BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig6028
         (928 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY065371_1566483 Arabidopsis thaliana unknown protein (At3g44...   335   1e-90   
pir|T49131|T49131 hypothetical protein F26G5.100 - Arabidopsis t...   319   6e-86   Arabidopsis thaliana [mouse-ear cress]
gb:AY046012_1561504 Arabidopsis thaliana unknown protein (At3g11...   295   1e-78   
gb:AC084296_1733456 Oryza sativa chromosome 3 BAC OSJNBb0024J04 ...   294   1e-78   
pir|F84534|F84534 hypothetical protein At2g15910 [imported] - Ar...   239   6e-62   Arabidopsis thaliana [mouse-ear cress]
gb:AC145811_1744508 Oryza sativa chromosome 3 BAC OSJNBb0088L13 ...   214   2e-54   
gb:ATAC016795_1543593 Arabidopsis thaliana chromosome III BAC F2...   181   2e-44   
pir|T46207|T46207 hypothetical protein T8P19.140 - Arabidopsis t...   163   4e-39   Arabidopsis thaliana [mouse-ear cress]
gb:AC084296_1733457 Oryza sativa chromosome 3 BAC OSJNBb0024J04 ...    95   2e-18   
gb:ATAC016795_1543592 Arabidopsis thaliana chromosome III BAC F2...    40   0.064   
gb:AP005165_1848575 Oryza sativa (japonica cultivar-group) genom...    36   1.2     
gb:OSJN00160_1695904 Oryza sativa genomic DNA, chromosome 4, BAC...    36   1.2     
gb:H0806H05_1681374 Oryza sativa genomic DNA, chromosome 4, BAC ...    36   1.2     
gb:CR382399_1374982 Plasmodium falciparum chromosome 6, complete...    34   4.6     
gb:HSM803461_1186975 Homo sapiens mRNA; cDNA DKFZp686D0714 (from...    34   4.6     
pir|T18472|T18472 hypothetical protein C0440c - malaria parasite...    34   4.6     Plasmodium falciparum 3D7
gb:BC023017_1978064 Homo sapiens, Similar to natriuretic peptide...    33   7.9     
gb:AL133410_1918507 Human DNA sequence from clone RP11-112J3 on ...    33   7.9     
gb:BTRGC_1437344 Bos taurus mRNA for retina guanylate cyclase.         33   7.9     
sp|P20594|ANPB_HUMAN|ANPB_HUMAN Atrial natriuretic peptide receptor B precu...    33   7.9     Homo sapiens [man]
sp|P46197|ANPB_BOVIN|ANPB_BOVIN Atrial natriuretic peptide receptor B precu...    33   7.9     Bos taurus [bovine]


>gb:AY065371_1566483 Arabidopsis thaliana unknown protein
           (At3g44150) mRNA, complete cds.>gb:AY150454_1585019
           Arabidopsis thaliana unknown protein (At3g44150) mRNA,
           complete cds.
          Length = 246

 Score =  335 bits (858), Expect = 1e-90
 Identities = 159/223 (71%), Positives = 190/223 (85%), Gaps = 2/223 (0%)
 Frame = +1

Query: 91  SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NA 264
           S +TN ++SPC+DT +Q+SDGFTFGI F++R + FIN +    V LSPCDRRLSL   N+
Sbjct: 28  SGNTNTIYSPCSDTRIQRSDGFTFGIAFSSRPSFFINQT----VLLSPCDRRLSLAAMNS 83

Query: 265 QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL 444
           Q +VFRPK+DEISLL++NTS+FFPD+ GGYMVAFAGRKYAARS PAF+AN ++IV+SFTL
Sbjct: 84  QFSVFRPKIDEISLLSINTSAFFPDNYGGYMVAFAGRKYAARSIPAFIANSTFIVTSFTL 143

Query: 445 VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF 624
           V EF+KGRLQNLYWKRDGCASCKG+  F CLN QDCA++T SCK RGG VDCSLGIQL F
Sbjct: 144 VMEFQKGRLQNLYWKRDGCASCKGNQNFVCLNKQDCAIRTPSCKGRGGAVDCSLGIQLAF 203

Query: 625 SGTDKHESVFNSWYEVKNLRQYSLYSVYSNLKDSLTSQYNKFF 753
           SGTDKH +V NSWYEV+NL+QYSLY +YSNLK SLT+Q+N FF
Sbjct: 204 SGTDKHLAVLNSWYEVENLKQYSLYGLYSNLKSSLTNQFNNFF 246



>pir|T49131|T49131 hypothetical protein F26G5.100 - Arabidopsis
           thaliana>gb:ATF26G5_1550098 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F26G5.
          Length = 240

 Score =  319 bits (817), Expect = 6e-86
 Identities = 154/223 (69%), Positives = 184/223 (82%), Gaps = 2/223 (0%)
 Frame = +1

Query: 91  SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSLN--NA 264
           S +TN ++SPC+DT +Q+SDGFTFGI F++R + FIN +    V LSPCDRRLSL   N+
Sbjct: 28  SGNTNTIYSPCSDTRIQRSDGFTFGIAFSSRPSFFINQT----VLLSPCDRRLSLAAMNS 83

Query: 265 QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL 444
           Q +VFRPK+DEISLL++NTS+FFPD+ GGYMVAFAGRKYAARS PAF+AN ++IV     
Sbjct: 84  QFSVFRPKIDEISLLSINTSAFFPDNYGGYMVAFAGRKYAARSIPAFIANSTFIV----- 138

Query: 445 VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF 624
             EF+KGRLQNLYWKRDGCASCKG+  F CLN QDCA++T SCK RGG VDCSLGIQL F
Sbjct: 139 -MEFQKGRLQNLYWKRDGCASCKGNQNFVCLNKQDCAIRTPSCKGRGGAVDCSLGIQLAF 197

Query: 625 SGTDKHESVFNSWYEVKNLRQYSLYSVYSNLKDSLTSQYNKFF 753
           SGTDKH +V NSWYEV+NL+QYSLY +YSNLK SLT+Q+N FF
Sbjct: 198 SGTDKHLAVLNSWYEVENLKQYSLYGLYSNLKSSLTNQFNNFF 240



>gb:AY046012_1561504 Arabidopsis thaliana unknown protein
           (At3g11800) mRNA, complete cds.>gb:AY079399_1568288
           Arabidopsis thaliana unknown protein (At3g11800) mRNA,
           complete cds.
          Length = 246

 Score =  295 bits (754), Expect = 1e-78
 Identities = 143/226 (63%), Positives = 180/226 (79%), Gaps = 5/226 (2%)
 Frame = +1

Query: 91  SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRR-LSLN-NA 264
           + D N V+SPC+D+TV   DGFTFGI FAA+++ F + +++K VQ SPCD R LSLN N+
Sbjct: 22  AGDNNQVYSPCSDSTVAIGDGFTFGIAFAAKDS-FFSTNRSKSVQYSPCDHRHLSLNGNS 80

Query: 265 QLAVFRPKVDEISLLTVNTSS---FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSS 435
           ++AVFRPKVDEI+LLT+NTSS   F PD+  GYMVAFAG KYAARS P  VA+ ++IV+S
Sbjct: 81  EVAVFRPKVDEITLLTINTSSSSSFRPDASKGYMVAFAGAKYAARSLPIMVADSNHIVTS 140

Query: 436 FTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQ 615
           FTLV EF+KGRL+N++WK+DGC+ C G S F CLN ++CA+K  +CKN+GG VDCSLGIQ
Sbjct: 141 FTLVLEFQKGRLENMFWKKDGCSKCSGDSKFVCLNKEECAIKPQNCKNQGGQVDCSLGIQ 200

Query: 616 LTFSGTDKHESVFNSWYEVKNLRQYSLYSVYSNLKDSLTSQYNKFF 753
           L FSGTDKH +  NSWYEV NL+QYSLY +YSNLKDSLT+ +   F
Sbjct: 201 LAFSGTDKHYTALNSWYEVANLKQYSLYGLYSNLKDSLTNPFKNIF 246



>gb:AC084296_1733456 Oryza sativa chromosome 3 BAC OSJNBb0024J04
           genomic sequence, complete sequence.
          Length = 253

 Score =  294 bits (753), Expect = 1e-78
 Identities = 149/227 (65%), Positives = 175/227 (77%), Gaps = 5/227 (2%)
 Frame = +1

Query: 88  SSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NN 261
           +  DTN V+ PCAD  VQ+ DGFTFG+ FAAR   F     +  VQLSPCD RLSL    
Sbjct: 33  AGGDTNGVYEPCADAAVQRGDGFTFGVAFAARGDFF-----SGGVQLSPCDGRLSLASKG 87

Query: 262 AQLAVFRPKVDEISLLTVNTSS---FFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVS 432
           A+LAVFRP+VDEISLLTVNTS+   F P + GGYMVAFAGRKYAARSPP FV+N SY V+
Sbjct: 88  AKLAVFRPEVDEISLLTVNTSAAGGFDPATSGGYMVAFAGRKYAARSPPVFVSNSSYTVT 147

Query: 433 SFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGI 612
           SFTLVFEF KG LQNLYWK +GC++C G   FTC++ Q+CA+ T +C  +GG+VDCS GI
Sbjct: 148 SFTLVFEFNKGTLQNLYWKANGCSACSGQPSFTCVD-QNCAISTANCTGKGGSVDCSPGI 206

Query: 613 QLTFSGTDKHESVFNSWYEVKNLRQYSLYSVYSNLKDSLTSQYNKFF 753
           QL FSGTDKHE+V NSWYEV  LRQYSL  ++SNLKDSLTSQ++ FF
Sbjct: 207 QLAFSGTDKHEAVLNSWYEVSKLRQYSLVGLFSNLKDSLTSQFSIFF 253



>pir|F84534|F84534 hypothetical protein At2g15910 [imported] -
           Arabidopsis thaliana>gb:AC006438_1534266 Arabidopsis
           thaliana chromosome 2 clone F19G14 map mi398, complete
           sequence.
          Length = 367

 Score =  239 bits (610), Expect = 6e-62
 Identities = 123/227 (54%), Positives = 156/227 (68%), Gaps = 13/227 (5%)
 Frame = +1

Query: 91  SSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NNA 264
           ++D N V+SPC+DT + K DGFT GI  +++ A F++      VQLSPCD RL L    A
Sbjct: 142 AADNNPVYSPCSDTQISKGDGFTIGIAISSKEAFFLDQ-----VQLSPCDTRLGLAAKMA 196

Query: 265 QLAVFRPKVDEISLLTVNTSSFFPDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTL 444
           QLA+FRPKVDEISLL+++TS F P   GG+MV FAG KYAARS P  VA+GS  +++FTL
Sbjct: 197 QLALFRPKVDEISLLSIDTSKFNPSEAGGFMVGFAGSKYAARSYPVKVADGSNTITAFTL 256

Query: 445 VF---------EFKKGRLQNLYWKRDGCASCKG--SSGFTCLNGQDCAMKTNSCKNRGGN 591
           V          EF+KG LQNL+WK  GC  CKG  SS   CLNG DCA+ T+ CK  GG 
Sbjct: 257 VMKLTLSPLVLEFQKGVLQNLFWKSFGCDLCKGTGSSSSVCLNGTDCAVPTSKCKANGGQ 316

Query: 592 VDCSLGIQLTFSGTDKHESVFNSWYEVKNLRQYSLYSVYSNLKDSLT 732
            +C++GIQ+ FSGTD++    N+WYEV NLRQYSL  +Y+N  DSL+
Sbjct: 317 ANCNIGIQVAFSGTDRNLESLNTWYEVNNLRQYSLTDLYANAVDSLS 363



>gb:AC145811_1744508 Oryza sativa chromosome 3 BAC OSJNBb0088L13
           genomic sequence, complete sequence.
          Length = 459

 Score =  214 bits (544), Expect = 2e-54
 Identities = 100/140 (71%), Positives = 114/140 (81%)
 Frame = +1

Query: 334 PDSVGGYMVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCASCK 513
           P + GGYMVAFAGRKYAARS P FV+N SY VSSFTLV EF KGRLQNL+WK+DGC +C 
Sbjct: 321 PATAGGYMVAFAGRKYAARSVPTFVSNSSYTVSSFTLVLEFNKGRLQNLHWKKDGCGACA 380

Query: 514 GSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSGTDKHESVFNSWYEVKNLRQYS 693
            SS   C+  Q CA +T SCK++ G VDCS+GIQL FSGTDKHESV NSWYEV NLRQYS
Sbjct: 381 KSSSLVCIGKQTCAFRTQSCKSQ-GPVDCSIGIQLAFSGTDKHESVLNSWYEVSNLRQYS 439

Query: 694 LYSVYSNLKDSLTSQYNKFF 753
           LY +YSNLKD+L+ Q+NKFF
Sbjct: 440 LYGLYSNLKDTLSGQFNKFF 459



 Score = 95.5 bits (236), Expect = 1e-18
 Identities = 51/103 (49%), Positives = 65/103 (63%), Gaps = 1/103 (0%)
 Frame = +1

Query: 28  ARPSAXXXXXXXXXXXXXAESSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDS 207
           A P +               ++ D N V+ PC+DT +Q+ DGF+FGI FA   A +   S
Sbjct: 146 APPHSLLLAAVALAALASVAAARDENGVYDPCSDTRIQRGDGFSFGIAFATLGAFYSGGS 205

Query: 208 KNKDVQLSPCDRRLSL-NNAQLAVFRPKVDEISLLTVNTSSFF 333
               VQLSPCDRRLSL ++ QLAVFRPKVDEISLLT+NT++ F
Sbjct: 206 ----VQLSPCDRRLSLASSGQLAVFRPKVDEISLLTINTTTGF 244



>gb:ATAC016795_1543593 Arabidopsis thaliana chromosome III BAC
           F26K24 genomic sequence, complete sequence.
          Length = 127

 Score =  181 bits (459), Expect = 2e-44
 Identities = 83/133 (62%), Positives = 102/133 (76%)
 Frame = +1

Query: 355 MVAFAGRKYAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTC 534
           MVAFAG KYAARS P  VA+ ++IV       EF+KGRL+N++WK+DGC+ C G S F C
Sbjct: 1   MVAFAGAKYAARSLPIMVADSNHIV------LEFQKGRLENMFWKKDGCSKCSGDSKFVC 54

Query: 535 LNGQDCAMKTNSCKNRGGNVDCSLGIQLTFSGTDKHESVFNSWYEVKNLRQYSLYSVYSN 714
           LN ++CA+K  +CKN+GG VDCSLGIQL FSGTDKH +  NSWYEV NL+QYSLY +YSN
Sbjct: 55  LNKEECAIKPQNCKNQGGQVDCSLGIQLAFSGTDKHYTALNSWYEVANLKQYSLYGLYSN 114

Query: 715 LKDSLTSQYNKFF 753
           LKDSLT+ +   F
Sbjct: 115 LKDSLTNPFKNIF 127



>pir|T46207|T46207 hypothetical protein T8P19.140 - Arabidopsis
           thaliana>gb:ATT8P19_1556538 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T8P19.
          Length = 122

 Score =  163 bits (413), Expect = 4e-39
 Identities = 75/103 (72%), Positives = 84/103 (81%)
 Frame = +1

Query: 445 VFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGNVDCSLGIQLTF 624
           V EF+KGRLQNLYWKRD CASCKG+  F CL  Q CA++T SCK RGG+V CSLGIQL F
Sbjct: 20  VMEFQKGRLQNLYWKRDVCASCKGNQNFVCLKKQVCAIRTPSCKGRGGSVGCSLGIQLAF 79

Query: 625 SGTDKHESVFNSWYEVKNLRQYSLYSVYSNLKDSLTSQYNKFF 753
           SGTDKH +V NSWYEV NL+QYSLY +YSNLK SLT+Q N FF
Sbjct: 80  SGTDKHLAVLNSWYEVDNLKQYSLYGLYSNLKSSLTNQLNNFF 122



>gb:AC084296_1733457 Oryza sativa chromosome 3 BAC OSJNBb0024J04
           genomic sequence, complete sequence.
          Length = 123

 Score = 94.7 bits (234), Expect = 2e-18
 Identities = 51/82 (62%), Positives = 59/82 (71%), Gaps = 2/82 (2%)
 Frame = +1

Query: 88  SSSDTNHVFSPCADTTVQKSDGFTFGIVFAARNATFINDSKNKDVQLSPCDRRLSL--NN 261
           +  DTN V+ PCAD  VQ+ DGFTFG+ FAAR   F     +  VQLSPCD RLSL    
Sbjct: 33  AGGDTNGVYEPCADAAVQRGDGFTFGVAFAARGDFF-----SGGVQLSPCDGRLSLASKG 87

Query: 262 AQLAVFRPKVDEISLLTVNTSS 327
           A+LAVFRP+VDEISLLTVNTS+
Sbjct: 88  AKLAVFRPEVDEISLLTVNTSA 109



>gb:ATAC016795_1543592 Arabidopsis thaliana chromosome III BAC
           F26K24 genomic sequence, complete sequence.
          Length = 78

 Score = 40.0 bits (92), Expect = 0.064
 Identities = 29/68 (42%), Positives = 43/68 (63%), Gaps = 5/68 (7%)
 Frame = -2

Query: 336 REEAGG---VDGEKRDLVDFRSEDSELSV-VEGE-AAVAGRQLDIFVFAVVDEGSVPRRE 172
           R E GG   +DG++ DL+DFRSE  +L V VE E A +AGR L+ F  ++  E  + R E
Sbjct: 5   RAETGGTRGIDGKECDLIDFRSEHGDLRVSVEREMAMIAGRVLNGF-GSICTEERIFRSE 63

Query: 171 YDSEGEAV 148
            ++E E++
Sbjct: 64  GNAESESI 71



>gb:AP005165_1848575 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBa0057M23.
          Length = 513

 Score = 35.8 bits (81), Expect = 1.2
 Identities = 30/129 (23%), Positives = 56/129 (43%), Gaps = 6/129 (4%)
 Frame = +1

Query: 202 DSKNKDVQLSPCDRRLSLNNAQL--AVFRPKVDEISLLTVNTSSFFPDSVGGYM--VAFA 369
           + K + V+ S   RR++     L  ++F   +DE S  TV    +F      ++  + F 
Sbjct: 91  EEKEQQVRNSSFPRRIACATKSLISSIFHGNIDEPSRSTVQRFEWFAKGADDFLKSLEFG 150

Query: 370 G--RKYAARSPPAFVANGSYIVSSFTLVFEFKKGRLQNLYWKRDGCASCKGSSGFTCLNG 543
           G  R+Y    P        ++++  TL ++F +G  Q+L+W R    + +G         
Sbjct: 151 GTPRRYLFFDPLI-----GHLLAGETLEYKFVQGNKQHLFWIRPNDIADRGVEAKLIFVY 205

Query: 544 QDCAMKTNS 570
            DC+   N+
Sbjct: 206 NDCSAPENN 214



>gb:OSJN00160_1695904 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0019G23, complete sequence.
          Length = 276

 Score = 35.8 bits (81), Expect = 1.2
 Identities = 21/66 (31%), Positives = 26/66 (39%), Gaps = 1/66 (1%)
 Frame = +1

Query: 391 SPPAFVANGSYIVSSFTLVFEF-KKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTN 567
           S PA   +G Y+  S T        G     +W R GCA    +  FTC    DC     
Sbjct: 66  SSPALARSGFYLAPSGTYHLAAPSSGTWSGTFWARTGCAVDSSTGRFTCATA-DCGSGDV 124

Query: 568 SCKNRG 585
           +C  RG
Sbjct: 125 ACNGRG 130



>gb:H0806H05_1681374 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: H0806H05, complete sequence.
          Length = 264

 Score = 35.8 bits (81), Expect = 1.2
 Identities = 21/66 (31%), Positives = 26/66 (39%), Gaps = 1/66 (1%)
 Frame = +1

Query: 391 SPPAFVANGSYIVSSFTLVFEF-KKGRLQNLYWKRDGCASCKGSSGFTCLNGQDCAMKTN 567
           S PA   +G Y+  S T        G     +W R GCA    +  FTC    DC     
Sbjct: 54  SSPALARSGFYLAPSGTYHLAAPSSGTWSGTFWARTGCAVDSSTGRFTCATA-DCGSGDV 112

Query: 568 SCKNRG 585
           +C  RG
Sbjct: 113 ACNGRG 118



>gb:CR382399_1374982 Plasmodium falciparum chromosome 6, complete
           sequence; segment 2/5.
          Length = 156

 Score = 33.9 bits (76), Expect = 4.6
 Identities = 12/36 (33%), Positives = 23/36 (63%)
 Frame = +3

Query: 117 AVRRYDGTEVRRLHLRNRIRGEERYLHQRQQKQRCP 224
           A+ +YDG+E+  L ++  I  +  Y ++++ K RCP
Sbjct: 120 AIDKYDGSEIEGLSIKMEILHKRNYTYKKKYKSRCP 155



>gb:HSM803461_1186975 Homo sapiens mRNA; cDNA DKFZp686D0714 (from
           clone DKFZp686D0714).
          Length = 394

 Score = 33.9 bits (76), Expect = 4.6
 Identities = 26/90 (28%), Positives = 38/90 (42%), Gaps = 6/90 (6%)
 Frame = +3

Query: 3   LNGDQTNYGEAVGDSLSADLPNSLSLG*IEQRHEPRVLAVRRYDGTEVRRLH-LRNRIRG 179
           L GD   + E V  +  A     L     +Q HE  V A+ +    +++ +   R R RG
Sbjct: 67  LAGDVETHAEMVHSAFQAQRAFLLMASQYQQPHENDVAALLKPISEKIQEIQTFRERNRG 126

Query: 180 EERYLHQRQQKQRCPA-----VSLRPPPLP 254
              + H     +  PA     VS +PPPLP
Sbjct: 127 SNMFNHLSAVSESIPALGWIAVSPKPPPLP 156



>pir|T18472|T18472 hypothetical protein C0440c - malaria parasite
           (Plasmodium falciparum)>gb:PFMAL3P4_1394480 Plasmodium
           falciparum MAL3P4.
          Length = 2269

 Score = 33.9 bits (76), Expect = 4.6
 Identities = 25/93 (26%), Positives = 44/93 (47%), Gaps = 5/93 (5%)
 Frame = +1

Query: 487 KRDGCASCKGSSGFTCLNGQDCAMKTNSCKNRGGN-----VDCSLGIQLTFSGTDKHESV 651
           KR  C   K  +    +N +     ++S KN G N     +D S  +    S  D+ E++
Sbjct: 27  KRYMCNDNKMDNDNNIINEKKYFNNSSSIKNTGNNYKNDNIDKSYDMCERRSMMDRDENI 86

Query: 652 FNSWYEVKNLRQYSLYSVYSNLKDSLTSQYNKF 750
           +N+ Y+ KN   YS  + YSN  + + ++ N +
Sbjct: 87  YNNNYKNKNRNNYSNKNNYSNNINHMDNRRNTY 119



>gb:BC023017_1978064 Homo sapiens, Similar to natriuretic peptide
           receptor B/guanylate cyclase B (atrionatriuretic peptide
           receptor B), clone IMAGE:4939622, mRNA, partial cds.
          Length = 618

 Score = 33.1 bits (74), Expect = 7.9
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 3/67 (4%)
 Frame = +1

Query: 115 SPCADTTVQKSDGFTFGIV---FAARNATFINDSKNKDVQLSPCDRRLSLNNAQLAVFRP 285
           +P   T +QK+D ++FGI+    A R+  F  +     + LSP +    + N Q   FRP
Sbjct: 266 NPLPTTGMQKADVYSFGIILQEIALRSGPFYLEG----LDLSPKEIVQKVRNGQRPYFRP 321

Query: 286 KVDEISL 306
            +D   L
Sbjct: 322 SIDRTQL 328



>gb:AL133410_1918507 Human DNA sequence from clone RP11-112J3 on
           chromosome 9p13.1-13.3 Contains the 3' end of the CA9
           gene for carbonic anhydrase IX (MN), the TPM2 gene for
           tropomyosin 2 (beta) (DA1, TMSB, AMCD1), the TLN1 gene
           for talin 1 (TLN, KIAA1027), the CREB3 gene for cAMP
           responsive element binding protein 3 (luman) (LZIP,
           LUMAN, MGC15333, MGC19782), the GBA2 gene for
           glucosidase, beta (bile acid) 2 (AD035, KIAA1605,
           MGC16895, DKFZp762K054), a novel gene (KIAA0258), five
           novel genes, the NPR2 gene for natriuretic peptide
           receptor B/guanylate cyclase B (atrionatriuretic peptide
           receptor B) (NPRB, ANPRB, GUC2B, NPRBi), the SPAG8 gene
           for sperm associated antigen 8 (SMP1, BS-84, HSD-1,
           hSMP-1, MGC26201), the HINT2 gene for Histidine triad
           nucleotide binding protein 2, the gene for NAG-5 protein
           (LOC51754), an olfactory receptor pseudogene, the gene
           for a novel seven transmembrane helix receptor, a NADH
           dehydrogenase (ubiquinone) 1 alpha subcomplex, 5,13kDa
           (B13, NUFM, UQOR13, FLJ12147, CI-13KD-B) (NDUFA5)
           pseudogene and six CpG islands, complete
           sequence.>gb:HSAJ5282_2010403 Homo sapiens mRNA for
           NPR-Bi.
          Length = 995

 Score = 33.1 bits (74), Expect = 7.9
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 3/67 (4%)
 Frame = +1

Query: 115 SPCADTTVQKSDGFTFGIV---FAARNATFINDSKNKDVQLSPCDRRLSLNNAQLAVFRP 285
           +P   T +QK+D ++FGI+    A R+  F  +     + LSP +    + N Q   FRP
Sbjct: 695 NPLPTTGMQKADVYSFGIILQEIALRSGPFYLEG----LDLSPKEIVQKVRNGQRPYFRP 750

Query: 286 KVDEISL 306
            +D   L
Sbjct: 751 SIDRTQL 757



>gb:BTRGC_1437344 Bos taurus mRNA for retina guanylate cyclase.
          Length = 497

 Score = 33.1 bits (74), Expect = 7.9
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 3/67 (4%)
 Frame = +1

Query: 115 SPCADTTVQKSDGFTFGIV---FAARNATFINDSKNKDVQLSPCDRRLSLNNAQLAVFRP 285
           +P   T +QK+D ++FGI+    A R+  F  +     + LSP +    + N Q   FRP
Sbjct: 145 NPLPTTGMQKADVYSFGIILQEIALRSGPFYLEG----LDLSPKEIVQKVRNGQRPYFRP 200

Query: 286 KVDEISL 306
            +D   L
Sbjct: 201 SIDRTQL 207



>sp|P20594|ANPB_HUMAN Atrial natriuretic peptide receptor B
           precursor (ANP-B) (ANPRB) (GC-B) (Guanylate cyclase) (EC
           4.6.1.2) (NPR-B) (Atrial natriuretic peptide B-type
           receptor).>pir|S05514|OYHUBR natriuretic peptide
           receptor B precursor - human>gb:AL133410_1918506 Human
           DNA sequence from clone RP11-112J3 on chromosome
           9p13.1-13.3 Contains the 3' end of the CA9 gene for
           carbonic anhydrase IX (MN), the TPM2 gene for
           tropomyosin 2 (beta) (DA1, TMSB, AMCD1), the TLN1 gene
           for talin 1 (TLN, KIAA1027), the CREB3 gene for cAMP
           responsive element binding protein 3 (luman) (LZIP,
           LUMAN, MGC15333, MGC19782), the GBA2 gene for
           glucosidase, beta (bile acid) 2 (AD035, KIAA1605,
           MGC16895, DKFZp762K054), a novel gene (KIAA0258), five
           novel genes, the NPR2 gene for natriuretic peptide
           receptor B/guanylate cyclase B (atrionatriuretic peptide
           receptor B) (NPRB, ANPRB, GUC2B, NPRBi), the SPAG8 gene
           for sperm associated antigen 8 (SMP1, BS-84, HSD-1,
           hSMP-1, MGC26201), the HINT2 gene for Histidine triad
           nucleotide binding protein 2, the gene for NAG-5 protein
           (LOC51754), an olfactory receptor pseudogene, the gene
           for a novel seven transmembrane helix receptor, a NADH
           dehydrogenase (ubiquinone) 1 alpha subcomplex, 5,13kDa
           (B13, NUFM, UQOR13, FLJ12147, CI-13KD-B) (NDUFA5)
           pseudogene and six CpG islands, complete sequence.
          Length = 1047

 Score = 33.1 bits (74), Expect = 7.9
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 3/67 (4%)
 Frame = +1

Query: 115 SPCADTTVQKSDGFTFGIV---FAARNATFINDSKNKDVQLSPCDRRLSLNNAQLAVFRP 285
           +P   T +QK+D ++FGI+    A R+  F  +     + LSP +    + N Q   FRP
Sbjct: 695 NPLPTTGMQKADVYSFGIILQEIALRSGPFYLEG----LDLSPKEIVQKVRNGQRPYFRP 750

Query: 286 KVDEISL 306
            +D   L
Sbjct: 751 SIDRTQL 757



>sp|P46197|ANPB_BOVIN Atrial natriuretic peptide receptor B
           precursor (ANP-B) (ANPRB) (GC-B) (Guanylate cyclase) (EC
           4.6.1.2) (NPR-B) (Atrial natriuretic peptide B-type
           receptor).>pir|I45882|I45882 guanylate cyclase (EC
           4.6.1.2) - bovine>gb:BOVCTNFR_1435369 Cow C-type
           natriuretic factor receptor mRNA, complete cds.
          Length = 1047

 Score = 33.1 bits (74), Expect = 7.9
 Identities = 21/67 (31%), Positives = 33/67 (49%), Gaps = 3/67 (4%)
 Frame = +1

Query: 115 SPCADTTVQKSDGFTFGIV---FAARNATFINDSKNKDVQLSPCDRRLSLNNAQLAVFRP 285
           +P   T +QK+D ++FGI+    A R+  F  +     + LSP +    + N Q   FRP
Sbjct: 695 NPLPTTGMQKADVYSFGIILQEIALRSGPFYLEG----LDLSPKEIVQKVRNGQRPYFRP 750

Query: 286 KVDEISL 306
            +D   L
Sbjct: 751 SIDRTQL 757


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 954,468,190
Number of Sequences: 1806583
Number of extensions: 20327300
Number of successful extensions: 68720
Number of sequences better than 10.0: 21
Number of HSP's better than 10.0 without gapping: 64655
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 68642
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 65853909672
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)