W   +  H  GD+S+AV QAN  LEDQ+Q+           P  T VGVYDGHGGP
Sbjct: 29  DGLVWDVALKAHASGDYSVAVAQANEALEDQAQVFVS--------PAATLVGVYDGHGGP 80

Query: 719 ETSRFINDPLFQHLQRFPTEQNSMT 793
           E +RF+N  LF  +Q F  +   ++
Sbjct: 81  EAARFVNKRLFSLIQEFAAQSGGIS 105



>gb:AC133339_1741424 Oryza sativa chromosome 3 BAC OSJNBa0078D06
           genomic sequence, complete sequence.
          Length = 386

 Score = 76.3 bits (186), Expect = 6e-13
 Identities = 47/129 (36%), Positives = 68/129 (52%), Gaps = 13/129 (10%)
 Frame = +2

Query: 446 MLSRLINFLKTC---W--------RSSSNSHVRKGFDATCRQ--DGLLWYKDIGQHLLGD 586
           ML  L+  L  C   W        RSSS+S      D    +  DGLLW++D+ +   G+
Sbjct: 1   MLGALLRLLSACGGVWPTSPAPPARSSSSSSAAAAADQAAAEGRDGLLWWRDLARCHAGE 60

Query: 587 FSMAVVQANNLLEDQSQIESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPLFQHLQR 766
            S+AVVQ N++LEDQ ++ESG   L       T +GV+DGH GP+ +RF  D L  +L+ 
Sbjct: 61  LSVAVVQGNHVLEDQCRVESGPPPLA-----ATCIGVFDGHAGPDAARFACDHLLPNLRE 115

Query: 767 FPTEQNSMT 793
             +    +T
Sbjct: 116 AASGPEGVT 124



>gb:AP005244_1849424 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1513_F02.
          Length = 377

 Score = 73.6 bits (179), Expect = 4e-12
 Identities = 38/91 (41%), Positives = 52/91 (57%), Gaps = 2/91 (2%)
 Frame = +2

Query: 515 GFDATCR--QDGLLWYKDIGQHLLGDFSMAVVQANNLLEDQSQIESGSLSLLDSGPYGTF 688
           G+ A  R  +D L W  ++  H  G+FSMA  QAN ++EDQ+Q+ +         P  T 
Sbjct: 8   GWPAAARGGRDELTWQAELTAHAAGEFSMAAAQANAVMEDQAQVMAS--------PGATL 59

Query: 689 VGVYDGHGGPETSRFINDPLFQHLQRFPTEQ 781
           VGVYDGHGGP+ SRF+   LF  +  F  E+
Sbjct: 60  VGVYDGHGGPDASRFLRSRLFPLIHEFAAER 90



>gb:AF079355_1766378 Mesembryanthemum crystallinum protein
           phosphatase-2c (PP2C) mRNA, partial cds.
          Length = 309

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 26/36 (72%), Positives = 30/36 (83%)
 Frame = +2

Query: 686 FVGVYDGHGGPETSRFINDPLFQHLQRFPTEQNSMT 793
           FVGVYDGHGGPETSR+IND LF HL+RF +E   M+
Sbjct: 1   FVGVYDGHGGPETSRYINDHLFHHLRRFASEHQCMS 36



>pir|T51101|T51101 protein phosphatase-2c [imported] - common ice
           plant  (fragment)
          Length = 309

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 26/36 (72%), Positives = 30/36 (83%)
 Frame = +2

Query: 686 FVGVYDGHGGPETSRFINDPLFQHLQRFPTEQNSMT 793
           FVGVYDGHGGPETSR+IND LF HL+RF +E   M+
Sbjct: 1   FVGVYDGHGGPETSRYINDHLFHHLRRFASEHQCMS 36



>gb:FSY298988_1679422 Fagus sylvatica partial mRNA for protein
           phosphatase 2C (pp2Cf2 gene), clone FsPP2Cf2.
          Length = 206

 Score = 46.2 bits (108), Expect = 7e-04
 Identities = 20/31 (64%), Positives = 26/31 (83%)
 Frame = +2

Query: 701 DGHGGPETSRFINDPLFQHLQRFPTEQNSMT 793
           DGHG  ETSR++N+ LFQHL+RF  EQ+SM+
Sbjct: 1   DGHGVLETSRYVNNHLFQHLKRFTLEQHSMS 31



>gb:AP003228_1825695 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0020E09.
          Length = 152

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 28/83 (33%), Positives = 46/83 (55%)
 Frame = -1

Query: 742 IIDKP*GLRPTMTIIYSNKSPIRTRIK*AQRSRLNLALILKQIVCLDNSH*EITKQVLPN 563
           + D+   LR TM I+ ++KS     +   +R   +LA IL+++VCL   H E+   V P 
Sbjct: 2   LCDEMSSLRATMAIVDADKSG-GGGVGEKKRGSFDLAGILEKVVCLHEGHREVAASVPPG 60

Query: 562 VLIPKKSILPASSIETLTDVAVG 494
           VL+P++SI  A+  E +  +  G
Sbjct: 61  VLVPEQSIPGAADGELVVGLEAG 83



>gb:AP004745_1844247 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0001B01.>gb:AP005470_1852433 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBa0043B22.
          Length = 440

 Score = 37.0 bits (84), Expect = 0.42
 Identities = 17/51 (33%), Positives = 31/51 (60%)
 Frame = +2

Query: 620 LEDQSQIESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPLFQHLQRFP 772
           +ED+  I+S +++    G   +  GV+DGHGGP  + ++   LF++L + P
Sbjct: 135 MEDRLSIKSTTVN----GETVSLFGVFDGHGGPRAAEYLKKHLFKNLVKHP 181



>pir|T45059|T45059 hypothetical protein Y39B6B.gg [imported] -
           Caenorhabditis elegans>gb:CEY39B6A_1369836
           Caenorhabditis elegans YAC Y39B6A, complete sequence.
          Length = 735

 Score = 23.5 bits (49), Expect(5) = 0.42
 Identities = 10/24 (41%), Positives = 11/24 (45%)
 Frame = -3

Query: 770 GTSGDAERGDH**TVRSPAHHDHH 699
           G    A  G H     +PAHH HH
Sbjct: 448 GHHSPAHHGHHGEHHHAPAHHGHH 471



 Score = 22.3 bits (46), Expect(5) = 0.42
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 722 SPAHHDHH 699
           SPAHH HH
Sbjct: 557 SPAHHGHH 564



 Score = 22.3 bits (46), Expect(5) = 0.42
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 722 SPAHHDHH 699
           SPAHH HH
Sbjct: 499 SPAHHGHH 506



 Score = 21.2 bits (43), Expect(5) = 0.42
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 722 SPAHHDHH 699
           +PAHH HH
Sbjct: 599 APAHHGHH 606



 Score = 21.2 bits (43), Expect(5) = 0.42
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 722 SPAHHDHH 699
           +PAHH HH
Sbjct: 535 APAHHGHH 542



>gb:OSJN00056_1694016 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0015K02, complete
           sequence.>gb:OSJN00153_1695787 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0011F23, complete
           sequence.
          Length = 282

 Score = 36.6 bits (83), Expect = 0.55
 Identities = 19/64 (29%), Positives = 27/64 (42%)
 Frame = +2

Query: 581 GDFSMAVVQANNLLEDQSQIESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPLFQHL 760
           G FS     +              +  +D    G F GV+DGHGG + + ++   LF HL
Sbjct: 24  GKFSYGYASSPGKRASMEDFYETRIDSVDGQIIGLF-GVFDGHGGAKVAEYVKQNLFSHL 82

Query: 761 QRFP 772
            R P
Sbjct: 83  LRHP 86



>gb:BC066440_2554330 Danio rerio zgc:55836, mRNA (cDNA clone
           MGC:77316 IMAGE:6966613), complete cds.
          Length = 535

 Score = 35.8 bits (81), Expect = 0.94
 Identities = 12/24 (50%), Positives = 19/24 (79%)
 Frame = +2

Query: 695 VYDGHGGPETSRFINDPLFQHLQR 766
           V+DGHGGP+ +RF  D L+ H+++
Sbjct: 103 VFDGHGGPDAARFARDHLWDHIKK 126



>gb:BC045471_2549308 Danio rerio zgc:55836, mRNA (cDNA clone
           MGC:55836 IMAGE:3818080), complete cds.
          Length = 535

 Score = 35.8 bits (81), Expect = 0.94
 Identities = 12/24 (50%), Positives = 19/24 (79%)
 Frame = +2

Query: 695 VYDGHGGPETSRFINDPLFQHLQR 766
           V+DGHGGP+ +RF  D L+ H+++
Sbjct: 103 VFDGHGGPDAARFARDHLWDHIKK 126



>gb:AP006844_1863015 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0052K15.
          Length = 363

 Score = 35.8 bits (81), Expect = 0.94
 Identities = 12/27 (44%), Positives = 20/27 (74%)
 Frame = +2

Query: 692 GVYDGHGGPETSRFINDPLFQHLQRFP 772
           GV+DGHGGP  + ++ + LF++L + P
Sbjct: 144 GVFDGHGGPRAAEYLKENLFENLLKHP 170



>gb:AF480497_1803763 Oryza sativa clone BAC 24K23, complete
           sequence.
          Length = 243

 Score = 35.8 bits (81), Expect = 0.94
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = +2

Query: 692 GVYDGHGGPETSRFINDPLFQHLQRFP 772
           GV+DGHGG + + ++   LF HL R P
Sbjct: 21  GVFDGHGGAKVAEYVKQNLFSHLLRHP 47



>gb:AF260827_1781483 Ipomoea batatas cysteine protease mRNA,
           complete cds.
          Length = 492

 Score = 35.8 bits (81), Expect = 0.94
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 4/58 (6%)
 Frame = +2

Query: 557 KDIGQHLLGDFSMAVVQANNLLE----DQSQIESGSLSLLDSGPYGTFVGVYDGHGGP 718
           +D+   +  D++   V ANNLL     D+S ++ GS  ++DSGP       Y  HGGP
Sbjct: 119 EDVYHGVPKDYTGDDVTANNLLAVILGDKSAVKGGSGKVVDSGPNDHIFIYYSDHGGP 176



>gb:AY621066_1618344 Zea mays protein phosphatase 2C (PP2C) mRNA,
           complete cds.
          Length = 290

 Score = 35.4 bits (80), Expect = 1.2
 Identities = 19/64 (29%), Positives = 27/64 (42%)
 Frame = +2

Query: 581 GDFSMAVVQANNLLEDQSQIESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPLFQHL 760
           G FS  V  +              +  +D    G F GVYDGHGG   + ++   LF +L
Sbjct: 20  GRFSYGVASSPGKRASMEDFYEARIDDVDGEKVGMF-GVYDGHGGVRAAEYVKQHLFSNL 78

Query: 761 QRFP 772
            + P
Sbjct: 79  IKHP 82



>gb:AP003328_1827945 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1040D09.
          Length = 187

 Score = 35.0 bits (79), Expect = 1.6
 Identities = 24/75 (32%), Positives = 37/75 (49%)
 Frame = +2

Query: 551 WYKDIGQHLLGDFSMAVVQANNLLEDQSQIESGSLSLLDSGPYGTFVGVYDGHGGPETSR 730
           W  D G+   G  S    +AN  +ED   I+S   S +D      F G++DGHGG   + 
Sbjct: 107 WTSDDGRMSCGYSSFRGRRAN--MEDFYDIKS---SKVDDNQINLF-GIFDGHGGSHAAE 160

Query: 731 FINDPLFQHLQRFPT 775
            +   LF++L + P+
Sbjct: 161 HLKKHLFENLLKHPS 175



>pir|T06308|T06308 protein phosphatase 2C homolog F11C18.60 -
           Arabidopsis thaliana>gb:ATCHRIV75_1547107 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           75.>gb:ATF11C18_1548265 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F11C18 (ESSA
           project).>gb:AY057611_1564024 Arabidopsis thaliana
           AT4g31860/F11C18_60 mRNA, complete
           cds.>gb:AY113024_1578184 Arabidopsis thaliana
           AT4g31860/F11C18_60 mRNA, complete cds.
          Length = 357

 Score = 35.0 bits (79), Expect = 1.6
 Identities = 16/44 (36%), Positives = 25/44 (56%)
 Frame = +2

Query: 629 QSQIESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPLFQHL 760
           ++ +E    ++LD     +F+GVYDGHGG   S+F    L Q +
Sbjct: 33  RASMEDAHAAILDLDDNTSFLGVYDGHGGKVVSKFCAKYLHQQV 76



>gb:BC044985_2548944 Xenopus laevis protein phosphatase 1D
           magnesium-dependent, delta isoform, mRNA (cDNA clone
           MGC:52997 IMAGE:5536900), complete cds.
          Length = 554

 Score = 34.7 bits (78), Expect = 2.1
 Identities = 13/27 (48%), Positives = 18/27 (66%)
 Frame = +2

Query: 686 FVGVYDGHGGPETSRFINDPLFQHLQR 766
           F  VYDGHGG E + F  D L+ H+++
Sbjct: 62  FFAVYDGHGGREAAHFARDHLWAHIRK 88



>gb:AE013599_1130136 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE013599_1130137 Drosophila melanogaster
           chromosome 2R, complete sequence.>gb:AE003787_1224598
           Drosophila melanogaster chromosome 2R, section 2 of 74
           of the complete sequence.>gb:AE003787_1224599 Drosophila
           melanogaster chromosome 2R, section 2 of 74 of the
           complete sequence.>gb:AY051748_1290342 Drosophila
           melanogaster LD27655 full length cDNA.
          Length = 662

 Score = 34.7 bits (78), Expect = 2.1
 Identities = 19/64 (29%), Positives = 33/64 (51%)
 Frame = +2

Query: 593 MAVVQANNLLEDQSQIESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPLFQHLQRFP 772
           +  V A+++   ++  E    S+L+     +F  VYDGHGG E +++  D L   L+   
Sbjct: 21  LLAVGASSMQGWRNSQEDAHNSILNFDNNTSFFAVYDGHGGAEVAQYCADKLPHFLKNLE 80

Query: 773 TEQN 784
           T +N
Sbjct: 81  TYKN 84



>pir|T05302|T05302 vacuolar processing enzyme (EC 3.4.22.-) isozyme
           gamma precursor - Arabidopsis
           thaliana>gb:ATCHRIV78_1547214 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           78.>gb:ATF26P21_1550169 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F26P21 (ESSA
           project).>gb:AY059104_1564468 Arabidopsis thaliana
           putative vacuolar processing enzyme gamma-VPE
           (At4g32940) mRNA, complete cds.>gb:AY133531_1581354
           Arabidopsis thaliana At4g32940/F26P21_60 mRNA, complete
           cds.>gb:AF370160_1792048 Arabidopsis thaliana putative
           vacuolar processing enzyme gamma-VPE (At4g32940) mRNA,
           complete cds.>gb:AF424619_1798957 Arabidopsis thaliana
           AT4g32940/F26P21_60 mRNA, complete cds.
          Length = 494

 Score = 34.7 bits (78), Expect = 2.1
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 4/58 (6%)
 Frame = +2

Query: 557 KDIGQHLLGDFSMAVVQANNL----LEDQSQIESGSLSLLDSGPYGTFVGVYDGHGGP 718
           KD+ Q +  D++   V  +NL    L D++ ++ GS  ++DSGP       Y  HGGP
Sbjct: 123 KDVYQGVPKDYTGDDVNVDNLFAVILGDKTAVKGGSGKVVDSGPNDHIFIFYSDHGGP 180



>sp|Q39119|VPEG_ARATH Vacuolar processing enzyme, gamma-isozyme
           precursor (EC 3.4.22.-) (Gamma-VPE).>gb:ATHGVPE_1553220
           Arabidopsis thaliana DNA for gamma-VPE, complete cds.
          Length = 490

 Score = 34.7 bits (78), Expect = 2.1
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 4/58 (6%)
 Frame = +2

Query: 557 KDIGQHLLGDFSMAVVQANNL----LEDQSQIESGSLSLLDSGPYGTFVGVYDGHGGP 718
           KD+ Q +  D++   V  +NL    L D++ ++ GS  ++DSGP       Y  HGGP
Sbjct: 119 KDVYQGVPKDYTGDDVNVDNLFAVILGDKTAVKGGSGKVVDSGPNDHIFIFYSDHGGP 176



>gb:AY063973_1565918 Arabidopsis thaliana putative protein
           phosphatase type 2C (At1g43900) mRNA, complete
           cds.>gb:AY117193_1579234 Arabidopsis thaliana putative
           protein phosphatase type 2C (At1g43900) mRNA, complete
           cds.
          Length = 371

 Score = 34.3 bits (77), Expect = 2.7
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = +2

Query: 668 SGPYGTFVGVYDGHGGPETSRFINDPLFQHL 760
           +G    F GV+DGHGG  T+ ++ + LF++L
Sbjct: 148 NGQMVAFFGVFDGHGGARTAEYLKNNLFKNL 178



>gb:AC006423_1534174 Arabidopsis thaliana chromosome I BAC F28H19
           genomic sequence, complete sequence.
          Length = 302

 Score = 34.3 bits (77), Expect = 2.7
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = +2

Query: 668 SGPYGTFVGVYDGHGGPETSRFINDPLFQHL 760
           +G    F GV+DGHGG  T+ ++ + LF++L
Sbjct: 148 NGQMVAFFGVFDGHGGARTAEYLKNNLFKNL 178



>gb:AC116956_1206512 Dictyostelium discoideum chromosome 2 map
           1418423-1684967 strain AX4, complete sequence.
          Length = 643

 Score = 34.3 bits (77), Expect = 2.7
 Identities = 15/55 (27%), Positives = 29/55 (52%)
 Frame = +2

Query: 623 EDQSQIESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPLFQHLQRFPTEQNS 787
           ED+ +++ G    L++  Y +  GV+DGHGG   S F+   +   + ++  E  +
Sbjct: 136 EDRHKVKMG----LENNQYLSLFGVFDGHGGDRASNFVKKKIVNCVNKYVKENKA 186



>gb:AE005173_892584 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC022314_1538858 Genomic sequence
           for Arabidopsis thaliana BAC F9C16 from chromosome I,
           complete sequence.
          Length = 396

 Score = 34.3 bits (77), Expect = 2.7
 Identities = 13/31 (41%), Positives = 21/31 (67%)
 Frame = +2

Query: 668 SGPYGTFVGVYDGHGGPETSRFINDPLFQHL 760
           +G    F GV+DGHGG  T+ ++ + LF++L
Sbjct: 148 NGQMVAFFGVFDGHGGARTAEYLKNNLFKNL 178



>gb:BC072934_2556858 Xenopus laevis MGC80458 protein, mRNA (cDNA
           clone MGC:80458 IMAGE:5156108), complete cds.
          Length = 554

 Score = 33.9 bits (76), Expect = 3.6
 Identities = 13/27 (48%), Positives = 17/27 (62%)
 Frame = +2

Query: 686 FVGVYDGHGGPETSRFINDPLFQHLQR 766
           F  VYDGHGG E + F  D L+ H+ +
Sbjct: 64  FFAVYDGHGGREAAHFARDRLWGHISK 90



>gb:AC098598_1736781 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1007_H05, complete sequence.
          Length = 491

 Score = 33.9 bits (76), Expect = 3.6
 Identities = 17/51 (33%), Positives = 29/51 (56%)
 Frame = +2

Query: 620 LEDQSQIESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPLFQHLQRFP 772
           +ED   I+S   S +D      F G++DGHGG   + ++ + LF++L + P
Sbjct: 242 MEDFYDIKS---SKIDDKQISLF-GIFDGHGGSRAAEYLKEHLFENLMKHP 288



>gb:CR382130_1662592 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 583

 Score = 33.5 bits (75), Expect = 4.7
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 5/65 (7%)
 Frame = +2

Query: 587 FSMAVVQANNLLEDQSQIESGSLSLLDSGPYGT-----FVGVYDGHGGPETSRFINDPLF 751
           + MA + +N+ +ED       S++L ++G         F G+YDGHGG  TS  + + L 
Sbjct: 160 YDMAQLPSNSPIEDDYSDRVVSVALNEAGNANASSDWMFWGLYDGHGGWTTSAKLREELI 219

Query: 752 QHLQR 766
            ++ R
Sbjct: 220 NYVIR 224



>gb:AE014298_1125842 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE014298_1125843 Drosophila melanogaster
           chromosome X, complete sequence.>gb:AE003500_1212851
           Drosophila melanogaster chromosome X, section 52 of 74
           of the complete sequence.>gb:AE003500_1212852 Drosophila
           melanogaster chromosome X, section 52 of 74 of the
           complete sequence.
          Length = 347

 Score = 33.5 bits (75), Expect = 4.7
 Identities = 25/84 (29%), Positives = 32/84 (38%)
 Frame = -3

Query: 722 SPAHHDHHILQQKSHKDQNQVSSKIQTQSGFDPQANCLPGQQPLRNHQASAAQCPYTKEV 543
           S +HH HH L Q  H  Q Q S   Q Q  F P + C      + + + S A       +
Sbjct: 106 SNSHHQHHQLHQHQHHHQQQQSQ--QQQQSFLPYSYCTDTIAAVHHQRQSYALVQKPPSL 163

Query: 542 HPAGK*HRNPYGRGCWMMSANRSS 471
              GK H         M S+  SS
Sbjct: 164 RYQGKPHHQLSNFSPTMTSSEPSS 187



>gb:AP005445_1851901 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0028E05.
          Length = 327

 Score = 33.1 bits (74), Expect = 6.1
 Identities = 18/64 (28%), Positives = 26/64 (40%)
 Frame = +2

Query: 581 GDFSMAVVQANNLLEDQSQIESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPLFQHL 760
           G FS     +              +  +D    G F GV+DGHGG   + F+   LF +L
Sbjct: 61  GKFSYGYASSPGKRSSMEDFYDTRIDGVDGETVGLF-GVFDGHGGARAAEFVKQNLFTNL 119

Query: 761 QRFP 772
            + P
Sbjct: 120 IKHP 123



>gb:AP005412_1851366 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0050G13.
          Length = 348

 Score = 33.1 bits (74), Expect = 6.1
 Identities = 18/64 (28%), Positives = 26/64 (40%)
 Frame = +2

Query: 581 GDFSMAVVQANNLLEDQSQIESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPLFQHL 760
           G FS     A              +  +D    G F GV+DGHGG   + ++   LF +L
Sbjct: 79  GKFSYGYASAPGKRASMEDFYETRIDGVDGETIGLF-GVFDGHGGARAAEYVKQHLFSNL 137

Query: 761 QRFP 772
            + P
Sbjct: 138 IKHP 141



>gb:AF044219_1236071 Drosophila melanogaster HCG-1 protein (HCG-1)
           mRNA, complete cds.>gb:AF044220_1236072 Drosophila
           melanogaster HCG-1 (HCG-1) gene, complete cds.
          Length = 347

 Score = 33.1 bits (74), Expect = 6.1
 Identities = 25/84 (29%), Positives = 31/84 (36%)
 Frame = -3

Query: 722 SPAHHDHHILQQKSHKDQNQVSSKIQTQSGFDPQANCLPGQQPLRNHQASAAQCPYTKEV 543
           S  HH HH L Q  H  Q Q S   Q Q  F P + C      + + + S A       +
Sbjct: 106 SNTHHQHHQLHQHQHHHQQQQSQ--QQQQSFLPYSYCTDTIAAVHHQRQSYALVQKPPSL 163

Query: 542 HPAGK*HRNPYGRGCWMMSANRSS 471
              GK H         M S+  SS
Sbjct: 164 RYQGKPHHQLSNFSPTMTSSEPSS 187



>gb:AE014298_1124309 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003431_1209491 Drosophila melanogaster
           chromosome X, section 15 of 74 of the complete
           sequence.>gb:AY069593_1294323 Drosophila melanogaster
           LD34192 full insert cDNA.
          Length = 1427

 Score = 33.1 bits (74), Expect = 6.1
 Identities = 16/43 (37%), Positives = 22/43 (51%)
 Frame = +2

Query: 620 LEDQSQIESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPL 748
           +EDQ  +      +     Y  F G+YDGHGGPE + F  + L
Sbjct: 270 MEDQFSVAYQESPITHELEYA-FFGIYDGHGGPEAALFAKEHL 311



>pir|T13926|T13926 probable protein phosphatase 2C1 - fruit fly
           (Drosophila melanogaster)>gb:DMU96697_1381141 Drosophila
           melanogaster DPP2C1 (dpp2c1) mRNA, complete cds.
          Length = 1428

 Score = 33.1 bits (74), Expect = 6.1
 Identities = 16/43 (37%), Positives = 22/43 (51%)
 Frame = +2

Query: 620 LEDQSQIESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPL 748
           +EDQ  +      +     Y  F G+YDGHGGPE + F  + L
Sbjct: 270 MEDQFSVAYQESPITHELEYA-FFGIYDGHGGPEAALFAKEHL 311



>sp|P49044|VPE_VICSA Vacuolar processing enzyme precursor (EC
           3.4.22.-) (VPE) (Proteinase B).>pir|S68984|S49175
           legumain (EC 3.4.22.34) precursor [similarity] - spring
           vetch>gb:VSCYSPROB_1727387 V.sativa L. (PROTB) mRNA for
           cysteine proteinase.
          Length = 493

 Score = 33.1 bits (74), Expect = 6.1
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 4/49 (8%)
 Frame = +2

Query: 584 DFSMAVVQANN----LLEDQSQIESGSLSLLDSGPYGTFVGVYDGHGGP 718
           D++ A V A+N    LL ++S +  GS  ++DSGP       Y  HGGP
Sbjct: 129 DYTGAEVHADNFYAALLGNKSALTGGSGKVVDSGPNDHIFVYYTDHGGP 177



>gb:AB048336_1408446 Equus caballus DRPLA gene for atrophin-1,
           partial cds, microsatellite TKY30.
          Length = 92

 Score = 32.7 bits (73), Expect = 8.0
 Identities = 21/74 (28%), Positives = 29/74 (39%), Gaps = 3/74 (4%)
 Frame = -3

Query: 722 SPAHHDHHILQQKSHKDQNQVSSKIQTQSGFDPQANCLPGQQPLRNHQASAAQCPYTKEV 543
           +P HH HH  QQ+  + Q Q   + Q Q            QQ  + H  S+   P     
Sbjct: 8   APTHHHHHQQQQQQQQQQQQQQQQQQQQQ-----------QQQQQQHHGSSGPPPPGAYP 56

Query: 542 HP---AGK*HRNPY 510
           HP   +   H +PY
Sbjct: 57  HPLESSSSHHAHPY 70



>gb:AC026301_1205237 Caenorhabditis elegans cosmid Y54F10BM,
           complete sequence.
          Length = 766

 Score = 32.7 bits (73), Expect = 8.0
 Identities = 12/28 (42%), Positives = 18/28 (64%)
 Frame = +2

Query: 683 TFVGVYDGHGGPETSRFINDPLFQHLQR 766
           TFVGV+DGHGG   S ++   L  ++ +
Sbjct: 52  TFVGVFDGHGGEHASEYVRRHLLMNITK 79



>gb:AE014296_1134029 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003468_1211328 Drosophila melanogaster
           chromosome 3L, section 2 of 83 of the complete
           sequence.>gb:AY089472_1297128 Drosophila melanogaster
           AT28366 full insert cDNA.
          Length = 352

 Score = 32.7 bits (73), Expect = 8.0
 Identities = 18/52 (34%), Positives = 26/52 (50%)
 Frame = +2

Query: 626 DQSQIESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPLFQHLQRFPTEQ 781
           D     +  LSL D  P   F  VYDGHGG   +++      +HL +F T++
Sbjct: 35  DMEDAHTHILSLPDD-PQAAFFAVYDGHGGASVAKYAG----KHLHKFITKR 81



>pir|H84643|H84643 probable protein phosphatase 2C [imported] -
           Arabidopsis thaliana>gb:AB079671_1523918 Arabidopsis
           thaliana AtPPC4;2 mRNA for protein phosphatase 2C,
           complete cds.>gb:AC006585_1534498 Arabidopsis thaliana
           chromosome 2 clone F27C12 map mi238, complete
           sequence.>gb:AY050873_1562367 Arabidopsis thaliana
           putative protein phosphatase 2C (At2g25070) mRNA,
           complete cds.>gb:AY091209_1574417 Arabidopsis thaliana
           putative protein phosphatase 2C (At2g25070) mRNA,
           complete cds.
          Length = 355

 Score = 32.7 bits (73), Expect = 8.0
 Identities = 15/44 (34%), Positives = 24/44 (54%)
 Frame = +2

Query: 629 QSQIESGSLSLLDSGPYGTFVGVYDGHGGPETSRFINDPLFQHL 760
           ++ +E    ++LD     +F GVYDGHGG   ++F    L Q +
Sbjct: 33  RATMEDAHAAILDLDDKTSFFGVYDGHGGKVVAKFCAKYLHQQV 76


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 821,285,663
Number of Sequences: 1806583
Number of extensions: 16945245
Number of successful extensions: 41950
Number of sequences better than 10.0: 68
Number of HSP's better than 10.0 without gapping: 40397
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 41860
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 50973593709
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)