BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig5980
         (1163 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AC002535_1530841 Arabidopsis thaliana chromosome 2 clone T30B...   204   1e-63   
gb:AC104272_1737352 Oryza sativa (japonica cultivar-group) chrom...   187   2e-58   
pir|T00435|T00435 probable mitochondrial carrier protein [import...   130   2e-41   Arabidopsis thaliana [mouse-ear cress]
gb:AY093232_1575186 Arabidopsis thaliana unknown protein (At1g25...   140   6e-40   
gb:AC079374_1732559 Arabidopsis thaliana chromosome 1 BAC F4F7 g...   130   3e-37   
gb:AP002970_1824027 Oryza sativa (japonica cultivar-group) genom...   121   2e-26   
gb:CR382134_1667348 Debaryomyces hansenii chromosome B of strain...    92   5e-23   
gb:CR380956_1652067 Candida glabrata strain CBS138 chromosome J ...    84   1e-19   
sp|P40556|YIA6_YEAST|YIA6_YEAST Putative mitochondrial carrier YIL006W.>pir...    84   5e-19   Saccharomyces cerevisiae [brewer's yeast]
sp|P39953|YEA6_YEAST|YEA6_YEAST Putative mitochondrial carrier YEL006W.>pir...    78   1e-17   Saccharomyces cerevisiae [brewer's yeast]
gb:CR382124_1656951 Kluyveromyces lactis strain NRRL Y-1140 chro...    75   5e-17   
gb:CR382131_1664134 Yarrowia lipolytica chromosome E of strain C...    87   6e-16   
gb:NC20H10_1688473 Neurospora crassa DNA linkage group V Cosmid ...    86   1e-15   
gb:AE016817_1747376 Ashbya gossypii (= Eremothecium gossypii) AT...    82   3e-14   
gb:AE013599_1130809 Drosophila melanogaster chromosome 2R, compl...    66   3e-14   
gb:AX453492_1468810 Sequence 53 from Patent WO0242455.                 66   3e-14   
gb:AE013599_1130810 Drosophila melanogaster chromosome 2R, compl...    66   3e-14   
gb:AP002483_1822209 Oryza sativa (japonica cultivar-group) genom...    72   2e-11   
pir|T50159|T50159 mitochondrial carrier protein [imported] - fis...    71   5e-11   Schizosaccharomyces pombe
gb:AE017341_1754628 Cryptococcus neoformans var. neoformans JEC2...    68   4e-10   
gb:BC087370_2565215 Xenopus laevis hypothetical LOC495984, mRNA ...    65   2e-09   
gb:AY084815_1569898 Arabidopsis thaliana clone 118596 mRNA, comp...    65   2e-09   
gb:AC096689_1736274 Oryza sativa chromosome 3 BAC OSJNBa0027J18 ...    65   3e-09   
gb:AP004139_1838151 Oryza sativa (japonica cultivar-group) genom...    64   6e-09   
gb:BT010139_1640205 Arabidopsis thaliana At5g66380 gene, complet...    63   1e-08   
gb:BC056716_2551909 Danio rerio zgc:65787, mRNA (cDNA clone MGC:...    62   2e-08   
gb:AJ720399_2502586 Gallus gallus mRNA for hypothetical protein,...    60   6e-08   
gb:CR382138_1671058 Debaryomyces hansenii chromosome F of strain...    60   6e-08   
gb:BC011293_2091362 Mus musculus RIKEN cDNA 5730438N18 gene, mRN...    60   8e-08   
gb:AF283645_1894677 Homo sapiens folate transporter/carrier mRNA...    60   8e-08   
gb:AB062964_1868955 Macaca fascicularis brain cDNA clone:QmoA-10...    60   1e-07   
gb:AX453490_1468809 Sequence 51 from Patent WO0242455.>gb:BC0480...    60   1e-07   
sp|Q95J75|MFTC_MACFA|MFTC_MACFA Mitochondrial folate transporter/carrier.>g...    60   1e-07   Macaca fascicularis [crab eating macaque]
gb:AY611603_2086858 Cricetulus griseus mitochondrial folate tran...    59   1e-07   
gb:CR382132_1665166 Yarrowia lipolytica chromosome F of strain C...    59   1e-07   
gb:AX880684_1478377 Sequence 15589 from Patent EP1074617.>gb:AK0...    59   1e-07   
gb:AX453448_1468806 Sequence 9 from Patent WO0242455.                  59   1e-07   
sp|Q9H2D1|MFTC_HUMAN|MFTC_HUMAN Mitochondrial folate transporter/carrier.>g...    59   1e-07   Homo sapiens [man]
gb:AJ720037_2502224 Gallus gallus mRNA for hypothetical protein,...    59   2e-07   
gb:BC014064_1974369 Homo sapiens hypothetical protein FLJ10618, ...    59   2e-07   
gb:AB060253_1868687 Macaca fascicularis brain cDNA clone:QtrA-11...    59   2e-07   
gb:AX876835_1476714 Sequence 11740 from Patent EP1074617.>gb:AK0...    59   2e-07   
gb:BC031874_2097283 Mus musculus mitochondrial folate transporte...    58   3e-07   
gb:AX453452_1468808 Sequence 13 from Patent WO0242455.                 58   3e-07   
gb:AX453450_1468807 Sequence 11 from Patent WO0242455.                 58   3e-07   
sp|Q8BMG8|MFTC_MOUSE|MFTC_MOUSE Mitochondrial folate transporter/carrier.>g...    58   3e-07   Mus musculus [mouse]
gb:AF495714_1905238 Homo sapiens mitochondrial carrier protein m...    58   4e-07   
gb:AB017061_1513317 Arabidopsis thaliana genomic DNA, chromosome...    58   4e-07   
gb:BC076521_2559349 Danio rerio zgc:92447, mRNA (cDNA clone MGC:...    57   5e-07   
pir|S44092|S44092 probable carrier protein c2 - Caenorhabditis e...    57   5e-07   Caenorhabditis elegans [roundworm]
gb:AK053646_1170509 Mus musculus 0 day neonate eyeball cDNA, RIK...    57   7e-07   
pir|S54495|S54495 probable carrier protein YPR021c - yeast (Sacc...    57   9e-07   Saccharomyces cerevisiae [brewer's yeast]
gb:AK176255_1818243 Arabidopsis thaliana mRNA for mitochondrial ...    56   1e-06   
gb:CR380957_1652615 Candida glabrata strain CBS138 chromosome K ...    56   1e-06   
gb:AY128317_1580616 Arabidopsis thaliana putative mitochondrial ...    56   1e-06   
gb:AC116957_1206699 Dictyostelium discoideum chromosome 2 map 16...    56   1e-06   
sp|Q9BQT8|ODC_HUMAN|ODC_HUMAN Mitochondrial 2-oxodicarboxylate carrier.>gb...    56   1e-06   Homo sapiens [man]
gb:AK096294_1914563 Homo sapiens cDNA FLJ38975 fis, clone NT2RI2...    56   2e-06   
gb:CNSLT1I6H_1180536 human full-length cDNA clone CS0DF030YI18 o...    56   2e-06   
sp|Q8N8R3|CACL_HUMAN|CACL_HUMAN Mitchondrial carnitine/acylcarnitine carrie...    56   2e-06   Homo sapiens [man]
gb:BC006711_2090331 Mus musculus solute carrier family 25 (mitoc...    55   2e-06   
gb:AE017347_1758054 Cryptococcus neoformans var. neoformans JEC2...    55   2e-06   
gb:CQ782989_1452248 Sequence 3129 from Patent EP1396543.>gb:CQ78...    55   2e-06   
gb:AE014134_1127042 Drosophila melanogaster chromosome 2L, compl...    55   2e-06   
sp|Q8BL03|CACL_MOUSE|CACL_MOUSE Mitchondrial carnitine/acylcarnitine carrie...    55   2e-06   Mus musculus [mouse]
gb:BT005998_1638920 Arabidopsis thaliana At3g20240 gene, complet...    55   3e-06   
gb:AY085067_1570149 Arabidopsis thaliana clone 126140 mRNA, comp...    55   3e-06   
gb:AY062478_1565134 Arabidopsis thaliana putative protein (F5K20...    55   3e-06   
gb:AK041694_1166081 Mus musculus 3 days neonate thymus cDNA, RIK...    55   3e-06   
gb:AK036988_1164704 Mus musculus adult female vagina cDNA, RIKEN...    55   3e-06   
pir|T45934|T45934 hypothetical protein F5K20.240 - Arabidopsis t...    55   3e-06   Arabidopsis thaliana [mouse-ear cress]
gb:BC089065_2110700 Rattus norvegicus solute carrier family 25 (...    55   4e-06   
gb:AE016818_1747896 Ashbya gossypii (= Eremothecium gossypii) AT...    55   4e-06   
gb:AK017628_1159245 Mus musculus 8 days embryo whole body cDNA, ...    55   4e-06   
gb:AE014297_1139018 Drosophila melanogaster chromosome 3R, compl...    55   4e-06   
gb:AE014297_1139015 Drosophila melanogaster chromosome 3R, compl...    55   4e-06   
gb:BC037087_2097986 Mus musculus solute carrier family 25 (mitoc...    54   5e-06   
gb:AY122132_1301494 Drosophila melanogaster GH25190 full insert ...    54   5e-06   
pir|G86383|G86383 probable mitochondrial carrier protein [import...    54   5e-06   Arabidopsis thaliana [mouse-ear cress]
gb:CR858050_1182238 Pongo pygmaeus mRNA; cDNA DKFZp459F1930 (fro...    54   6e-06   
gb:AE014296_1136007 Drosophila melanogaster chromosome 3L, compl...    54   6e-06   
gb:AE014296_1136005 Drosophila melanogaster chromosome 3L, compl...    54   6e-06   
gb:BC080378_2561685 Xenopus laevis MGC81556 protein, mRNA (cDNA ...    54   8e-06   
gb:AJ720668_2502855 Gallus gallus mRNA for hypothetical protein,...    54   8e-06   
gb:AE016817_1747335 Ashbya gossypii (= Eremothecium gossypii) AT...    54   8e-06   
gb:AK032960_1163145 Mus musculus 12 days embryo male wolffian du...    54   8e-06   
gb:BC041303_2547930 Xenopus laevis solute carrier family 25 (mit...    53   1e-05   
gb:CR382125_1657818 Kluyveromyces lactis strain NRRL Y-1140 chro...    53   1e-05   
gb:AC115584_1205707 Dictyostelium discoideum chromosome 2 map co...    53   1e-05   
gb:CR857243_1181488 Pongo pygmaeus mRNA; cDNA DKFZp469I0832 (fro...    53   1e-05   
gb:HAMCTP_1996072 H.sapiens gene encoding mitochondrial citrate ...    53   1e-05   
gb:AP004622_1842244 Oryza sativa (japonica cultivar-group) genom...    53   1e-05   
gb:CR382128_1661239 Yarrowia lipolytica chromosome B of strain C...    53   1e-05   
pir|G01789|G01789 citrate transporter protein - human>gb:HSU2514...    53   1e-05   Homo sapiens [man]
sp|P32089|TXTP_RAT|TXTP_RAT Tricarboxylate transport protein, mitochondri...    53   1e-05   Rattus norvegicus [brown rat]
sp|P53007|TXTP_HUMAN|TXTP_HUMAN Tricarboxylate transport protein, mitochond...    53   1e-05   Homo sapiens [man]
gb:BC055369_2102017 Mus musculus solute carrier family 25 (mitoc...    52   2e-05   
gb:BC005163_1969651 Homo sapiens solute carrier family 25 (mitoc...    52   2e-05   
gb:AY358515_1947394 Homo sapiens clone DNA59609 LCLC549 (UNQ549)...    52   2e-05   
gb:AL360268_1926110 Human DNA sequence from clone RP11-379C10 on...    52   2e-05   
gb:AL360268_1926109 Human DNA sequence from clone RP11-379C10 on...    52   2e-05   
gb:AJ619992_1907010 Homo sapiens mRNA for small calcium-binding ...    52   2e-05   
gb:AJ619990_1907008 Homo sapiens mRNA for small calcium-binding ...    52   2e-05   
gb:AJ619989_1907007 Homo sapiens mRNA for small calcium-binding ...    52   2e-05   
gb:AJ619963_1907004 Homo sapiens partial mRNA for mitochondrial ...    52   2e-05   
gb:AB067483_1870791 Homo sapiens mRNA for KIAA1896 protein, part...    52   2e-05   
gb:AB007915_1864032 Homo sapiens mRNA for KIAA0446 protein, part...    52   2e-05   
gb:AP005003_1847110 Oryza sativa (japonica cultivar-group) genom...    52   2e-05   
gb:AP003246_1826180 Oryza sativa (japonica cultivar-group) genom...    52   2e-05   
gb:AP001080_1820751 Oryza sativa (japonica cultivar-group) genom...    52   2e-05   
gb:AC150162_1745056 Solanum demissum chromosome 5 clone PGEC160O...    52   2e-05   
gb:AC135208_1742064 Oryza sativa (japonica cultivar-group) chrom...    52   2e-05   
gb:AK032806_1163075 Mus musculus 12 days embryo male wolffian du...    52   2e-05   
gb:BC056033_2551616 Xenopus laevis hypothetical protein MGC68982...    52   2e-05   
gb:AE016820_1749644 Ashbya gossypii (= Eremothecium gossypii) AT...    52   2e-05   
gb:SCACR1PRA_1706453 S.cerevisiae ACR1-protein gene, complete CDS.     52   2e-05   
gb:CR380956_1652054 Candida glabrata strain CBS138 chromosome J ...    52   2e-05   
gb:BT020902_1436260 Bos taurus solute carrier family 25 (mitocho...    52   2e-05   
gb:AC116925_1206488 Dictyostelium discoideum chromosome 2 map 41...    52   2e-05   
gb:CR859982_1184078 Pongo pygmaeus mRNA; cDNA DKFZp459L1427 (fro...    52   2e-05   
sp|P33303|SFC1_YEAST|SFC1_YEAST Succinate/fumarate mitochondrial transporte...    52   2e-05   Saccharomyces cerevisiae [brewer's yeast]
gb:BC084172_2563563 Xenopus tropicalis hypothetical LOC496457, m...    52   3e-05   
gb:BC043993_2548403 Xenopus laevis hypothetical protein LOC39847...    52   3e-05   
pir|T50686|T50686 peroxisomal Ca-dependent solute carrier [impor...    52   3e-05   Oryctolagus cuniculus [domestic rabbit]
pir|T39385|T39385 probable mitochondrial carrier protein - fissi...    52   3e-05   Schizosaccharomyces pombe
pir|T47703|T47703 Ca-dependent solute carrier-like protein - Ara...    52   3e-05   Arabidopsis thaliana [mouse-ear cress]
pir|T01729|T01729 mitochondrial solute carrier protein homolog -...    52   3e-05   Arabidopsis thaliana [mouse-ear cress]
pir|D84798|D84798 probable mitochondrial carrier protein [import...    52   3e-05   Arabidopsis thaliana [mouse-ear cress]
pir|T04273|T04273 hypothetical protein F20B18.290 - Arabidopsis ...    46   4e-05   Arabidopsis thaliana [mouse-ear cress]
gb:BC064874_2553915 Xenopus tropicalis hypothetical protein MGC7...    51   4e-05   
gb:BC068561_1987697 Homo sapiens solute carrier family 25 (mitoc...    51   4e-05   
gb:AJ619987_1907005 Homo sapiens mRNA for small calcium-binding ...    51   4e-05   
gb:AJ619961_1907002 Homo sapiens partial mRNA for mitochondrial ...    51   4e-05   
gb:AE016820_1749907 Ashbya gossypii (= Eremothecium gossypii) AT...    51   4e-05   
gb:SPBC12D12_1718900 S.pombe chromosome II cosmid c12D12.              51   4e-05   
gb:CR382135_1668468 Debaryomyces hansenii chromosome C of strain...    51   4e-05   
sp|P23500|MRS4_YEAST|MRS4_YEAST Mitochondrial RNA splicing protein MRS4.>pi...    51   4e-05   Saccharomyces cerevisiae [brewer's yeast]
gb:BC066998_2105893 Mus musculus solute carrier family 25 (mitoc...    51   5e-05   
gb:BC037109_2097999 Mus musculus solute carrier family 25 (mitoc...    51   5e-05   
gb:BC019978_2093181 Mus musculus solute carrier family 25 (mitoc...    51   5e-05   
gb:AK122568_2069233 Mus musculus mRNA for mKIAA1896 protein.           51   5e-05   
gb:NC3H10_1688523 Neurospora crassa DNA linkage group V Cosmid c...    51   5e-05   
gb:CR382139_1672894 Debaryomyces hansenii chromosome G of strain...    51   5e-05   
gb:CR382135_1668169 Debaryomyces hansenii chromosome C of strain...    51   5e-05   
gb:AY325139_1177808 Rattus norvegicus Ab1-114 mRNA, complete cds.      51   5e-05   
gb:AK049392_1168778 Mus musculus 7 days embryo whole body cDNA, ...    51   5e-05   
gb:AE014297_1138928 Drosophila melanogaster chromosome 3R, compl...    51   5e-05   
sp|Q9WVD5|ORT1_MOUSE|ORT1_MOUSE Mitochondrial ornithine transporter 1 (Solu...    51   5e-05   Mus musculus [mouse]
sp|Q99JD3|ODC_RAT|ODC_RAT Mitochondrial 2-oxodicarboxylate carrier.>gb:B...    51   5e-05   Rattus norvegicus [brown rat]
gb:CR382125_1658281 Kluyveromyces lactis strain NRRL Y-1140 chro...    49   6e-05   
gb:AY043169_2074445 Rattus norvegicus peroxisomal Ca-dependent s...    50   7e-05   
gb:CR380958_1653321 Candida glabrata strain CBS138 chromosome L ...    50   7e-05   
gb:AE014298_1126466 Drosophila melanogaster chromosome X, comple...    50   7e-05   
pir|H86274|H86274 F7A19.22 protein - Arabidopsis thaliana>gb:AE0...    50   7e-05   Arabidopsis thaliana [mouse-ear cress]
gb:BC084177_2563568 Xenopus tropicalis hypothetical LOC496462, m...    50   9e-05   
gb:BC022637_2093833 Mus musculus solute carrier family 25 (mitoc...    50   9e-05   
gb:BC031671_1980220 Homo sapiens hypothetical protein MGC34725, ...    50   9e-05   
gb:AK097761_1914975 Homo sapiens cDNA FLJ40442 fis, clone TESTI2...    50   9e-05   
gb:AP001305_1821073 Arabidopsis thaliana genomic DNA, chromosome...    50   9e-05   
gb:CR382132_1664944 Yarrowia lipolytica chromosome F of strain C...    50   9e-05   
gb:AY080592_1568336 Arabidopsis thaliana unknown protein (At3g21...    50   9e-05   
gb:CR926117_1185621 Pongo pygmaeus mRNA; cDNA DKFZp459H2410 (fro...    50   9e-05   
gb:BC087392_2565235 Xenopus laevis hypothetical LOC496002, mRNA ...    50   1e-04   
gb:BC056787_2551973 Danio rerio zgc:63578, mRNA (cDNA clone MGC:...    50   1e-04   
gb:AE017345_1756867 Cryptococcus neoformans var. neoformans JEC2...    50   1e-04   
gb:RNI7580_1703883 Ribes nigrum mRNA for mitochondrial carrier p...    50   1e-04   
gb:CR382135_1668366 Debaryomyces hansenii chromosome C of strain...    50   1e-04   
gb:CR382126_1658489 Kluyveromyces lactis strain NRRL Y-1140 chro...    50   1e-04   
gb:AK007934_1154290 Mus musculus 10 day old male pancreas cDNA, ...    50   1e-04   
pir|T51158|T51158 hypothetical protein [imported] - Arabidopsis ...    50   1e-04   Arabidopsis thaliana [mouse-ear cress]
sp|P79110|TXTP_BOVIN|TXTP_BOVIN Tricarboxylate transport protein, mitochond...    50   1e-04   Bos taurus [bovine]
gb:BC064218_2553771 Xenopus tropicalis hypothetical protein MGC7...    49   1e-04   
gb:AY665293_1958598 Macaca fascicularis mitochondrial solute car...    49   1e-04   
gb:AK054901_1911376 Homo sapiens cDNA FLJ30339 fis, clone BRACE2...    49   1e-04   
gb:AJ619962_1907003 Homo sapiens partial mRNA for mitochondrial ...    49   1e-04   
gb:CR382132_1664986 Yarrowia lipolytica chromosome F of strain C...    49   1e-04   
gb:CR382130_1663399 Yarrowia lipolytica chromosome D of strain C...    49   1e-04   
gb:CR380952_1650553 Candida glabrata strain CBS138 chromosome F ...    49   1e-04   
gb:AY086597_1571644 Arabidopsis thaliana clone 260615 mRNA, comp...    49   1e-04   
gb:AX817352_1475896 Sequence 100 from Patent WO02081517.               49   1e-04   
gb:CQ783884_1452675 Sequence 4024 from Patent EP1396543.>gb:AK07...    49   1e-04   
gb:CQ782543_1452030 Sequence 2683 from Patent EP1396543.>gb:AK07...    49   1e-04   
gb:DMEY18197_1379514 Drosophila melanogaster mRNA for mitochondr...    49   1e-04   
gb:AK077159_1171700 Mus musculus adult male testis cDNA, RIKEN f...    49   1e-04   
gb:AE014297_1142184 Drosophila melanogaster chromosome 3R, compl...    49   1e-04   
gb:AE014297_1142183 Drosophila melanogaster chromosome 3R, compl...    49   1e-04   
sp|Q9HC21|DNC_HUMAN|DNC_HUMAN Mitochondrial deoxynucleotide carrier (Mitoc...    49   1e-04   Homo sapiens [man]
sp|Q9VA73|CMC1_DROME|CMC1_DROME Calcium-binding mitochondrial carrier Arala...    49   1e-04   Drosophila melanogaster
sp|Q21153|CMC1_CAEEL|CMC1_CAEEL Probable calcium-binding mitochondrial carr...    49   1e-04   Caenorhabditis elegans [roundworm]
gb:CR382139_1673004 Debaryomyces hansenii chromosome G of strain...    46   2e-04   
gb:AC116920_1206416 Dictyostelium discoideum chromosome 2 map 44...    45   2e-04   
gb:BC072926_2556850 Xenopus laevis MGC80420 protein, mRNA (cDNA ...    49   2e-04   
gb:BC066404_2554294 Danio rerio zgc:77454, mRNA (cDNA clone MGC:...    49   2e-04   
gb:BC055226_2551305 Danio rerio zgc:63736, mRNA (cDNA clone MGC:...    49   2e-04   
gb:AF123303_1884886 Homo sapiens calcium-binding transporter mRN...    49   2e-04   
gb:AP004869_1846306 Oryza sativa (japonica cultivar-group) genom...    49   2e-04   
gb:NCB13O20_1689219 Neurospora crassa DNA linkage group V BAC cl...    49   2e-04   
gb:CR382131_1664907 Yarrowia lipolytica chromosome E of strain C...    49   2e-04   
gb:CEF17E5_1362631 Caenorhabditis elegans cosmid F17E5, complete...    49   2e-04   
sp|Q19529|CMC3_CAEEL|CMC3_CAEEL Probable calcium-binding mitochondrial carr...    49   2e-04   Caenorhabditis elegans [roundworm]
gb:BC045395_2549235 Danio rerio zgc:55596, mRNA (cDNA clone MGC:...    49   3e-04   
gb:AL360268_1926108 Human DNA sequence from clone RP11-379C10 on...    49   3e-04   
gb:AF155811_1886677 Homo sapiens mitochondrial uncoupling protei...    49   3e-04   
gb:AP003334_1828137 Oryza sativa (japonica cultivar-group) genom...    49   3e-04   
gb:AP003334_1828136 Oryza sativa (japonica cultivar-group) genom...    49   3e-04   
gb:CR380953_1651003 Candida glabrata strain CBS138 chromosome G ...    49   3e-04   
gb:AX338084_1465833 Sequence 1 from Patent WO0174854.                  49   3e-04   
sp|O95258|UCP5_HUMAN|UCP5_HUMAN Brain mitochondrial carrier protein-1 (BMCP...    49   3e-04   Homo sapiens [man]
gb:BX649502_2567819 Zebrafish DNA sequence from clone DKEY-204F1...    48   3e-04   
gb:AF535151_2067731 Mus musculus brain mitochondrial carrier pro...    48   3e-04   
gb:AF535150_2067730 Mus musculus brain mitochondrial carrier pro...    48   3e-04   
gb:AF076981_2053591 Mus musculus brain mitochondrial carrier pro...    48   3e-04   
gb:AB028879_2044525 Rattus norvegicus BMCP1 mRNA for brain mitoc...    48   3e-04   
gb:AE016816_1746950 Ashbya gossypii (= Eremothecium gossypii) AT...    48   3e-04   
gb:CR382130_1662581 Yarrowia lipolytica chromosome D of strain C...    48   3e-04   
gb:AE014298_1123762 Drosophila melanogaster chromosome X, comple...    48   3e-04   
pir|T50393|T50393 probable mitochondrial carrier protein [import...    48   3e-04   Schizosaccharomyces pombe
pir|JC7553|JC7553 brain mitochondrial carrier protein-1 - rat>gb...    48   3e-04   Rattus norvegicus [brown rat]
pir|T23170|T23170 hypothetical protein K01C8.7 - Caenorhabditis ...    48   3e-04   Caenorhabditis elegans [roundworm]
sp|Q9Z2B2|UCP5_MOUSE|UCP5_MOUSE Brain mitochondrial carrier protein-1 (BMCP...    48   3e-04   Mus musculus [mouse]
gb:BC001656_1967747 Homo sapiens solute carrier family 25 (mitoc...    48   4e-04   
gb:AP002900_1823705 Oryza sativa (japonica cultivar-group) genom...    48   4e-04   
gb:SPAPB17E12_1718633 S.pombe chromosome I BAC pB17E12.                48   4e-04   
gb:CR380959_1653875 Candida glabrata strain CBS138 chromosome M ...    48   4e-04   
gb:AY027563_1559048 Aspergillus nidulans mitochondrial carrier A...    48   4e-04   
gb:AX705226_1473542 Sequence 17 from Patent WO03014353.>gb:AE016...    48   4e-04   
pir|S57544|S57544 probable membrane protein YPR011c - yeast (Sac...    48   4e-04   Saccharomyces cerevisiae [brewer's yeast]
gb:BC072270_2556522 Xenopus laevis hypothetical protein LOC44357...    47   6e-04   
gb:AF332005_1897051 Homo sapiens ornithine transporter 2 (ORNT2)...    47   6e-04   
gb:AP003629_1831729 Oryza sativa (japonica cultivar-group) genom...    47   6e-04   
gb:AK117673_1815695 Arabidopsis thaliana At1g14140 mRNA for puta...    47   6e-04   
gb:AE017343_1755898 Cryptococcus neoformans var. neoformans JEC2...    47   6e-04   
gb:CR380959_1654039 Candida glabrata strain CBS138 chromosome M ...    47   6e-04   
gb:BX897673_1644312 Neurospora crassa DNA linkage group III BAC ...    47   6e-04   
gb:AB019236_1514251 Arabidopsis thaliana genomic DNA, chromosome...    47   6e-04   
gb:AK045863_1167560 Mus musculus adult male corpora quadrigemina...    47   6e-04   
gb:AK044260_1166888 Mus musculus adult retina cDNA, RIKEN full-l...    47   6e-04   
gb:AE014134_1127950 Drosophila melanogaster chromosome 2L, compl...    47   6e-04   
sp|P38127|RIM2_YEAST|RIM2_YEAST Mitochondrial carrier protein RIM2.>pir|S36...    47   6e-04   Saccharomyces cerevisiae [brewer's yeast]
sp|P38702|LEU5_YEAST|LEU5_YEAST Mitochondrial carrier protein LEU5.>pir|S46...    47   6e-04   Saccharomyces cerevisiae [brewer's yeast]
sp|Q9DAM5|DNC_MOUSE|DNC_MOUSE Mitochondrial deoxynucleotide carrier.>gb:AK...    47   6e-04   Mus musculus [mouse]
gb:BC088076_2565587 Xenopus tropicalis hypothetical LOC496786, m...    47   7e-04   
gb:BC084458_2563832 Xenopus tropicalis cDNA clone MGC:89262 IMAG...    47   7e-04   
gb:BC063207_2553479 Xenopus tropicalis hypothetical protein LOC3...    47   7e-04   
gb:AJ720830_2503017 Gallus gallus mRNA for hypothetical protein,...    47   7e-04   
gb:AF177333_1888076 Homo sapiens clone SP1855 unknown mRNA.>gb:B...    47   7e-04   
gb:AF151827_1886313 Homo sapiens CGI-69 protein mRNA, complete c...    47   7e-04   
gb:AE017347_1757792 Cryptococcus neoformans var. neoformans JEC2...    47   7e-04   
gb:AE017344_1756366 Cryptococcus neoformans var. neoformans JEC2...    47   7e-04   
gb:CR382132_1665820 Yarrowia lipolytica chromosome F of strain C...    47   7e-04   
gb:AY140067_1582507 Arabidopsis thaliana mitochondrial carrier p...    47   7e-04   
gb:AF119864_1150048 Homo sapiens PRO2163 mRNA, complete cds.           47   7e-04   
pir|T43493|T43493 hypothetical protein DKFZp434C119.1 - human>gb...    47   7e-04   Homo sapiens [man]
pir|B96811|B96811 hypothetical protein T11I11.12 [imported] - Ar...    47   7e-04   Arabidopsis thaliana [mouse-ear cress]
sp|Q9Y619|ORT1_HUMAN|ORT1_HUMAN Mitochondrial ornithine transporter 1 (Solu...    47   7e-04   Homo sapiens [man]
sp|Q9BZJ4|CG69_HUMAN|CG69_HUMAN Mitochondrial carrier protein CGI-69 (PRO21...    47   7e-04   Homo sapiens [man]
gb:BC089755_2566300 Xenopus tropicalis cDNA clone MGC:108450 IMA...    47   0.001   
gb:BC079812_2561343 Xenopus laevis MGC86457 protein, mRNA (cDNA ...    47   0.001   
gb:BC073249_2557101 Xenopus laevis MGC80594 protein, mRNA (cDNA ...    47   0.001   
gb:BC057495_2552126 Danio rerio solute carrier family 25 (mitoch...    47   0.001   
gb:BC043834_2548290 Xenopus laevis mitochondrial Ca2+-dependent ...    47   0.001   
gb:AB056388_1868375 Macaca fascicularis brain cDNA, clone:QflA-1...    47   0.001   
gb:AE017343_1755509 Cryptococcus neoformans var. neoformans JEC2...    47   0.001   
gb:AY085415_1570484 Arabidopsis thaliana clone 150522 mRNA, comp...    47   0.001   
gb:AY061222_1293025 Drosophila melanogaster LD16544 full length ...    47   0.001   
gb:CR857224_1181471 Pongo pygmaeus mRNA; cDNA DKFZp469N0421 (fro...    47   0.001   
gb:AK077111_1171667 Mus musculus adult male testis cDNA, RIKEN f...    47   0.001   
gb:AE013599_1133881 Drosophila melanogaster chromosome 2R, compl...    47   0.001   
gb:AE014298_1125088 Drosophila melanogaster chromosome X, comple...    47   0.001   
gb:BC045598_1983587 Homo sapiens hypothetical protein MGC26694, ...    46   0.001   
gb:AP002901_1823731 Oryza sativa (japonica cultivar-group) genom...    46   0.001   
gb:NCB21O8_1689692 Neurospora crassa DNA linkage group II BAC cl...    46   0.001   
gb:AY048991_1561800 Cryptococcus neoformans var. neoformans puta...    46   0.001   
sp|Q8BH59|CMC1_MOUSE|CMC1_MOUSE Calcium-binding mitochondrial carrier prote...    46   0.001   Mus musculus [mouse]
gb:AJ720306_2502493 Gallus gallus mRNA for hypothetical protein,...    46   0.002   
gb:BC079002_2107145 Rattus norvegicus similar to solute carrier ...    46   0.002   
gb:BC072660_2106623 Mus musculus RIKEN cDNA 2310067G05 gene, mRN...    46   0.002   
gb:HSA512835_2008136 Homo sapiens mRNA for putative calcium bind...    46   0.002   
gb:BC016932_1975807 Homo sapiens solute carrier family 25 (mitoc...    46   0.002   
gb:CR380957_1652869 Candida glabrata strain CBS138 chromosome K ...    46   0.002   
gb:AB013389_1512041 Arabidopsis thaliana genomic DNA, chromosome...    46   0.002   
gb:CR858723_1182877 Pongo pygmaeus mRNA; cDNA DKFZp468M1513 (fro...    46   0.002   
gb:AE005172_890450 Arabidopsis thaliana chromosome 1, top arm co...    46   0.002   
pir|T00582|T00582 probable mitochondrial carrier protein [import...    46   0.002   
sp|O75746|CMC1_HUMAN|CMC1_HUMAN Calcium-binding mitochondrial carrier prote...    46   0.002   
gb:BC076734_2559480 Xenopus laevis MGC81365 protein, mRNA (cDNA ...    45   0.002   
gb:BC025937_2095235 Mus musculus RIKEN cDNA 2900084M01 gene, mRN...    45   0.002   
gb:AF378119_1899427 Homo sapiens ornithine transporter 2 (ORNT2)...    45   0.002   
gb:AE017343_1755493 Cryptococcus neoformans var. neoformans JEC2...    45   0.002   
gb:AC137608_1743479 Oryza sativa (japonica cultivar-group) chrom...    45   0.002   
gb:CR382137_1669871 Debaryomyces hansenii chromosome E of strain...    45   0.002   
gb:AY093061_1575015 Arabidopsis thaliana putative mitochondrial ...    45   0.002   
gb:BX538352_1359034 Cryptosporidium parvum chromosome 6, complet...    45   0.002   
gb:BT001438_1356211 Drosophila melanogaster GH24658 full insert ...    45   0.002   
gb:HSM801771_1186436 Homo sapiens mRNA; cDNA DKFZp434M1820 (from...    45   0.002   
gb:AE014297_1138356 Drosophila melanogaster chromosome 3R, compl...    45   0.002   
gb:AE014134_1128557 Drosophila melanogaster chromosome 2L, compl...    45   0.002   
gb:AE014134_1128555 Drosophila melanogaster chromosome 2L, compl...    45   0.002   
sp|Q03829|YM39_YEAST|YM39_YEAST Putative mitochondrial carrier YMR166C.>pir...    45   0.002   
sp|Q9BXI2|ORT2_HUMAN|ORT2_HUMAN Mitochondrial ornithine transporter 2 (Solu...    45   0.002   
gb:AB065433_1408841 Bos taurus mRNA for adenine nucleotide trans...    43   0.002   
gb:AY394951_2531694 Danio rerio clone RK050A1F10 solute carrier ...    45   0.003   
gb:BC087106_2109999 Rattus norvegicus cDNA clone MGC:94707 IMAGE...    45   0.003   
gb:BC046767_2099350 Mus musculus solute carrier family 25 (mitoc...    45   0.003   
gb:HSA496569_2007650 Homo sapiens mRNA for mitochondrial asparta...    45   0.003   
gb:HOS17571_1996294 Homo sapiens mRNA for mitochondrial carrier ...    45   0.003   
gb:AB083329_1871866 Macaca fascicularis slc25a13 mRNA for solute...    45   0.003   
gb:AP004045_1836827 Oryza sativa (japonica cultivar-group) genom...    45   0.003   
gb:AP003615_1831435 Oryza sativa (japonica cultivar-group) genom...    45   0.003   
gb:AE017356_1760412 Cryptococcus neoformans var. neoformans JEC2...    45   0.003   
gb:CR380957_1652638 Candida glabrata strain CBS138 chromosome K ...    45   0.003   
gb:AY186582_1588088 Arabidopsis thaliana mitochondrial basic ami...    45   0.003   
gb:CR859581_1183690 Pongo pygmaeus mRNA; cDNA DKFZp459O044 (from...    45   0.003   
pir|A86205|A86205 hypothetical protein [imported] - Arabidopsis ...    45   0.003   
pir|G89667|G89667 protein F17E5.2 [imported] - Caenorhabditis el...    45   0.003   
pir|T21074|T21074 hypothetical protein F17E5.2 - Caenorhabditis ...    45   0.003   
pir|T40968|T40968 probable mitochondrial carrier protein - fissi...    45   0.003   
pir|T50326|T50326 probable mitochondrial phosphate carrier prote...    45   0.003   
pir|T39149|T39149 probable RNA splicing proteinmitochondial carr...    45   0.003   
pir|T26089|T26089 hypothetical protein W02B12.9 - Caenorhabditis...    45   0.003   
sp|Q9UJS0|CMC2_HUMAN|CMC2_HUMAN Calcium-binding mitochondrial carrier prote...    45   0.003   
sp|P29518|BT1_MAIZE|BT1_MAIZE Brittle-1 protein, chloroplast precursor.>pi...    45   0.003   
sp|Q99297|ODC2_YEAST|ODC2_YEAST Mitochondrial 2-oxodicarboxylate carrier 2....    44   0.003   
gb:BC076052_2558934 Danio rerio zgc:92520, mRNA (cDNA clone MGC:...    45   0.004   
gb:BC016571_2092379 Mus musculus solute carrier family 25 (mitoc...    45   0.004   
gb:AL627107_1931027 Human DNA sequence from clone XXyac-R12DG2 o...    45   0.004   
gb:AC003083_1874481 Homo sapiens BAC clone CTB-60N22 from 7, com...    45   0.004   
gb:AP004365_1840810 Oryza sativa (japonica cultivar-group) genom...    45   0.004   
gb:NCB7N14_1690215 Neurospora crassa DNA linkage group II BAC cl...    45   0.004   
gb:AB024734_1516047 Symplocarpus foetidus mRNA for SfUCPb, compl...    45   0.004   
gb:AB024733_1516046 Symplocarpus foetidus mRNA for SfUCPa, compl...    45   0.004   
gb:AX879835_1478005 Sequence 14740 from Patent EP1074617.              45   0.004   
gb:AK012670_1157094 Mus musculus 10, 11 days embryo whole body c...    45   0.004   
gb:AE014296_1135890 Drosophila melanogaster chromosome 3L, compl...    45   0.004   
sp|Q9QXX4|CMC2_MOUSE|CMC2_MOUSE Calcium-binding mitochondrial carrier prote...    45   0.004   
gb:BC059349_2552384 Xenopus laevis hypothetical protein MGC69168...    44   0.005   
gb:AB093647_1872213 Macaca fascicularis brain cDNA clone:QflA-20...    44   0.005   
gb:AE016819_1748982 Ashbya gossypii (= Eremothecium gossypii) AT...    44   0.005   
gb:SPAC688_1718215 S.pombe chromosome I cosmid c688.                   44   0.005   
gb:CR382130_1662412 Yarrowia lipolytica chromosome D of strain C...    44   0.005   
gb:AY644462_1619791 Saccharum officinarum mitochondrial uncoupli...    44   0.005   
gb:AY046052_1561539 Arabidopsis thaliana putative mitochondrial ...    44   0.005   
gb:AB017063_1513347 Arabidopsis thaliana genomic DNA, chromosome...    44   0.005   
gb:PFMAL13_1191734 Plasmodium falciparum 3D7 chromosome 13, *** ...    44   0.005   
gb:AK002829_1151477 Mus musculus adult male kidney cDNA, RIKEN f...    44   0.005   
gb:AE014297_1141799 Drosophila melanogaster chromosome 3R, compl...    44   0.005   
gb:AE014134_1128325 Drosophila melanogaster chromosome 2L, compl...    44   0.005   
pir|T09362|T09362 hypothetical protein F23K16.90 - Arabidopsis t...    44   0.005   
gb:BC085527_2564430 Danio rerio zgc:103470, mRNA (cDNA clone MGC...    44   0.006   
gb:BC080980_2561891 Xenopus tropicalis MGC79800 protein, mRNA (c...    44   0.006   
gb:BC077266_2559981 Xenopus laevis MGC80014 protein, mRNA (cDNA ...    44   0.006   
gb:BC075377_2558480 Xenopus tropicalis MGC89095 protein, mRNA (c...    44   0.006   
gb:BC004720_2089736 Mus musculus solute carrier family 25 (mitoc...    44   0.006   
gb:AP002869_1823466 Oryza sativa (japonica cultivar-group) genom...    44   0.006   
gb:CR382138_1671193 Debaryomyces hansenii chromosome F of strain...    44   0.006   
gb:CR382132_1665730 Yarrowia lipolytica chromosome F of strain C...    44   0.006   
gb:CR382125_1658059 Kluyveromyces lactis strain NRRL Y-1140 chro...    44   0.006   
gb:AY084555_1569644 Arabidopsis thaliana clone 111544 mRNA, comp...    44   0.006   
gb:AY013245_1558478 Oryza sativa (japonica cultivar-group) chrom...    44   0.006   
gb:AB016885_1513123 Arabidopsis thaliana genomic DNA, chromosome...    44   0.006   
gb:AF310895_1261397 Dictyostelium discoideum RIM (rimA) and RacI...    44   0.006   
gb:AK078385_1172297 Mus musculus 10 days neonate cerebellum cDNA...    44   0.006   
pir|T40033|T40033 probable mitochondrial FAD carrier protein - f...    44   0.006   
gb:BC036869_1982093 Homo sapiens hypothetical protein LOC283130,...    44   0.008   
gb:BC013194_1974008 Homo sapiens hypothetical protein FLJ20551, ...    44   0.008   
gb:AK090434_1913231 Homo sapiens mRNA for FLJ00351 protein.            44   0.008   
gb:AK000558_1908000 Homo sapiens cDNA FLJ20551 fis, clone KAT11656.    44   0.008   
gb:AE016820_1749890 Ashbya gossypii (= Eremothecium gossypii) AT...    44   0.008   
gb:CNS09S4S_1648214 DNA centromeric region sequence from BAC DP2...    44   0.008   
gb:AB017067_1513422 Arabidopsis thaliana genomic DNA, chromosome...    44   0.008   
gb:AX453443_1468804 Sequence 4 from Patent WO0242455.                  44   0.008   
gb:BT001624_1356397 Drosophila melanogaster RE36975 full insert ...    44   0.008   
gb:AE014296_1134731 Drosophila melanogaster chromosome 3L, compl...    44   0.008   
gb:AE014134_1127737 Drosophila melanogaster chromosome 2L, compl...    44   0.008   
gb:TMA238539_1725220 Tuber magnatum pcp gene, exons 1-3.               42   0.008   
gb:BC078435_2561002 Danio rerio zgc:92470, mRNA (cDNA clone MGC:...    43   0.011   
gb:AB093538_2464532 Rana rugosa AAT-Yec mRNA for ADP/ATP translo...    43   0.011   
gb:AB093537_2464531 Rana rugosa AAT-Sad mRNA for ADP/ATP translo...    43   0.011   
gb:AB093536_2464530 Rana rugosa AAT-H2 mRNA for ADP/ATP transloc...    43   0.011   
gb:AB008458_2460460 Rana rugosa mRNA for ADP/ATP translocase, co...    43   0.011   
gb:AB008457_2460459 Rana rugosa mRNA for ADP/ATP translocase, co...    43   0.011   
gb:AB008456_2460458 Rana rugosa mRNA for ADP/ATP translocase, co...    43   0.011   
gb:BC022676_2093856 Mus musculus solute carrier family 25, membe...    43   0.011   
gb:AY597807_1957268 Homo sapiens chromosome 11 hypothetical prot...    43   0.011   
gb:AP005248_1849515 Oryza sativa (japonica cultivar-group) genom...    43   0.011   
gb:AP004779_1844983 Oryza sativa (japonica cultivar-group) genom...    43   0.011   
gb:CR382122_1655169 Kluyveromyces lactis strain NRRL Y-1140 chro...    43   0.011   
gb:BT005018_1637964 Arabidopsis thaliana clone U50609 putative m...    43   0.011   
gb:AY086408_1571457 Arabidopsis thaliana clone 249772 mRNA, comp...    43   0.011   
gb:AK030865_1162206 Mus musculus adult male thymus cDNA, RIKEN f...    43   0.011   
gb:AK015679_1158455 Mus musculus adult male testis cDNA, RIKEN f...    43   0.011   
pir|T48171|T48171 hypothetical protein F7A7.20 - Arabidopsis tha...    43   0.011   
pir|G96770|G96770 hypothetical protein F1O17.9 [imported] - Arab...    43   0.011   
pir|T16844|T16844 hypothetical protein T10F2.2 - Caenorhabditis ...    43   0.011   
sp|Q93XM7|MCAT_ARATH|MCAT_ARATH Mitochondrial carnitine/acylcarnitine carri...    43   0.011   
sp|Q20799|CMC2_CAEEL|CMC2_CAEEL Probable calcium-binding mitochondrial carr...    43   0.011   
gb:BC068199_1987591 Homo sapiens solute carrier family 25 (mitoc...    42   0.011   
gb:AC004000_1874514 Human PAC clone RP3-404F18 from Xq23, comple...    42   0.011   
gb:CR860963_1185004 Pongo pygmaeus mRNA; cDNA DKFZp469I2114 (fro...    42   0.011   
pir|A29132|A29132 ADP,ATP carrier protein T2 - human>gb:HUMATPC_...    42   0.011   
sp|P05141|ADT2_HUMAN|ADT2_HUMAN ADP,ATP carrier protein, fibroblast isoform...    42   0.011   
gb:HUMTLC_2037784 Human ADP/ATP translocase mRNA, 3' end, clone ...    42   0.011   
sp|P51881|ADT2_MOUSE|ADT2_MOUSE ADP,ATP carrier protein, fibroblast isoform...    40   0.014   
gb:BC075888_2558778 Danio rerio zgc:92090, mRNA (cDNA clone MGC:...    43   0.014   
gb:MMU27315_2120033 Mus musculus adenine nucleotide translocase-...    43   0.014   
gb:BC082071_2108299 Rattus norvegicus cDNA clone MGC:95235 IMAGE...    43   0.014   
gb:AF125531_1885106 Homo sapiens mitochondrial carrier family pr...    43   0.014   
gb:AE016818_1748562 Ashbya gossypii (= Eremothecium gossypii) AT...    43   0.014   
gb:CR382132_1665788 Yarrowia lipolytica chromosome F of strain C...    43   0.014   
gb:CR382131_1663905 Yarrowia lipolytica chromosome E of strain C...    43   0.014   
gb:CR382125_1657910 Kluyveromyces lactis strain NRRL Y-1140 chro...    43   0.014   
gb:CR380952_1650580 Candida glabrata strain CBS138 chromosome F ...    43   0.014   
gb:AB010069_1510860 Arabidopsis thaliana genomic DNA, chromosome...    43   0.014   
gb:AB009049_1510612 Arabidopsis thaliana genomic DNA, chromosome...    43   0.014   
gb:CQ871238_1454653 Sequence 7 from Patent WO2004078112.               43   0.014   
gb:AC116979_1207048 Dictyostelium discoideum chromosome 2 map 64...    43   0.014   
gb:AK050414_1169291 Mus musculus adult male liver tumor cDNA, RI...    43   0.014   
pir|T49871|T49871 peroxisomal Ca-dependent solute carrier-like p...    43   0.014   
pir|A84750|A84750 probable mitochondrial carrier protein [import...    43   0.014   
pir|T37992|T37992 probable tricarboxylate transport protein - fi...    43   0.014   
pir|T20290|T20290 hypothetical protein D1046.3 - Caenorhabditis ...    43   0.014   
sp|O70579|PM34_MOUSE|PM34_MOUSE Peroxisomal membrane protein PMP34 (34 kDa ...    43   0.014   
pir|S31814|S31814 ADP,ATP carrier protein T2 - mouse                   40   0.018   
gb:BC074600_2558095 Xenopus tropicalis MGC69323 protein, mRNA (c...    40   0.018   
gb:BC076803_2559546 Xenopus laevis cDNA clone MGC:83750 IMAGE:66...    42   0.018   
gb:AY648845_2541673 Danio rerio DKFZp586G0123-like mRNA, complet...    42   0.018   
gb:BC061143_2104358 Mus musculus solute carrier family 25 (mitoc...    42   0.018   
gb:AF503433_1806725 Sorghum bicolor BAC 170F8, complete sequence.      42   0.018   
gb:AE017343_1755942 Cryptococcus neoformans var. neoformans JEC2...    42   0.018   
gb:AC134348_1741785 Oryza sativa (japonica cultivar-group) chrom...    42   0.018   
gb:CR382139_1672489 Debaryomyces hansenii chromosome G of strain...    42   0.018   
gb:CR382128_1660480 Yarrowia lipolytica chromosome B of strain C...    42   0.018   
gb:CR382127_1660321 Yarrowia lipolytica chromosome A of strain C...    42   0.018   
gb:CR382124_1656764 Kluyveromyces lactis strain NRRL Y-1140 chro...    42   0.018   
gb:CR382123_1655970 Kluyveromyces lactis strain NRRL Y-1140 chro...    42   0.018   
gb:AB009386_1407715 Oryctolagus cuniculus mRNA for ADP/ATP trans...    42   0.018   
gb:OVU45998_1391505 Onchocerca volvulus MRS3/MRS4 class mitochon...    42   0.018   
sp|O43808|PM34_HUMAN|PM34_HUMAN Peroxisomal membrane protein PMP34 (34 kDa ...    42   0.018   
sp|P38921|PET8_YEAST|PET8_YEAST Putative mitochondrial carrier protein PET8...    42   0.018   
sp|P32332|OAC1_YEAST|OAC1_YEAST Mitochondrial oxaloacetate transport protei...    42   0.018   
sp|Q09073|ADT2_RAT|ADT2_RAT ADP,ATP carrier protein, fibroblast isoform (...    40   0.023   
gb:BC072091_2556354 Xenopus laevis hypothetical protein MGC79005...    42   0.024   
gb:AJ719388_2501575 Gallus gallus mRNA for hypothetical protein,...    42   0.024   
gb:BC060533_2104021 Rattus norvegicus solute carrier family 25 (...    42   0.024   
gb:AF055463_2052650 Mus musculus peroxisomal integral membrane p...    42   0.024   
gb:AF223466_1890837 Homo sapiens HT015 protein (HT015) mRNA, com...    42   0.024   
gb:AC004143_1874545 Homo sapiens chromosome 19 overlapping cosmi...    42   0.024   
gb:AE017341_1754300 Cryptococcus neoformans var. neoformans JEC2...    42   0.024   
gb:SCMRS3G_1708782 Yeast nuclear DNA fragment N3/2.0 with MRS3 g...    42   0.024   
gb:SCMRS3_1708780 Yeast MRS3 gene for suppression of a mitochond...    42   0.024   
gb:D89102_1675220 Schizosaccharomyces pombe mRNA, partial cds, c...    42   0.024   
gb:CR382138_1671803 Debaryomyces hansenii chromosome F of strain...    42   0.024   
gb:CR382127_1660151 Yarrowia lipolytica chromosome A of strain C...    42   0.024   
gb:AB091506_1525049 Penicillium chrysogenum mRNA for ADP/ATP car...    42   0.024   
gb:OGU45997_1391222 Onchocerca gibsoni MRS3/MRS4 class mitochond...    42   0.024   
gb:AK078077_1172168 Mus musculus adult male medulla oblongata cD...    42   0.024   
pir|B96830|B96830 hypothetical protein F19K16.14 [imported] - Ar...    42   0.024   
pir|T42011|T42011 ADP,ATP carrier protein - fission yeast (Schiz...    42   0.024   
pir|B40141|B40141 mitochondrial solute carrier protein homolog -...    42   0.024   
sp|P10566|MRS3_YEAST|MRS3_YEAST Mitochondrial RNA splicing protein MRS3.>pi...    42   0.024   
sp|P16261|GDC_RAT|GDC_RAT Grave'S disease carrier protein (GDC) (Mitocho...    42   0.024   
sp|Q09188|ADT_SCHPO|ADT_SCHPO ADP,ATP carrier protein (ADP/ATP translocase...    42   0.024   
sp|Q05962|ADT1_RAT|ADT1_RAT ADP,ATP carrier protein, heart/skeletal muscl...    42   0.024   
sp|P48962|ADT1_MOUSE|ADT1_MOUSE ADP,ATP carrier protein, heart/skeletal mus...    42   0.024   
gb:CR382132_1666038 Yarrowia lipolytica chromosome F of strain C...    40   0.030   
gb:RSU44832_2579123 Rana sylvatica ADP/ATP translocase mRNA, com...    42   0.031   
gb:BC087813_2565463 Xenopus tropicalis hypothetical LOC496683, m...    42   0.031   
gb:AY166600_2516298 Xenopus laevis uncoupling protein 4 mRNA, co...    42   0.031   
gb:AP005720_1856486 Oryza sativa (japonica cultivar-group) genom...    42   0.031   
gb:AC087553_1734115 Oryza sativa (japonica cultivar-group) chrom...    42   0.031   
gb:CR382131_1663579 Yarrowia lipolytica chromosome E of strain C...    42   0.031   
gb:CR382124_1656517 Kluyveromyces lactis strain NRRL Y-1140 chro...    42   0.031   
gb:CR380956_1652222 Candida glabrata strain CBS138 chromosome J ...    42   0.031   
gb:AY087702_1572730 Arabidopsis thaliana clone 37798 mRNA, compl...    42   0.031   
gb:BT020652_1436010 Bos taurus hypothetical protein FLJ20551 (FL...    42   0.031   
gb:BT020649_1436007 Bos taurus hypothetical protein FLJ20551 (FL...    42   0.031   
gb:AF055633_1412979 Sus scrofa domestica adenine nucleotide tran...    42   0.031   
pir|T48156|T48156 hypothetical protein T10O8.50 - Arabidopsis th...    42   0.031   
pir|S40756|S40756 hypothetical protein K11H3.3 - Caenorhabditis ...    42   0.031   
pir|A43646|XWBO ADP,ATP carrier protein T1 - bovine>gb:BOVT1TRAN...    42   0.031   
sp|Q09834|YAD8_SCHPO|YAD8_SCHPO Putative mitochondrial carrier C4G8.08.>pir...    42   0.031   
sp|P34519|TXTP_CAEEL|TXTP_CAEEL Putative tricarboxylate transport protein, ...    42   0.031   
sp|P02722|ADT1_BOVIN|ADT1_BOVIN ADP,ATP carrier protein, heart isoform T1 (...    42   0.031   
gb:AY519198_1430977 Antechinus flavipes mitochondrial uncoupling...    33   0.039   
gb:CR382131_1664620 Yarrowia lipolytica chromosome E of strain C...    40   0.039   
gb:BC082409_2562646 Xenopus laevis MGC82075 protein, mRNA (cDNA ...    41   0.039   
gb:AF436811_2494303 Meleagris gallopavo skeletal muscle uncoupli...    41   0.041   
gb:AF287144_2484594 Gallus gallus mitochondrial uncoupling prote...    41   0.041   
gb:AB088685_2464019 Gallus gallus avUCP mRNA for uncoupling prot...    41   0.041   
gb:BC019584_1976869 Homo sapiens similar to solute carrier famil...    41   0.041   
gb:AK094254_1914130 Homo sapiens cDNA FLJ36935 fis, clone BRACE2...    41   0.041   
gb:AJ617305_1812045 Pichia angusta MAT locus, containing yol077C...    41   0.041   
gb:AE017348_1758159 Cryptococcus neoformans var. neoformans JEC2...    41   0.041   
gb:ATLOVBSGC2_1553596 Aspergillus terreus lovastatin biosynthesi...    41   0.041   
gb:AF217402_1251968 Drosophila melanogaster clone 2H5 unknown mRNA.    41   0.041   
gb:AK051172_1169591 Mus musculus 12 days embryo spinal ganglion ...    41   0.041   
gb:AK015371_1158362 Mus musculus adult male testis cDNA, RIKEN f...    41   0.041   
pir|T40082|T40082 mitochondrial carrier protein - fission yeast ...    41   0.041   
pir|T19322|T19322 hypothetical protein C16C10.1 - Caenorhabditis...    41   0.041   
sp|Q09461|YQ51_CAEEL|YQ51_CAEEL Putative mitochondrial carrier C16C10.1.>gb...    41   0.041   


>gb:AC002535_1530841 Arabidopsis thaliana chromosome 2 clone T30B22
           map CIC06C03, complete sequence.>gb:AY074833_1567686
           Arabidopsis thaliana At2g47490/T30B22.21 mRNA, complete
           cds.>gb:AY084889_1569971 Arabidopsis thaliana clone
           120306 mRNA, complete sequence.>gb:AF372957_1792671
           Arabidopsis thaliana At2g47490/T30B22.21 mRNA, complete
           cds.
          Length = 312

 Score =  204 bits (520), Expect(3) = 1e-63
 Identities = 97/153 (63%), Positives = 115/153 (75%)
 Frame = +3

Query: 396 MTADAHGPSPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV 575
           M+A++H P+ K +LCN            TFVCPLDVIKTRFQVHGLPKLG+ NI+GSLIV
Sbjct: 1   MSANSHPPNSKNVLCNAAAGAAAGVVAATFVCPLDVIKTRFQVHGLPKLGDANIKGSLIV 60

Query: 576 GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXX 755
           GSLEQIF+REG+RG+YRGLSPTV+ALL NWA+YFT+Y+QLKSFLCS+D  H+LS+     
Sbjct: 61  GSLEQIFKREGMRGLYRGLSPTVMALLSNWAIYFTMYDQLKSFLCSND--HKLSVGANVL 118

Query: 756 XXXXXXXXXXXXXNPLWVVKTRLQTQGMRAGVV 854
                        NPLWVVKTRLQTQGMR G+V
Sbjct: 119 AASGAGAATTIATNPLWVVKTRLQTQGMRVGIV 151



 Score = 55.5 bits (132), Expect(3) = 1e-63
 Identities = 26/31 (83%), Positives = 28/31 (90%)
 Frame = +1

Query: 988  SGLVTALAGISHVAIQFPTYEKIKIYLANRG 1080
            SGLV ALAGISHVAIQFPTYE IK+YLA +G
Sbjct: 174  SGLVPALAGISHVAIQFPTYEMIKVYLAKKG 204



 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 37/117 (31%), Positives = 54/117 (46%), Gaps = 2/117 (1%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PL V+KTR Q  G+ ++G    + +    +L +I   EG+RG+Y GL P  LA + + A+
Sbjct: 133 PLWVVKTRLQTQGM-RVGIVPYKSTF--SALRRIAYEEGIRGLYSGLVP-ALAGISHVAI 188

Query: 672 YFTIYEQLKSFLC--SDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
            F  YE +K +L    D     L+                    P  VV+ RLQ QG
Sbjct: 189 QFPTYEMIKVYLAKKGDKSVDNLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQG 245



 Score = 28.5 bits (62), Expect(3) = 1e-63
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = +2

Query: 854 RGTLSALRRIAREKGILGLF 913
           + T SALRRIA E+GI GL+
Sbjct: 154 KSTFSALRRIAYEEGIRGLY 173



>gb:AC104272_1737352 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1045_C06, complete
           sequence.>gb:AC121363_1740158 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBa0036C12,
           complete sequence.
          Length = 336

 Score =  187 bits (474), Expect(3) = 2e-58
 Identities = 90/148 (60%), Positives = 101/148 (68%)
 Frame = +3

Query: 411 HGPSPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQ 590
           H  S +GLLC+            TFVCPLDVIKTRFQVHG PKL    I GS+I+GSL+Q
Sbjct: 23  HATSARGLLCHAAAGASAGVVAATFVCPLDVIKTRFQVHGWPKLATGTIGGSVIIGSLQQ 82

Query: 591 IFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXX 770
           I QREG RGMYRGLSPT+LALLPNWAVYFT+YEQLKS L S+D  H LS+          
Sbjct: 83  IAQREGFRGMYRGLSPTILALLPNWAVYFTVYEQLKSLLSSNDRSHHLSLGANVIAASCA 142

Query: 771 XXXXXXXXNPLWVVKTRLQTQGMRAGVV 854
                   NPLWVVKTR QTQG+RAGV+
Sbjct: 143 GGATTIATNPLWVVKTRFQTQGIRAGVI 170



 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 41/117 (35%), Positives = 60/117 (51%), Gaps = 2/117 (1%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PL V+KTRFQ  G+ + G    +G+L   +L++I   EG+RG+Y GL P  LA + + A+
Sbjct: 152 PLWVVKTRFQTQGI-RAGVIPYKGTL--AALKRIAHEEGIRGLYSGLVP-ALAGISHVAI 207

Query: 672 YFTIYEQLKSFLCSDDER--HELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
            F  YE++K++L   D      LS                    P  VV++RLQ QG
Sbjct: 208 QFPAYEKIKAYLAERDNTTVEALSFGDVAVASSLAKVAASTLTYPHEVVRSRLQEQG 264



 Score = 53.1 bits (126), Expect(3) = 2e-58
 Identities = 26/30 (86%), Positives = 26/30 (86%)
 Frame = +1

Query: 988  SGLVTALAGISHVAIQFPTYEKIKIYLANR 1077
            SGLV ALAGISHVAIQFP YEKIK YLA R
Sbjct: 193  SGLVPALAGISHVAIQFPAYEKIKAYLAER 222



 Score = 41.2 bits (95), Expect = 0.041
 Identities = 21/76 (27%), Positives = 39/76 (51%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   P +V+++R Q  G     ++  R + ++  + +++  EGL G YRG +  +L   P
Sbjct: 248 TLTYPHEVVRSRLQEQG----AHSKARYTGVMDCIRKVYHIEGLTGFYRGCATNLLRTTP 303

Query: 660 NWAVYFTIYEQLKSFL 707
              + FT +E +  FL
Sbjct: 304 AAVITFTSFEMIHRFL 319



 Score = 30.8 bits (68), Expect(3) = 2e-58
 Identities = 13/20 (65%), Positives = 18/20 (90%)
 Frame = +2

Query: 854 RGTLSALRRIAREKGILGLF 913
           +GTL+AL+RIA E+GI GL+
Sbjct: 173 KGTLAALKRIAHEEGIRGLY 192



>pir|T00435|T00435 probable mitochondrial carrier protein [imported]
           - Arabidopsis thaliana
          Length = 447

 Score =  130 bits (326), Expect(3) = 2e-41
 Identities = 72/167 (43%), Positives = 88/167 (52%), Gaps = 14/167 (8%)
 Frame = +3

Query: 396 MTADAHGPSPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV 575
           M+A++H P+ K +LCN                                       GSLIV
Sbjct: 152 MSANSHPPNSKNVLCNAAAGAAA--------------------------------GSLIV 179

Query: 576 GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD------------- 716
           GSLEQIF+REG+RG+YRGLSPTV+ALL NWA+YFT+Y+QLKSFLCS+             
Sbjct: 180 GSLEQIFKREGMRGLYRGLSPTVMALLSNWAIYFTMYDQLKSFLCSNGLCFSTQNLVNSC 239

Query: 717 -DERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMRAGVV 854
               H+LS+                  NPLWVVKTRLQTQGMR G+V
Sbjct: 240 LSGDHKLSVGANVLAASGAGAATTIATNPLWVVKTRLQTQGMRVGIV 286



 Score = 55.5 bits (132), Expect(3) = 2e-41
 Identities = 26/31 (83%), Positives = 28/31 (90%)
 Frame = +1

Query: 988  SGLVTALAGISHVAIQFPTYEKIKIYLANRG 1080
            SGLV ALAGISHVAIQFPTYE IK+YLA +G
Sbjct: 309  SGLVPALAGISHVAIQFPTYEMIKVYLAKKG 339



 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 37/117 (31%), Positives = 54/117 (46%), Gaps = 2/117 (1%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PL V+KTR Q  G+ ++G    + +    +L +I   EG+RG+Y GL P  LA + + A+
Sbjct: 268 PLWVVKTRLQTQGM-RVGIVPYKSTF--SALRRIAYEEGIRGLYSGLVP-ALAGISHVAI 323

Query: 672 YFTIYEQLKSFLC--SDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
            F  YE +K +L    D     L+                    P  VV+ RLQ QG
Sbjct: 324 QFPTYEMIKVYLAKKGDKSVDNLNARDVAVASSIAKIFASTLTYPHEVVRARLQEQG 380



 Score = 28.5 bits (62), Expect(3) = 2e-41
 Identities = 13/20 (65%), Positives = 16/20 (80%)
 Frame = +2

Query: 854 RGTLSALRRIAREKGILGLF 913
           + T SALRRIA E+GI GL+
Sbjct: 289 KSTFSALRRIAYEEGIRGLY 308



>gb:AY093232_1575186 Arabidopsis thaliana unknown protein
           (At1g25380) mRNA, complete cds.>gb:BT008746_1639942
           Arabidopsis thaliana At1g25380 gene, complete cds.
          Length = 363

 Score =  140 bits (352), Expect(3) = 6e-40
 Identities = 73/145 (50%), Positives = 88/145 (60%)
 Frame = +3

Query: 420 SPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQ 599
           S + +  N            TFVCPLDVIKTR QV GLP+   +  RG +I+ SL+ I +
Sbjct: 13  SIREVAANAGAGATAGAIAATFVCPLDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIIK 72

Query: 600 REGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXX 779
            EG RGMYRGLSPT++ALLPNWAVYF++Y +LK  L S D +  LSI             
Sbjct: 73  EEGYRGMYRGLSPTIIALLPNWAVYFSVYGKLKDVLQSSDGK--LSIGSNMIAAAGAGAA 130

Query: 780 XXXXXNPLWVVKTRLQTQGMRAGVV 854
                NPLWVVKTRL TQG+R GVV
Sbjct: 131 TSIATNPLWVVKTRLMTQGIRPGVV 155



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 26/89 (29%), Positives = 45/89 (50%), Gaps = 9/89 (10%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P +VI+ + Q  G  ++ N   + S ++  + ++F+ EG+ G+YRG +  +L   P+  +
Sbjct: 237 PHEVIRAKLQEQG--QIRNAETKYSGVIDCITKVFRSEGIPGLYRGCATNLLRTTPSAVI 294

Query: 672 YFTIYEQLKSFL---------CSDDERHE 731
            FT YE +  F           SDD R E
Sbjct: 295 TFTTYEMMLRFFRQVVPPETNRSDDRRRE 323



 Score = 46.2 bits (108), Expect(3) = 6e-40
 Identities = 20/28 (71%), Positives = 25/28 (89%)
 Frame = +1

Query: 988  SGLVTALAGISHVAIQFPTYEKIKIYLA 1071
            SG++ +LAG+SHVAIQFP YEKIK Y+A
Sbjct: 178  SGILPSLAGVSHVAIQFPAYEKIKQYMA 205



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 2/117 (1%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PL V+KTR    G+ + G    +   ++ +  +I   EG+RG+Y G+ P+ LA + + A+
Sbjct: 137 PLWVVKTRLMTQGI-RPGVVPYKS--VMSAFSRICHEEGVRGLYSGILPS-LAGVSHVAI 192

Query: 672 YFTIYEQLKSFLCSDDER--HELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
            F  YE++K ++   D      LS                    P  V++ +LQ QG
Sbjct: 193 QFPAYEKIKQYMAKMDNTSVENLSPGNVAIASSIAKVIASILTYPHEVIRAKLQEQG 249



 Score = 22.3 bits (46), Expect(3) = 6e-40
 Identities = 8/20 (40%), Positives = 13/20 (65%)
 Frame = +2

Query: 854 RGTLSALRRIAREKGILGLF 913
           +  +SA  RI  E+G+ GL+
Sbjct: 158 KSVMSAFSRICHEEGVRGLY 177



>gb:AC079374_1732559 Arabidopsis thaliana chromosome 1 BAC F4F7
           genomic sequence, complete sequence.
          Length = 376

 Score =  130 bits (328), Expect(3) = 3e-37
 Identities = 73/158 (46%), Positives = 88/158 (55%), Gaps = 13/158 (8%)
 Frame = +3

Query: 420 SPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQ 599
           S + +  N            TFVCPLDVIKTR QV GLP+   +  RG +I+ SL+ I +
Sbjct: 13  SIREVAANAGAGATAGAIAATFVCPLDVIKTRLQVLGLPEAPASGQRGGVIITSLKNIIK 72

Query: 600 REGLRGMYRGLSPTVLALLPNWA-------------VYFTIYEQLKSFLCSDDERHELSI 740
            EG RGMYRGLSPT++ALLPNWA             VYF++Y +LK  L S D +  LSI
Sbjct: 73  EEGYRGMYRGLSPTIIALLPNWAVSTTVLYRALFLQVYFSVYGKLKDVLQSSDGK--LSI 130

Query: 741 XXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMRAGVV 854
                             NPLWVVKTRL TQG+R GVV
Sbjct: 131 GSNMIAAAGAGAATSIATNPLWVVKTRLMTQGIRPGVV 168



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 26/89 (29%), Positives = 45/89 (50%), Gaps = 9/89 (10%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P +VI+ + Q  G  ++ N   + S ++  + ++F+ EG+ G+YRG +  +L   P+  +
Sbjct: 250 PHEVIRAKLQEQG--QIRNAETKYSGVIDCITKVFRSEGIPGLYRGCATNLLRTTPSAVI 307

Query: 672 YFTIYEQLKSFL---------CSDDERHE 731
            FT YE +  F           SDD R E
Sbjct: 308 TFTTYEMMLRFFRQVVPPETNRSDDRRRE 336



 Score = 46.2 bits (108), Expect(3) = 3e-37
 Identities = 20/28 (71%), Positives = 25/28 (89%)
 Frame = +1

Query: 988  SGLVTALAGISHVAIQFPTYEKIKIYLA 1071
            SG++ +LAG+SHVAIQFP YEKIK Y+A
Sbjct: 191  SGILPSLAGVSHVAIQFPAYEKIKQYMA 218



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 2/117 (1%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PL V+KTR    G+ + G    +   ++ +  +I   EG+RG+Y G+ P+ LA + + A+
Sbjct: 150 PLWVVKTRLMTQGI-RPGVVPYKS--VMSAFSRICHEEGVRGLYSGILPS-LAGVSHVAI 205

Query: 672 YFTIYEQLKSFLCSDDER--HELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
            F  YE++K ++   D      LS                    P  V++ +LQ QG
Sbjct: 206 QFPAYEKIKQYMAKMDNTSVENLSPGNVAIASSIAKVIASILTYPHEVIRAKLQEQG 262



 Score = 22.3 bits (46), Expect(3) = 3e-37
 Identities = 8/20 (40%), Positives = 13/20 (65%)
 Frame = +2

Query: 854 RGTLSALRRIAREKGILGLF 913
           +  +SA  RI  E+G+ GL+
Sbjct: 171 KSVMSAFSRICHEEGVRGLY 190



>gb:AP002970_1824027 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0504D03.>gb:AP003213_1825309 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OSJNBa0054L14.
          Length = 314

 Score =  121 bits (304), Expect = 2e-26
 Identities = 68/152 (44%), Positives = 81/152 (53%), Gaps = 13/152 (8%)
 Frame = +3

Query: 438 CNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPK-LGNTNIRGSLIVGSLEQIFQREGLR 614
           CN            T +CPLDVIKTR QV+GLP  L +T   G +I+   + I + EGL 
Sbjct: 19  CNAIAGGSAGVISATVLCPLDVIKTRLQVYGLPSNLSSTAPPGRVIISGFQHILKNEGLP 78

Query: 615 GMYRGLSPTVLALLPNWA-----------VYFTIYEQLKSFLCSD-DERHELSIXXXXXX 758
           G+YRGLSPT++AL P WA           V F++Y  LK  L S  D   ELS+      
Sbjct: 79  GLYRGLSPTIVALFPTWAAKYCFMIDACLVTFSVYNHLKGLLHSQGDNTGELSVQANILA 138

Query: 759 XXXXXXXXXXXXNPLWVVKTRLQTQGMRAGVV 854
                       NPLWVVKTRLQTQGMR GVV
Sbjct: 139 ASCAGIATAVATNPLWVVKTRLQTQGMRTGVV 170



 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 21/72 (29%), Positives = 41/72 (56%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P +V++++ Q  G  + G  +  G  ++  ++Q++Q+EG+ G YRG +  +L   PN  +
Sbjct: 239 PHEVVRSKLQEQGRARHGAVHYTG--VIDCIKQVYQKEGIPGFYRGCATNLLRTTPNAVI 296

Query: 672 YFTIYEQLKSFL 707
            FT YE +   +
Sbjct: 297 TFTSYEMINRLM 308



 Score = 37.0 bits (84), Expect = 0.77
 Identities = 14/23 (60%), Positives = 18/23 (78%)
 Frame = +1

Query: 1009 AGISHVAIQFPTYEKIKIYLANR 1077
            AG++HVAIQ P YE +K+Y A R
Sbjct: 187  AGVTHVAIQLPVYENVKLYFAKR 209



>gb:CR382134_1667348 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 390

 Score = 91.7 bits (226), Expect(3) = 5e-23
 Identities = 51/124 (41%), Positives = 63/124 (50%), Gaps = 8/124 (6%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGL-----PKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLA 650
           VCPLDV+KTRFQ HG        L +   RG L  G+ + I + EGLRG+YRGL P  + 
Sbjct: 82  VCPLDVVKTRFQAHGALAQSTGSLASKKYRGFL--GAFKTILREEGLRGLYRGLVPITIG 139

Query: 651 LLPNWAVYFTIYEQLKSFLCSDDERH---ELSIXXXXXXXXXXXXXXXXXXNPLWVVKTR 821
            LP W +YFT+YE+ K F     + H   E                     NP+WVVKTR
Sbjct: 140 YLPTWTIYFTVYERAKLFYPEFLKSHFNLETHALNHFCSALTAGMTSSIAVNPIWVVKTR 199

Query: 822 LQTQ 833
           L  Q
Sbjct: 200 LMIQ 203



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 23/76 (30%), Positives = 42/76 (55%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   P ++++TR Q+    +  +   +G LI  S+ +I+Q+EGL+G Y G    ++  +P
Sbjct: 309 TITYPHEILRTRMQIQSSNRNKSDKQKGKLI-NSIIKIYQKEGLKGFYAGYGVNLIRTVP 367

Query: 660 NWAVYFTIYEQLKSFL 707
             AV    +E  K++L
Sbjct: 368 ASAVTLVSFEYFKTYL 383



 Score = 40.8 bits (94), Expect = 0.053
 Identities = 32/138 (23%), Positives = 60/138 (43%), Gaps = 22/138 (15%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVH-----------------GLPKLGNTNIRGSLIVGSLEQIFQREGLR 614
           V P+ V+KTR  +                    PK+  T  +G+L   ++  +++ EG+R
Sbjct: 190 VNPIWVVKTRLMIQTGSGSTIYNNNAENKSAAQPKVERTYYKGTL--DAIRTMYKEEGIR 247

Query: 615 GMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD-----DERHELSIXXXXXXXXXXXXX 779
             Y GL P++  LL +  ++F +YE+LK +L  D      +  + ++             
Sbjct: 248 VFYSGLIPSLFGLL-HVGIHFPVYEKLKLWLECDLKSASADEQKSTLGRLIAASSVSKMI 306

Query: 780 XXXXXNPLWVVKTRLQTQ 833
                 P  +++TR+Q Q
Sbjct: 307 ASTITYPHEILRTRMQIQ 324



 Score = 38.1 bits (87), Expect(3) = 5e-23
 Identities = 15/30 (50%), Positives = 22/30 (73%)
 Frame = +1

Query: 979  IVVSGLVTALAGISHVAIQFPTYEKIKIYL 1068
            +  SGL+ +L G+ HV I FP YEK+K++L
Sbjct: 248  VFYSGLIPSLFGLLHVGIHFPVYEKLKLWL 277



 Score = 21.6 bits (44), Expect(3) = 5e-23
 Identities = 8/16 (50%), Positives = 13/16 (81%)
 Frame = +2

Query: 854 RGTLSALRRIAREKGI 901
           +GTL A+R + +E+GI
Sbjct: 231 KGTLDAIRTMYKEEGI 246



>gb:CR380956_1652067 Candida glabrata strain CBS138 chromosome J
           complete sequence.
          Length = 361

 Score = 84.0 bits (206), Expect(2) = 1e-19
 Identities = 48/130 (36%), Positives = 65/130 (50%), Gaps = 2/130 (1%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNI--RGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           VCPLDV KTR Q  GL      N+  RGS  +G++  I + EG+RG+Y+GL P ++   P
Sbjct: 86  VCPLDVAKTRLQAQGLQTRTTENLYYRGS--IGTMTTIVRDEGVRGLYKGLVPIIMGYFP 143

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGM 839
            W +YF++YE  K  L ++      S                   NP+WVVKTRL  Q  
Sbjct: 144 TWMIYFSVYEFCKDNLRTNSS--NWSFVSHSFSAITAGAVSTVVTNPIWVVKTRLMLQ-T 200

Query: 840 RAGVVGVHYR 869
             G    HY+
Sbjct: 201 HIGSNTTHYQ 210



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 33/117 (28%), Positives = 61/117 (52%), Gaps = 5/117 (4%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+ V+KTR  +        T+ +G+    + ++I  +EG++ +Y GL P++L LL + A+
Sbjct: 188 PIWVVKTRLMLQTHIGSNTTHYQGTY--DAFKKIINQEGVKALYAGLVPSLLGLL-HVAI 244

Query: 672 YFTIYEQLK-SFLC--SDDERHE--LSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
           +F +YE+LK SF C   D+  +E  +++                   P  +++TRLQ
Sbjct: 245 HFPVYERLKVSFKCYQRDESSNESKINLKRLILASSVSKMVASVLSYPHEILRTRLQ 301



 Score = 35.8 bits (81), Expect(2) = 1e-19
 Identities = 14/25 (56%), Positives = 20/25 (80%)
 Frame = +1

Query: 988  SGLVTALAGISHVAIQFPTYEKIKI 1062
            +GLV +L G+ HVAI FP YE++K+
Sbjct: 230  AGLVPSLLGLLHVAIHFPVYERLKV 254



>sp|P40556|YIA6_YEAST Putative mitochondrial carrier
           YIL006W.>pir|S48451|S48451 probable membrane protein
           YIL006w - yeast (Saccharomyces
           cerevisiae)>gb:SC4554_1705293 S.cerevisiae chromosome IX
           lambda clone 4554.
          Length = 373

 Score = 83.6 bits (205), Expect(2) = 5e-19
 Identities = 50/129 (38%), Positives = 62/129 (48%), Gaps = 1/129 (0%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLP-KLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           VCPLDV KTR Q  GL  +  N   RG  I+G+L  I + EG RG+Y+GL P VL   P 
Sbjct: 95  VCPLDVAKTRLQAQGLQTRFENPYYRG--IMGTLSTIVRDEGPRGLYKGLVPIVLGYFPT 152

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMR 842
           W +YF++YE  K F        +                     NP+WVVKTRL  Q   
Sbjct: 153 WMIYFSVYEFSKKFF--HGIFPQFDFVAQSCAAITAGAASTTLTNPIWVVKTRLMLQS-N 209

Query: 843 AGVVGVHYR 869
            G    HY+
Sbjct: 210 LGEHPTHYK 218



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 32/112 (28%), Positives = 52/112 (46%), Gaps = 2/112 (1%)
 Frame = +3

Query: 411 HGPSPK-GLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLE 587
           HG  P+   +              T   P+ V+KTR  +        T+ +G+    +  
Sbjct: 168 HGIFPQFDFVAQSCAAITAGAASTTLTNPIWVVKTRLMLQSNLGEHPTHYKGTF--DAFR 225

Query: 588 QIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLK-SFLCSDDERHELSI 740
           ++F +EG + +Y GL P++L L  + A++F IYE LK  F C   E +  SI
Sbjct: 226 KLFYQEGFKALYAGLVPSLLGLF-HVAIHFPIYEDLKVRFHCYSRENNTNSI 276



 Score = 34.3 bits (77), Expect(2) = 5e-19
 Identities = 14/25 (56%), Positives = 19/25 (76%)
 Frame = +1

Query: 988  SGLVTALAGISHVAIQFPTYEKIKI 1062
            +GLV +L G+ HVAI FP YE +K+
Sbjct: 238  AGLVPSLLGLFHVAIHFPIYEDLKV 262



>sp|P39953|YEA6_YEAST Putative mitochondrial carrier
           YEL006W.>pir|S50453|S50453 hypothetical protein YEL006w
           - yeast (Saccharomyces cerevisiae)>gb:SCE9871_1708256
           Saccharomyces cerevisiae chromosome V cosmids 9871,
           8199, 9867, 9495 and lambda clones 6693 and 5898.
          Length = 335

 Score = 78.2 bits (191), Expect(2) = 1e-17
 Identities = 43/128 (33%), Positives = 59/128 (46%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           VCP DV KTR Q  GL  + + +       G+   IF+ EG  G+Y+GL PTVL  +P  
Sbjct: 56  VCPFDVAKTRLQAQGLQNMTHQSQHYKGFFGTFATIFKDEGAAGLYKGLQPTVLGYIPTL 115

Query: 666 AVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMRA 845
            +YF++Y+  + +  S D                         NP+WVVKTRL  Q    
Sbjct: 116 MIYFSVYDFCRKY--SVDIFPHSPFLSNASSAITAGAISTVATNPIWVVKTRLMLQ-TGI 172

Query: 846 GVVGVHYR 869
           G    HY+
Sbjct: 173 GKYSTHYK 180



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 28/89 (31%), Positives = 46/89 (51%), Gaps = 1/89 (1%)
 Frame = +3

Query: 435 LCNXXXXXXXXXXXXTFVCPLDVIKTRFQVH-GLPKLGNTNIRGSLIVGSLEQIFQREGL 611
           L N                P+ V+KTR  +  G+ K  +T+ +G+  + +  +I Q+EG 
Sbjct: 139 LSNASSAITAGAISTVATNPIWVVKTRLMLQTGIGKY-STHYKGT--IDTFRKIIQQEGA 195

Query: 612 RGMYRGLSPTVLALLPNWAVYFTIYEQLK 698
           + +Y GL P +L +L N A+ F +YE LK
Sbjct: 196 KALYAGLVPALLGML-NVAIQFPLYENLK 223



 Score = 35.0 bits (79), Expect(2) = 1e-17
 Identities = 16/25 (64%), Positives = 20/25 (80%)
 Frame = +1

Query: 988  SGLVTALAGISHVAIQFPTYEKIKI 1062
            +GLV AL G+ +VAIQFP YE +KI
Sbjct: 200  AGLVPALLGMLNVAIQFPLYENLKI 224



>gb:CR382124_1656951 Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 431

 Score = 75.1 bits (183), Expect(2) = 5e-17
 Identities = 51/145 (35%), Positives = 67/145 (46%), Gaps = 17/145 (11%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGN-TNIRGSL-----------IVGSLEQIFQREGLRGMYRG 629
           VCPLDV KTR Q  GL   G  T   GS+           I G+L  I + E +RG+Y+G
Sbjct: 121 VCPLDVAKTRLQAQGLQLNGPVTRPVGSVATTFGGKYYSGIWGTLTTIVRDESIRGLYKG 180

Query: 630 LSPTVLALLPNWAVYFTIYEQLK-----SFLCSDDERHELSIXXXXXXXXXXXXXXXXXX 794
           + P VL   P W +YF++YE+ K      F  S+   H +S                   
Sbjct: 181 IVPIVLGYFPTWMIYFSVYERCKLSYPRYFNNSEFLSHSMS-------ALTAGAISTTLT 233

Query: 795 NPLWVVKTRLQTQGMRAGVVGVHYR 869
           NP+WVVKTRL  Q  +      HY+
Sbjct: 234 NPIWVVKTRLMLQSGKNIKGMTHYK 258



 Score = 41.2 bits (95), Expect = 0.041
 Identities = 25/77 (32%), Positives = 45/77 (58%), Gaps = 1/77 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKL-GNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALL 656
           T   P+ V+KTR  +     + G T+ + +L   +  +I++ EG++  Y GL P++  LL
Sbjct: 231 TLTNPIWVVKTRLMLQSGKNIKGMTHYKNTL--DAFIKIYKVEGIKSFYSGLIPSLFGLL 288

Query: 657 PNWAVYFTIYEQLKSFL 707
            + A++F +YE+LK  L
Sbjct: 289 -HVAIHFPVYEKLKKVL 304



 Score = 36.2 bits (82), Expect(2) = 5e-17
 Identities = 15/24 (62%), Positives = 19/24 (79%)
 Frame = +1

Query: 988  SGLVTALAGISHVAIQFPTYEKIK 1059
            SGL+ +L G+ HVAI FP YEK+K
Sbjct: 278  SGLIPSLFGLLHVAIHFPVYEKLK 301



>gb:CR382131_1664134 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 306

 Score = 87.0 bits (214), Expect = 6e-16
 Identities = 42/117 (35%), Positives = 61/117 (52%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           VCPLDVIKTR Q  G       +++G L   +++ I + +G+RG+YRG+ P +L   P W
Sbjct: 37  VCPLDVIKTRLQAEGALDKQRGSLKGGL-TRTMDSIVKHDGVRGLYRGVIPIILGYSPTW 95

Query: 666 AVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
            +YF +YE+ K  L +  +                        NP+WVVKTRL +QG
Sbjct: 96  MIYFAVYEKSKYLLSTVPQLDPYPFFSHCLSALGAGAASTTITNPIWVVKTRLMSQG 152



 Score = 42.0 bits (97), Expect = 0.024
 Identities = 19/30 (63%), Positives = 23/30 (76%)
 Frame = +1

Query: 979  IVVSGLVTALAGISHVAIQFPTYEKIKIYL 1068
            +  SGL  AL G+SHVAIQFP YEK+K+ L
Sbjct: 177  VFYSGLGPALLGLSHVAIQFPMYEKLKVML 206



>gb:NC20H10_1688473 Neurospora crassa DNA linkage group V Cosmid
           contig 20H10.
          Length = 450

 Score = 86.3 bits (212), Expect = 1e-15
 Identities = 45/116 (38%), Positives = 65/116 (56%), Gaps = 1/116 (0%)
 Frame = +3

Query: 489 CPLDVIKTRFQVHGLPK-LGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           CPLDVIKT+ Q  G  + +G   +   L VG+ + I++ EG+RGMYRGL P ++  LP W
Sbjct: 110 CPLDVIKTKLQAQGAGQHVGQPRMYNGL-VGTAKVIWRHEGIRGMYRGLGPIIMGYLPTW 168

Query: 666 AVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
           AV+FT+Y + K +L    ++    I                  NP+WV+KTRL +Q
Sbjct: 169 AVWFTVYNKSKIWLRQYTDK---PIAINFGASIIAGASSTIATNPIWVIKTRLMSQ 221



 Score = 40.8 bits (94), Expect = 0.053
 Identities = 18/31 (58%), Positives = 22/31 (70%)
 Frame = +1

Query: 988  SGLVTALAGISHVAIQFPTYEKIKIYLANRG 1080
            SGL  AL G+SHVA+QFPTYE +K     +G
Sbjct: 258  SGLTPALLGLSHVAVQFPTYEFLKTKFTGQG 288



 Score = 35.4 bits (80), Expect = 2.2
 Identities = 26/89 (29%), Positives = 38/89 (42%), Gaps = 7/89 (7%)
 Frame = +3

Query: 588 QIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFL-------CSDDERHELSIXX 746
           +++  EGL   Y GL+P +L  L + AV F  YE LK+          + D+  + S   
Sbjct: 246 KMYTTEGLLSFYSGLTPALLG-LSHVAVQFPTYEFLKTKFTGQGMGGAAGDQNAKPSFMG 304

Query: 747 XXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
                            P  V++TRLQTQ
Sbjct: 305 TFAASVLSKIIASSATYPHEVIRTRLQTQ 333



>gb:AE016817_1747376 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 379

 Score = 81.6 bits (200), Expect = 3e-14
 Identities = 49/120 (40%), Positives = 61/120 (50%), Gaps = 4/120 (3%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           VCPLDV KTR Q  G    G    RG  IVG+L  I + EG+ G+Y+GL+P VL   P W
Sbjct: 102 VCPLDVAKTRLQAQGAGS-GERYYRG--IVGTLSAILRDEGVAGLYKGLAPIVLGYFPTW 158

Query: 666 AVYFTIYEQLK----SFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
            +YF++YE+ K    S+L      H  S                   NP+WVVKTRL  Q
Sbjct: 159 MLYFSVYEKCKQRYPSYLPGGFVSHAAS-------ALTAGAISTALTNPIWVVKTRLMIQ 211



 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 33/145 (22%), Positives = 64/145 (44%), Gaps = 8/145 (5%)
 Frame = +3

Query: 423 PKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQR 602
           P G + +                P+ V+KTR  +       +TN R +L   +  ++++ 
Sbjct: 177 PGGFVSHAASALTAGAISTALTNPIWVVKTRLMIQSDVSRDSTNYRSTL--DAFRKMYRS 234

Query: 603 EGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFL-----CSDDER---HELSIXXXXXX 758
           EGL+  Y GL P++  L  + A++F +YE+LK +L      +D +R   ++L +      
Sbjct: 235 EGLKVFYSGLVPSLFGLF-HVAIHFPVYEKLKIWLHRNTPAADGQRLDHNKLQLDRLIVA 293

Query: 759 XXXXXXXXXXXXNPLWVVKTRLQTQ 833
                        P  +++TR+Q +
Sbjct: 294 SCLSKVVASVITYPHEILRTRMQVR 318



 Score = 40.8 bits (94), Expect = 0.053
 Identities = 18/30 (60%), Positives = 23/30 (76%)
 Frame = +1

Query: 979  IVVSGLVTALAGISHVAIQFPTYEKIKIYL 1068
            +  SGLV +L G+ HVAI FP YEK+KI+L
Sbjct: 239  VFYSGLVPSLFGLFHVAIHFPVYEKLKIWL 268



>gb:AE013599_1130809 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003834_1226913 Drosophila melanogaster
           chromosome 2R, section 16 of 74 of the complete
           sequence.
          Length = 360

 Score = 66.2 bits (160), Expect(3) = 3e-14
 Identities = 37/114 (32%), Positives = 54/114 (47%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD+IK RF V+          RG  +  +   IF++EG RG+Y+G++P V     +W +
Sbjct: 42  PLDLIKIRFAVNDGRTATVPQYRG--LSSAFTTIFRQEGFRGLYKGVTPNVWGSGSSWGL 99

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
           YF  Y  +K+F+   +    L                    NP+WVVKTRL  Q
Sbjct: 100 YFMFYNTIKTFIQGGNTTMPLGPTMNMLAAAESGILTLLLTNPIWVVKTRLCLQ 153



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 28/93 (30%), Positives = 45/93 (48%)
 Frame = +3

Query: 423 PKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQR 602
           P G   N                P+ V+KTR  +       +   RG  ++ +L QI++ 
Sbjct: 119 PLGPTMNMLAAAESGILTLLLTNPIWVVKTRLCLQ-CDAASSAEYRG--MIHALGQIYKE 175

Query: 603 EGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKS 701
           EG+RG+YRG  P +L  + + A+ F  YE+LK+
Sbjct: 176 EGIRGLYRGFVPGMLG-VSHGAIQFMTYEELKN 207



 Score = 35.0 bits (79), Expect = 2.9
 Identities = 16/43 (37%), Positives = 25/43 (58%)
 Frame = +3

Query: 603 EGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHE 731
           EG RG Y+GL  ++  ++P   V F +YE +  FL +  +R E
Sbjct: 310 EGYRGFYKGLKASLTRVVPACMVTFLVYENVSHFLLARRKRIE 352



 Score = 31.6 bits (70), Expect(3) = 3e-14
 Identities = 13/23 (56%), Positives = 17/23 (73%)
 Frame = +1

Query: 991  GLVTALAGISHVAIQFPTYEKIK 1059
            G V  + G+SH AIQF TYE++K
Sbjct: 184  GFVPGMLGVSHGAIQFMTYEELK 206



 Score = 23.5 bits (49), Expect(3) = 3e-14
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = +2

Query: 854 RGTLSALRRIAREKGILGLF 913
           RG + AL +I +E+GI GL+
Sbjct: 163 RGMIHALGQIYKEEGIRGLY 182



>gb:AX453492_1468810 Sequence 53 from Patent WO0242455.
          Length = 322

 Score = 66.2 bits (160), Expect(3) = 3e-14
 Identities = 37/114 (32%), Positives = 54/114 (47%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD+IK RF V+          RG  +  +   IF++EG RG+Y+G++P V     +W +
Sbjct: 42  PLDLIKIRFAVNDGRTATVPQYRG--LSSAFTTIFRQEGFRGLYKGVTPNVWGSGSSWGL 99

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
           YF  Y  +K+F+   +    L                    NP+WVVKTRL  Q
Sbjct: 100 YFMFYNTIKTFIQGGNTTMPLGPTMNMLAAAESGILTLLLTNPIWVVKTRLCLQ 153



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 28/93 (30%), Positives = 45/93 (48%)
 Frame = +3

Query: 423 PKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQR 602
           P G   N                P+ V+KTR  +       +   RG  ++ +L QI++ 
Sbjct: 119 PLGPTMNMLAAAESGILTLLLTNPIWVVKTRLCLQ-CDAASSAEYRG--MIHALGQIYKE 175

Query: 603 EGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKS 701
           EG+RG+YRG  P +L  + + A+ F  YE+LK+
Sbjct: 176 EGIRGLYRGFVPGMLG-VSHGAIQFMTYEELKN 207



 Score = 38.5 bits (88), Expect = 0.26
 Identities = 23/80 (28%), Positives = 39/80 (48%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P  V++ R Q H     G  +         ++Q ++ EG RG Y+GL  ++  ++P   V
Sbjct: 243 PYQVVRARLQDHHHRYNGTWDC--------IKQTWRFEGYRGFYKGLKASLTRVVPACMV 294

Query: 672 YFTIYEQLKSFLCSDDERHE 731
            F +YE +  FL +  +R E
Sbjct: 295 TFLVYENVSHFLLARRKRIE 314



 Score = 31.6 bits (70), Expect(3) = 3e-14
 Identities = 13/23 (56%), Positives = 17/23 (73%)
 Frame = +1

Query: 991  GLVTALAGISHVAIQFPTYEKIK 1059
            G V  + G+SH AIQF TYE++K
Sbjct: 184  GFVPGMLGVSHGAIQFMTYEELK 206



 Score = 23.5 bits (49), Expect(3) = 3e-14
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = +2

Query: 854 RGTLSALRRIAREKGILGLF 913
           RG + AL +I +E+GI GL+
Sbjct: 163 RGMIHALGQIYKEEGIRGLY 182



>gb:AE013599_1130810 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003834_1226914 Drosophila melanogaster
           chromosome 2R, section 16 of 74 of the complete
           sequence.>gb:AY060332_1292244 Drosophila melanogaster
           GH22139 full length cDNA.>gb:AX453446_1468805 Sequence 7
           from Patent WO0242455.
          Length = 304

 Score = 66.2 bits (160), Expect(3) = 3e-14
 Identities = 37/114 (32%), Positives = 54/114 (47%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD+IK RF V+          RG  +  +   IF++EG RG+Y+G++P V     +W +
Sbjct: 42  PLDLIKIRFAVNDGRTATVPQYRG--LSSAFTTIFRQEGFRGLYKGVTPNVWGSGSSWGL 99

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
           YF  Y  +K+F+   +    L                    NP+WVVKTRL  Q
Sbjct: 100 YFMFYNTIKTFIQGGNTTMPLGPTMNMLAAAESGILTLLLTNPIWVVKTRLCLQ 153



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 28/93 (30%), Positives = 45/93 (48%)
 Frame = +3

Query: 423 PKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQR 602
           P G   N                P+ V+KTR  +       +   RG  ++ +L QI++ 
Sbjct: 119 PLGPTMNMLAAAESGILTLLLTNPIWVVKTRLCLQ-CDAASSAEYRG--MIHALGQIYKE 175

Query: 603 EGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKS 701
           EG+RG+YRG  P +L  + + A+ F  YE+LK+
Sbjct: 176 EGIRGLYRGFVPGMLG-VSHGAIQFMTYEELKN 207



 Score = 33.9 bits (76), Expect = 6.5
 Identities = 20/70 (28%), Positives = 35/70 (50%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P  V++ R Q H     G  +         ++Q ++ E +RG Y+GL P ++ + PN  +
Sbjct: 243 PYQVVRARLQDHHHRYNGTWDC--------IKQTWRYERMRGFYKGLVPYLVHVTPNICM 294

Query: 672 YFTIYEQLKS 701
              I+E+L S
Sbjct: 295 VMLIWEKLTS 304



 Score = 31.6 bits (70), Expect(3) = 3e-14
 Identities = 13/23 (56%), Positives = 17/23 (73%)
 Frame = +1

Query: 991  GLVTALAGISHVAIQFPTYEKIK 1059
            G V  + G+SH AIQF TYE++K
Sbjct: 184  GFVPGMLGVSHGAIQFMTYEELK 206



 Score = 23.5 bits (49), Expect(3) = 3e-14
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = +2

Query: 854 RGTLSALRRIAREKGILGLF 913
           RG + AL +I +E+GI GL+
Sbjct: 163 RGMIHALGQIYKEEGIRGLY 182



>gb:AP002483_1822209 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0019D06.>gb:AP003311_1827803
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 1, PAC clone:P0024G09.
          Length = 305

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 38/84 (45%), Positives = 52/84 (61%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD++K R Q+ G    G +++  S I G++ QIFQ+EGLRG YRG+ P  L ++P
Sbjct: 223 TATFPLDLVKRRMQLQGAA--GTSSVCKSSITGTIRQIFQKEGLRGFYRGIVPEYLKVVP 280

Query: 660 NWAVYFTIYEQLKSFLCSDDERHE 731
           +  + F  YE LKS L S DE  E
Sbjct: 281 SVGIAFMTYETLKSLLSSIDEDDE 304



 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 33/115 (28%), Positives = 56/115 (48%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLDV++TR       +      +G  I  ++  I + EG++G+Y+GL  T+L + P+ A+
Sbjct: 132 PLDVVRTRLATQKTTRY----YKG--IFHAVSTICRDEGVKGLYKGLGATLLGVGPSIAI 185

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
            FT+YE L+S    +  +   ++                   PL +VK R+Q QG
Sbjct: 186 SFTVYESLRSHWQMERPQDSPAVVSLFSGSLSGIASSTATF-PLDLVKRRMQLQG 239



>pir|T50159|T50159 mitochondrial carrier protein [imported] -
           fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC227_1717127 S.pombe chromosome I cosmid
           c227.
          Length = 371

 Score = 70.9 bits (172), Expect = 5e-11
 Identities = 46/143 (32%), Positives = 64/143 (44%), Gaps = 27/143 (18%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVH-GLPKLG---NTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLAL 653
           V PLDV+KTR Q        G   NT + G  +  S+  IF  EG+ G+YRG+ P +L  
Sbjct: 23  VAPLDVVKTRKQAQKAFYSTGGGKNTMVLGGTL-SSMRTIFHNEGIAGLYRGVGPMMLGY 81

Query: 654 LPNWAVYFTIYEQ-----------------------LKSFLCSDDERHELSIXXXXXXXX 764
           LP+W++YF +YE+                       +K+ L S D++             
Sbjct: 82  LPSWSIYFVVYEKCKVLFGVNKKYTSLHEIDSSKVGIKASLDSSDKQFYRYWGGQIFSAV 141

Query: 765 XXXXXXXXXXNPLWVVKTRLQTQ 833
                     NP+WVVKTRL TQ
Sbjct: 142 IAGAASVTLTNPIWVVKTRLVTQ 164



 Score = 38.1 bits (87), Expect = 0.34
 Identities = 26/84 (30%), Positives = 39/84 (46%)
 Frame = +3

Query: 579 SLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXX 758
           +  +I++ EGL   YRGL P++   L +  + F +YE  KSFL  DD   + S       
Sbjct: 236 AFRKIYKYEGLAAFYRGLFPSLFGTL-HVGIQFPLYEYFKSFL--DDFFGKKSNFHIVLA 292

Query: 759 XXXXXXXXXXXXNPLWVVKTRLQT 830
                        P  V++TRLQ+
Sbjct: 293 ATLSKIAASTVTYPHEVLRTRLQS 316



>gb:AE017341_1754628 Cryptococcus neoformans var. neoformans JEC21
           chromosome 1, complete sequence.
          Length = 382

 Score = 67.8 bits (164), Expect = 4e-10
 Identities = 39/118 (33%), Positives = 53/118 (44%), Gaps = 3/118 (2%)
 Frame = +3

Query: 489 CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA 668
           CPLDV+KTR Q               +I+   + I+   G RG YRGL PT+   LP W 
Sbjct: 42  CPLDVVKTRLQAQAASVHHKDYQTVEMII---KDIWTSGGFRGFYRGLGPTLAGYLPTWG 98

Query: 669 VYFTIYEQLKSFLCSDDERHELSI---XXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
           +YFT+Y+ +K  L +     +L                       +PLWV+KTRL  Q
Sbjct: 99  IYFTVYDLVKDRLGAWAAHSDLPTKPSMVHIVAAMTAGATGTCMTSPLWVIKTRLMAQ 156



 Score = 42.4 bits (98), Expect = 0.018
 Identities = 20/41 (48%), Positives = 27/41 (65%)
 Frame = +1

Query: 991  GLVTALAGISHVAIQFPTYEKIKIYLANRGTSLFSFSLFIC 1113
            GL+ +L GISHVA+QFP YEK K +     +SL   ++ IC
Sbjct: 187  GLLPSLMGISHVAVQFPLYEKAKSWSEGDHSSLTPSTILIC 227



>gb:BC087370_2565215 Xenopus laevis hypothetical LOC495984, mRNA
           (cDNA clone MGC:99132 IMAGE:7205791), complete cds.
          Length = 318

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 39/114 (34%), Positives = 57/114 (50%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD++K RF V    +L     RG  IV  L  ++QREGLRG+Y+G++P +     +W +
Sbjct: 45  PLDLVKIRFAVSDGLEL-RPKYRG--IVHCLATVWQREGLRGLYQGVTPNMWGAGASWGL 101

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
           YF  Y  +K++   +    +LS                   NP+WV KTRL  Q
Sbjct: 102 YFFFYNAVKAYK-KEGRAEDLSAVEHLLSAAGAGALTLCFTNPIWVTKTRLVLQ 154



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 17/72 (23%), Positives = 40/72 (55%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P  V++ R Q        + + R + ++  + + +++EG++G Y+G+ P ++ + P   +
Sbjct: 247 PYQVVRARLQ--------DQHNRYTGVLDVISRTWRKEGVQGFYKGIVPNIIRVTPACCI 298

Query: 672 YFTIYEQLKSFL 707
            F +YE++  FL
Sbjct: 299 TFVVYEKVSHFL 310



 Score = 35.0 bits (79), Expect = 2.9
 Identities = 33/130 (25%), Positives = 56/130 (43%), Gaps = 4/130 (3%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           F  P+ V KTR  +     + ++  +   +  +L +I++ EG+ G+Y+G  P +L    +
Sbjct: 140 FTNPIWVTKTRLVLQYDAGIDSSKRQYRGMFHALGKIYRNEGIPGLYKGFVPGLLG-TSH 198

Query: 663 WAVYFTIYEQLK---SFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
            A+ F  YE+LK   +   +     +L                     P  VV+ RLQ Q
Sbjct: 199 GALQFMAYEELKMEYNKYLNRPSDTKLGTLEYITMAALSKIFAVSTTYPYQVVRARLQDQ 258

Query: 834 GMR-AGVVGV 860
             R  GV+ V
Sbjct: 259 HNRYTGVLDV 268



>gb:AY084815_1569898 Arabidopsis thaliana clone 118596 mRNA,
           complete sequence.
          Length = 308

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 40/119 (33%), Positives = 55/119 (46%), Gaps = 5/119 (4%)
 Frame = +3

Query: 492 PLDVIKTRFQVH-----GLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALL 656
           PLDV++TRFQV+      LP   NT         ++  I + EGLRG+Y G  P V+   
Sbjct: 26  PLDVVRTRFQVNDGRGSSLPTYKNT-------AHAVFTIARLEGLRGLYAGFFPAVIGST 78

Query: 657 PNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
            +W +YF  Y + K       +  +LS                   NP+W+VKTRLQ Q
Sbjct: 79  VSWGLYFFFYGRAKQRYARGRDDEKLSPALHLASAAEAGALVCLCTNPIWLVKTRLQLQ 137



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 4/76 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           P  VI+ R Q     +G+P+  ++       +  + +  + EGLRG YRGL+  +L  +P
Sbjct: 232 PFQVIRARLQQRPSTNGIPRYIDS-------LHVVRETARYEGLRGFYRGLTANLLKNVP 284

Query: 660 NWAVYFTIYEQLKSFL 707
             ++ F +YE +   L
Sbjct: 285 ASSITFIVYENVLKLL 300



>gb:AC096689_1736274 Oryza sativa chromosome 3 BAC OSJNBa0027J18
           genomic sequence, complete sequence.
          Length = 318

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 43/121 (35%), Positives = 57/121 (47%), Gaps = 7/121 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQVHG------LPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLAL 653
           PLDV++TRFQV G      LP   NT         ++  I + EGLRG+Y G  P VL  
Sbjct: 35  PLDVVRTRFQVSGGRGCYDLPPYRNT-------AHAVYTIARSEGLRGLYAGFYPAVLGS 87

Query: 654 LPNWAVYFTIYEQLKS-FLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQT 830
             +W +YF  Y + K  +L   D+  +L                    NP+W+VKTRLQ 
Sbjct: 88  TVSWGLYFFFYNRAKQRYLQGKDD--QLRPVHHLVSAAEAGALVCLFTNPIWLVKTRLQL 145

Query: 831 Q 833
           Q
Sbjct: 146 Q 146



>gb:AP004139_1838151 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1486_E07.>gb:AP005108_1847976 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0461B08.
          Length = 618

 Score = 63.9 bits (154), Expect = 6e-09
 Identities = 31/79 (39%), Positives = 50/79 (63%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P DV+KTR Q+  L  +   +     ++ +L++IFQ EGL+G+YRGL+P +   +   A+
Sbjct: 540 PFDVVKTRVQLQALSPISKYDG----VLHALKEIFQHEGLQGLYRGLAPRLAMYISQGAI 595

Query: 672 YFTIYEQLKSFLCSDDERH 728
           +FT YE LK+ + S+ E H
Sbjct: 596 FFTSYEFLKTIMFSEQELH 614



>gb:BT010139_1640205 Arabidopsis thaliana At5g66380 gene, complete
           cds.
          Length = 308

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 39/118 (33%), Positives = 54/118 (45%), Gaps = 5/118 (4%)
 Frame = +3

Query: 495 LDVIKTRFQVH-----GLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           LDV++TRFQV+      LP   NT         ++  I + EGLRG+Y G  P V+    
Sbjct: 27  LDVVRTRFQVNDGRGSSLPTYKNT-------AHAVFTIARLEGLRGLYAGFFPAVIGSTV 79

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
           +W +YF  Y + K       +  +LS                   NP+W+VKTRLQ Q
Sbjct: 80  SWGLYFFFYGRAKQRYARGRDDEKLSPALHLASAAEAGALVCLCTNPIWLVKTRLQLQ 137



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 22/76 (28%), Positives = 39/76 (51%), Gaps = 4/76 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           P  VI+ R Q     +G+P+  ++       +  + +  + EGLRG YRGL+  +L  +P
Sbjct: 232 PFQVIRARLQQRPSTNGIPRYIDS-------LHVIRETARYEGLRGFYRGLTANLLKNVP 284

Query: 660 NWAVYFTIYEQLKSFL 707
             ++ F +YE +   L
Sbjct: 285 ASSITFIVYENVLKLL 300



>gb:BC056716_2551909 Danio rerio zgc:65787, mRNA (cDNA clone
           MGC:65787 IMAGE:6790740), complete
           cds.>gb:BC065854_2554145 Danio rerio zgc:65787, mRNA
           (cDNA clone MGC:77728 IMAGE:7000719), complete cds.
          Length = 314

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 43/140 (30%), Positives = 63/140 (45%), Gaps = 20/140 (14%)
 Frame = +3

Query: 489 CPLDVIKTRFQVHGLP-------KLGNTNIRGSLIVGS--------LEQIFQREGLRGMY 623
           CPL+V+KTR Q  GL        +LG  N  G +  GS        L  I ++EG R ++
Sbjct: 25  CPLEVLKTRLQSSGLTLRPVFQVQLGTLNGAGVIRPGSVTPGLLQVLRSILEKEGPRSLF 84

Query: 624 RGLSPTVLALLPNWAVYFTIYEQLKS-----FLCSDDERHELSIXXXXXXXXXXXXXXXX 788
           RGL P ++ + P+ A+YF  Y + K      F+ +    H  S                 
Sbjct: 85  RGLGPNLVGVAPSRAIYFAAYSKSKETFNGIFVPNSGVVHMSS-------AGFAAFITNS 137

Query: 789 XXNPLWVVKTRLQTQGMRAG 848
             NP+W+VKTR+Q +    G
Sbjct: 138 LMNPIWMVKTRMQLEKKARG 157



 Score = 39.3 bits (90), Expect = 0.15
 Identities = 31/128 (24%), Positives = 56/128 (43%), Gaps = 11/128 (8%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLE---QIFQREGLRGMYRGLSPTVLALLPN 662
           P+ ++KTR Q+           RG   + +L+    +++ EG+RG YRGL+ +  A +  
Sbjct: 141 PIWMVKTRMQLE-------KKARGEKKMNALQCARYVYKTEGMRGFYRGLTAS-YAGISE 192

Query: 663 WAVYFTIYEQLKSFLC--------SDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKT 818
             + F IYE LK +L         +D+++                        P  V++T
Sbjct: 193 TMICFLIYETLKKYLAQSRFTTPDTDNDKGASDFLGLMFAAAFAKGCASCIAYPHEVIRT 252

Query: 819 RLQTQGMR 842
           RL+ +G +
Sbjct: 253 RLREEGSK 260



>gb:AJ720399_2502586 Gallus gallus mRNA for hypothetical protein,
           clone 16o11.
          Length = 322

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 36/118 (30%), Positives = 58/118 (49%), Gaps = 4/118 (3%)
 Frame = +3

Query: 492 PLDVIKTRFQVH-GL---PKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PLD++K RF V  GL   PK          I+  +  +++REGLRG+Y+G++P ++    
Sbjct: 49  PLDLVKIRFAVSDGLELRPKYNG-------ILHCMTTVWKREGLRGLYQGVTPNMVGAGA 101

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
           +W +YF  Y  +K++   + +   L+                   NP+WV KTRL  Q
Sbjct: 102 SWGLYFFFYNAIKAYK-KEGKLESLTATEHLVSAAEAGAMTLCITNPIWVTKTRLVLQ 158



 Score = 41.6 bits (96), Expect = 0.031
 Identities = 20/76 (26%), Positives = 39/76 (51%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   P  V++ R Q        + + R S ++  + + +++EG+ G Y+G+ P V+ + P
Sbjct: 247 TATYPYQVVRARLQ--------DQHNRYSGVLDVIRRTWRKEGIHGFYKGIVPNVIRVTP 298

Query: 660 NWAVYFTIYEQLKSFL 707
              + F +YE +  FL
Sbjct: 299 ACCITFVVYENVSGFL 314



 Score = 33.9 bits (76), Expect = 6.5
 Identities = 33/127 (25%), Positives = 55/127 (43%), Gaps = 4/127 (3%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+ V KTR  +     +  +  + + +  +L +I++ EG+RG+Y+G  P +     + A+
Sbjct: 147 PIWVTKTRLVLQYDAGVDPSKRQYTGMSDALIKIYKTEGIRGLYKGFVPGLFG-TSHGAL 205

Query: 672 YFTIYEQLKSFLCSDDER---HELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMR 842
            F  YE LK        R    +L+                    P  VV+ RLQ Q  R
Sbjct: 206 QFMAYEDLKQRYNKYRNRVSDTKLNTAEYIMMAAVSKIFAVTATYPYQVVRARLQDQHNR 265

Query: 843 -AGVVGV 860
            +GV+ V
Sbjct: 266 YSGVLDV 272



>gb:CR382138_1671058 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 365

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 39/142 (27%), Positives = 63/142 (44%), Gaps = 15/142 (10%)
 Frame = +3

Query: 489 CPLDVIKTRFQ-------VHGLPKLGNTNIR--------GSLIVGSLEQIFQREGLRGMY 623
           CPLDV+KTR Q        +  PK  N  I+        G++I G    ++  EG R ++
Sbjct: 72  CPLDVVKTRLQSDVYHSTYNRTPKSSNPVIKAAQHFKETGTVIRG----LYANEGTRALF 127

Query: 624 RGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPL 803
           +GL P ++ ++P  ++ F  Y   K F+ S+    +                     NP+
Sbjct: 128 KGLGPNLVGVIPARSINFFTYGATKDFISSNFNNGQEETWIHLVSGINAGFVTSTATNPI 187

Query: 804 WVVKTRLQTQGMRAGVVGVHYR 869
           W++KTRLQ    +    G HY+
Sbjct: 188 WLIKTRLQLDKTK----GKHYK 205



 Score = 37.0 bits (84), Expect = 0.77
 Identities = 19/66 (28%), Positives = 34/66 (51%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P +V++TR +   L   G     G  ++   + + + EGL  +Y GL+P +L  +PN  +
Sbjct: 295 PHEVVRTRLRQAPLESTGKPKYTG--LIQCFKLVIKEEGLASIYGGLTPHLLRTVPNSII 352

Query: 672 YFTIYE 689
            F  +E
Sbjct: 353 MFGTWE 358



 Score = 34.3 bits (77), Expect = 5.0
 Identities = 21/72 (29%), Positives = 41/72 (56%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+ +IKTR Q   L K    + + S      + + + EG++G+Y+GLS + L  + +  +
Sbjct: 186 PIWLIKTRLQ---LDKTKGKHYKNSW--DCFKNVIKHEGVKGLYKGLSASYLGGVES-TL 239

Query: 672 YFTIYEQLKSFL 707
            + +YE++KS +
Sbjct: 240 QWVLYEEMKSII 251



>gb:BC011293_2091362 Mus musculus RIKEN cDNA 5730438N18 gene, mRNA
           (cDNA clone MGC:19266 IMAGE:3989313), complete cds.
          Length = 320

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 42/139 (30%), Positives = 65/139 (46%), Gaps = 22/139 (15%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGL-------PKLGNTNIRGSLIVGS----------LEQIFQREGL 611
           F CPL+VIKTR Q   L       P++    I G+ +V            L+ I ++EG 
Sbjct: 28  FTCPLEVIKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSVTPGLLQVLKSILEKEGP 87

Query: 612 RGMYRGLSPTVLALLPNWAVYFTIYEQLKS-----FLCSDDERHELSIXXXXXXXXXXXX 776
           + ++RGL P ++ + P+ AVYF  Y + K      F+ + +  H LS             
Sbjct: 88  KSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFNGVFVPNSNTVHILS-------AGSAAF 140

Query: 777 XXXXXXNPLWVVKTRLQTQ 833
                 NP+W+VKTR+Q +
Sbjct: 141 VTNTLMNPIWMVKTRMQLE 159



 Score = 40.4 bits (93), Expect = 0.069
 Identities = 35/132 (26%), Positives = 58/132 (43%), Gaps = 11/132 (8%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLE---QIFQREGLRGMYRGLSPTVLA 650
           T + P+ ++KTR Q+          +RG   + +L+   +++Q EG+RG YRGL+ +  A
Sbjct: 144 TLMNPIWMVKTRMQLE-------RKVRGCKQMNTLQCARRVYQTEGVRGFYRGLTAS-YA 195

Query: 651 LLPNWAVYFTIYEQLKSFL------CSDD--ERHELSIXXXXXXXXXXXXXXXXXXNPLW 806
            +    + F IYE LK  L       S D  E+                        P  
Sbjct: 196 GISETIICFAIYESLKKCLKDAPIVSSTDGAEKSSSGFFGLMAAAAVSKGCASCIAYPHE 255

Query: 807 VVKTRLQTQGMR 842
           V++TRL+ +G +
Sbjct: 256 VIRTRLREEGSK 267



>gb:AF283645_1894677 Homo sapiens folate transporter/carrier mRNA,
           complete cds; nuclear gene for mitochondrial product.
          Length = 315

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 39/118 (33%), Positives = 54/118 (45%), Gaps = 4/118 (3%)
 Frame = +3

Query: 492 PLDVIKTRFQVH-GL---PKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PLD++K RF V  GL   PK          I+  L  I++ +GLRG+Y+G++P +     
Sbjct: 42  PLDLVKIRFAVSDGLELRPKYNG-------ILHCLTTIWKLDGLRGLYQGVTPNIWGAGL 94

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
           +W +YF  Y  +KS+       H L                    NPLWV KTRL  Q
Sbjct: 95  SWGLYFFFYNAIKSYKTEGRAEH-LEATEYLVSAAEAGAMTLCITNPLWVTKTRLMLQ 151



 Score = 38.9 bits (89), Expect = 0.20
 Identities = 18/80 (22%), Positives = 42/80 (52%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P  V++ R Q        + ++  S ++  + + +++EG+ G Y+G++P ++ + P   +
Sbjct: 244 PYQVVRARLQ--------DQHMFYSGVIDVITKTWRKEGVGGFYKGIAPNLIRVTPACCI 295

Query: 672 YFTIYEQLKSFLCSDDERHE 731
            F +YE +  FL    E+ +
Sbjct: 296 TFVVYENVSHFLLDLREKRK 315



 Score = 37.4 bits (85), Expect = 0.59
 Identities = 35/127 (27%), Positives = 55/127 (43%), Gaps = 4/127 (3%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PL V KTR  +     + + + +   +  +L +I++ EG+RG+Y+G  P +     + A+
Sbjct: 140 PLWVTKTRLMLQYDAVVNSPHRQYKGMFDTLVKIYKYEGVRGLYKGFVPGLFG-TSHGAL 198

Query: 672 YFTIYEQLKSFLCSDDER---HELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGM- 839
            F  YE LK        R    +LS                    P  VV+ RLQ Q M 
Sbjct: 199 QFMAYELLKLKYNQHINRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMF 258

Query: 840 RAGVVGV 860
            +GV+ V
Sbjct: 259 YSGVIDV 265



>gb:AB062964_1868955 Macaca fascicularis brain cDNA
           clone:QmoA-10283, full insert sequence.
          Length = 303

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 39/118 (33%), Positives = 55/118 (46%), Gaps = 4/118 (3%)
 Frame = +3

Query: 492 PLDVIKTRFQVH-GL---PKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PLD++K RF V  GL   PK          I+  L  I++ +GLRG+Y+G++P V     
Sbjct: 42  PLDLVKIRFAVSDGLELRPKYNG-------ILHCLTTIWKLDGLRGLYQGVTPNVWGAGL 94

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
           +W +YF  Y  +KS+  ++     L                    NPLWV KTRL  Q
Sbjct: 95  SWGLYFFFYNAIKSYK-TEGRAERLEATEYLVSAAEAGAMTLCITNPLWVTKTRLMLQ 151



 Score = 33.5 bits (75), Expect = 8.5
 Identities = 21/69 (30%), Positives = 37/69 (53%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PL V KTR  +     + + + +   +  +L +I++ EG+RG+Y+G  P +     + A+
Sbjct: 140 PLWVTKTRLMLQYDAVINSPHRQYKGMFDTLVKIYKYEGVRGLYKGFVPGLFG-TSHGAL 198

Query: 672 YFTIYEQLK 698
            F  YE LK
Sbjct: 199 QFMAYELLK 207



>gb:AX453490_1468809 Sequence 51 from Patent
           WO0242455.>gb:BC048057_2550018 Danio rerio zgc:55610,
           mRNA (cDNA clone MGC:55610 IMAGE:2644093), complete cds.
          Length = 324

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 36/114 (31%), Positives = 56/114 (49%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD+IK RF V    K+      G L    ++ I++ EG+RG+Y+G++P +     +W +
Sbjct: 56  PLDLIKIRFAVSDGLKM-RPQYDGML--DCMKTIWKLEGIRGLYQGVTPNIWGAGSSWGL 112

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
           YF  Y  +K++   +  + ELS                   NP+WV KTRL  Q
Sbjct: 113 YFLFYNAIKAY-TQEGRQTELSACEHLVSAAEAGILTLCLTNPVWVTKTRLVLQ 165



 Score = 35.4 bits (80), Expect = 2.2
 Identities = 18/75 (24%), Positives = 36/75 (48%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P  V++ R Q        + N  G  IV  + + +  EG+ G Y+G+ P ++ ++P   +
Sbjct: 256 PYQVVRARLQDQ------HNNYSG--IVDVMRRTWSNEGVEGFYKGMVPNLVRVIPACCI 307

Query: 672 YFTIYEQLKSFLCSD 716
            F ++E +   L  +
Sbjct: 308 TFLVFENVSRLLLGE 322



>sp|Q95J75|MFTC_MACFA Mitochondrial folate
           transporter/carrier.>gb:AB060884_1868739 Macaca
           fascicularis brain cDNA clone:QtrA-13024, full insert
           sequence.>gb:AB062992_1868966 Macaca fascicularis brain
           cDNA clone:QmoA-10785, full insert sequence.
          Length = 315

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 39/118 (33%), Positives = 55/118 (46%), Gaps = 4/118 (3%)
 Frame = +3

Query: 492 PLDVIKTRFQVH-GL---PKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PLD++K RF V  GL   PK          I+  L  I++ +GLRG+Y+G++P V     
Sbjct: 42  PLDLVKIRFAVSDGLELRPKYNG-------ILHCLTTIWKLDGLRGLYQGVTPNVWGAGL 94

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
           +W +YF  Y  +KS+  ++     L                    NPLWV KTRL  Q
Sbjct: 95  SWGLYFFFYNAIKSYK-TEGRAERLEATEYLVSAAEAGAMTLCITNPLWVTKTRLMLQ 151



 Score = 39.3 bits (90), Expect = 0.15
 Identities = 18/80 (22%), Positives = 42/80 (52%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P  V++ R Q        + ++  S ++  + + +++EG+ G Y+G++P ++ + P   +
Sbjct: 244 PYQVVRARLQ--------DQHMFYSGVIDVITKTWRKEGIGGFYKGIAPNLIRVTPACCI 295

Query: 672 YFTIYEQLKSFLCSDDERHE 731
            F +YE +  FL    E+ +
Sbjct: 296 TFVVYENVSHFLLDLREKRK 315



 Score = 37.7 bits (86), Expect = 0.45
 Identities = 35/127 (27%), Positives = 55/127 (43%), Gaps = 4/127 (3%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PL V KTR  +     + + + +   +  +L +I++ EG+RG+Y+G  P +     + A+
Sbjct: 140 PLWVTKTRLMLQYDAVINSPHRQYKGMFDTLVKIYKYEGVRGLYKGFVPGLFG-TSHGAL 198

Query: 672 YFTIYEQLKSFLCSDDER---HELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGM- 839
            F  YE LK        R    +LS                    P  VV+ RLQ Q M 
Sbjct: 199 QFMAYELLKLKYNQHINRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMF 258

Query: 840 RAGVVGV 860
            +GV+ V
Sbjct: 259 YSGVIDV 265



>gb:AY611603_2086858 Cricetulus griseus mitochondrial folate
           transporter (MFT) mRNA, complete cds; nuclear gene for
           mitochondrial product.
          Length = 316

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 37/114 (32%), Positives = 56/114 (49%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD++K RF V    ++     +G  I+  L  I++ EGLRG+Y+G++P V     +W +
Sbjct: 42  PLDLVKIRFAVSDGLEV-RPKYKG--ILHCLTTIWKVEGLRGLYQGVTPNVWGAGLSWGL 98

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
           YF  Y  +KS+  ++    +L                    NPLWV KTRL  Q
Sbjct: 99  YFFFYNAIKSYK-TEGRAEQLEPLEYLVSAAEAGAMTLCITNPLWVTKTRLMLQ 151



 Score = 41.6 bits (96), Expect = 0.031
 Identities = 18/78 (23%), Positives = 41/78 (52%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P  V++ R Q        + ++    ++  + + +++EG+ G Y+G++P ++ + P   +
Sbjct: 244 PYQVVRARLQ--------DQHVSYGGVMDVIVKTWRKEGIGGFYKGIAPNLIRVTPACCI 295

Query: 672 YFTIYEQLKSFLCSDDER 725
            F +YE +  FLC   E+
Sbjct: 296 TFVVYENVSHFLCGLREK 313



 Score = 35.8 bits (81), Expect = 1.7
 Identities = 36/126 (28%), Positives = 52/126 (41%), Gaps = 5/126 (3%)
 Frame = +3

Query: 492 PLDVIKTRF--QVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           PL V KTR   Q  G+        +G  +  +L +I++ EG+RG+Y+G  P +     + 
Sbjct: 140 PLWVTKTRLMLQYGGVVNPSQRQYKG--MFDALVKIYKYEGVRGLYKGFVPGLFG-TSHG 196

Query: 666 AVYFTIYEQLKSFLCSDDER---HELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
           A+ F  YE LK        R    +LS                    P  VV+ RLQ Q 
Sbjct: 197 ALQFMAYELLKLEYNKHINRLPEAQLSTPEYISVAALSKIFAVAATYPYQVVRARLQDQH 256

Query: 837 MRAGVV 854
           +  G V
Sbjct: 257 VSYGGV 262



>gb:CR382132_1665166 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 361

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 37/130 (28%), Positives = 61/130 (46%), Gaps = 15/130 (11%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQV-------------HGLPKLGNTNIRGSLI-VGS-LEQIFQREGLRG 617
           F CPLDV+KTR Q              +G PK    N     +  GS L+ I+++EG R 
Sbjct: 58  FTCPLDVVKTRLQADFYKTQLAEMRTAYGNPKGPFRNAWLHFVETGSILKNIYRQEGYRA 117

Query: 618 MYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXN 797
           +++GL P ++ ++P+ ++ F  Y   K F+  +    + +                   N
Sbjct: 118 LFKGLGPNLVGVIPSRSINFFTYGVGKEFIAKEFNDGKEASWVHLLAAANAGIVTSTCTN 177

Query: 798 PLWVVKTRLQ 827
           P+W++KTRLQ
Sbjct: 178 PIWLIKTRLQ 187



 Score = 35.8 bits (81), Expect = 1.7
 Identities = 21/82 (25%), Positives = 46/82 (56%), Gaps = 1/82 (1%)
 Frame = +3

Query: 492 PLDVIKTRFQVH-GLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA 668
           P+ +IKTR Q+    P+      + S     L Q+ + EG+RG+Y+GL+ + L    +  
Sbjct: 178 PIWLIKTRLQLDKASPETHLRQYKNSW--DCLRQVMRTEGIRGLYKGLTASYLGASES-T 234

Query: 669 VYFTIYEQLKSFLCSDDERHEL 734
           + + +YE++K  + + +++ ++
Sbjct: 235 LQWVLYEKMKQLIRNKEKQRQI 256



>gb:AX880684_1478377 Sequence 15589 from Patent
           EP1074617.>gb:AK027787_1911229 Homo sapiens cDNA
           FLJ14881 fis, clone PLACE1003420, weakly similar to
           PUTATIVE MITOCHONDRIAL CARRIER YIL006W.
          Length = 315

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 38/118 (32%), Positives = 55/118 (46%), Gaps = 4/118 (3%)
 Frame = +3

Query: 492 PLDVIKTRFQVH-GL---PKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PLD++K RF V  GL   PK          I+  L  I++ +GLRG+Y+G++P +     
Sbjct: 42  PLDLVKIRFAVSDGLELRPKYNG-------ILHCLTTIWKLDGLRGLYQGVTPNIWGAGL 94

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
           +W +YF  Y  +KS+  ++     L                    NPLWV KTRL  Q
Sbjct: 95  SWGLYFFFYNAIKSYK-TEGRAERLEATEYLVSAAEAGAMTLCITNPLWVTKTRLMLQ 151



 Score = 37.4 bits (85), Expect = 0.59
 Identities = 35/127 (27%), Positives = 55/127 (43%), Gaps = 4/127 (3%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PL V KTR  +     + + + +   +  +L +I++ EG+RG+Y+G  P +     + A+
Sbjct: 140 PLWVTKTRLMLQYDAVVNSPHRQYKGMFDTLVKIYKYEGVRGLYKGFVPGLFG-TSHGAL 198

Query: 672 YFTIYEQLKSFLCSDDER---HELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGM- 839
            F  YE LK        R    +LS                    P  VV+ RLQ Q M 
Sbjct: 199 QFMAYELLKLKYNQHINRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMF 258

Query: 840 RAGVVGV 860
            +GV+ V
Sbjct: 259 YSGVIDV 265



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 17/80 (21%), Positives = 41/80 (51%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P  V++ R Q        + ++  S ++  + + +++EG+ G Y+G++P ++ + P   +
Sbjct: 244 PYQVVRARLQ--------DQHMFYSGVIDVITKTWRKEGVGGFYKGIAPNLIRVTPACCI 295

Query: 672 YFTIYEQLKSFLCSDDERHE 731
            F +YE +   L    E+ +
Sbjct: 296 TFVVYENVSHLLLDLREKRK 315



>gb:AX453448_1468806 Sequence 9 from Patent WO0242455.
          Length = 315

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 38/118 (32%), Positives = 55/118 (46%), Gaps = 4/118 (3%)
 Frame = +3

Query: 492 PLDVIKTRFQVH-GL---PKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PLD++K RF V  GL   PK          I+  L  I++ +GLRG+Y+G++P +     
Sbjct: 42  PLDLVKIRFAVSDGLELRPKYNG-------ILHCLTTIWKLDGLRGLYQGVTPNIWGAGL 94

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
           +W +YF  Y  +KS+  ++     L                    NPLWV KTRL  Q
Sbjct: 95  SWGLYFFFYNAIKSYK-TEGRAERLEATEYLVSAAEAGAMTLCITNPLWVTKTRLMLQ 151



 Score = 38.9 bits (89), Expect = 0.20
 Identities = 18/80 (22%), Positives = 42/80 (52%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P  V++ R Q        + ++  S ++  + + +++EG+ G Y+G++P ++ + P   +
Sbjct: 244 PYQVVRARLQ--------DQHMFYSGVIDVITKTWRKEGVGGFYKGIAPNLIRVTPACCI 295

Query: 672 YFTIYEQLKSFLCSDDERHE 731
            F +YE +  FL    E+ +
Sbjct: 296 TFVVYENVSHFLLDLREKRK 315



 Score = 37.4 bits (85), Expect = 0.59
 Identities = 35/127 (27%), Positives = 55/127 (43%), Gaps = 4/127 (3%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PL V KTR  +     + + + +   +  +L +I++ EG+RG+Y+G  P +     + A+
Sbjct: 140 PLWVTKTRLMLQYDAVVNSPHPQYKGMFDTLVKIYKYEGVRGLYKGFVPGLFG-TSHGAL 198

Query: 672 YFTIYEQLKSFLCSDDER---HELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGM- 839
            F  YE LK        R    +LS                    P  VV+ RLQ Q M 
Sbjct: 199 QFMAYELLKLKYNQHINRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMF 258

Query: 840 RAGVVGV 860
            +GV+ V
Sbjct: 259 YSGVIDV 265



>sp|Q9H2D1|MFTC_HUMAN Mitochondrial folate
           transporter/carrier.>gb:AX879781_1477982 Sequence 14686
           from Patent EP1074617.>gb:AK027531_1911041 Homo sapiens
           cDNA FLJ14625 fis, clone NT2RP2000257, weakly similar to
           PUTATIVE MITOCHONDRIAL CARRIER
           YIL006W.>gb:BC021893_1977593 Homo sapiens mitochondrial
           folate transporter/carrier, mRNA (cDNA clone MGC:21744
           IMAGE:4524907), complete cds.
          Length = 315

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 38/118 (32%), Positives = 55/118 (46%), Gaps = 4/118 (3%)
 Frame = +3

Query: 492 PLDVIKTRFQVH-GL---PKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PLD++K RF V  GL   PK          I+  L  I++ +GLRG+Y+G++P +     
Sbjct: 42  PLDLVKIRFAVSDGLELRPKYNG-------ILHCLTTIWKLDGLRGLYQGVTPNIWGAGL 94

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
           +W +YF  Y  +KS+  ++     L                    NPLWV KTRL  Q
Sbjct: 95  SWGLYFFFYNAIKSYK-TEGRAERLEATEYLVSAAEAGAMTLCITNPLWVTKTRLMLQ 151



 Score = 38.9 bits (89), Expect = 0.20
 Identities = 18/80 (22%), Positives = 42/80 (52%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P  V++ R Q        + ++  S ++  + + +++EG+ G Y+G++P ++ + P   +
Sbjct: 244 PYQVVRARLQ--------DQHMFYSGVIDVITKTWRKEGVGGFYKGIAPNLIRVTPACCI 295

Query: 672 YFTIYEQLKSFLCSDDERHE 731
            F +YE +  FL    E+ +
Sbjct: 296 TFVVYENVSHFLLDLREKRK 315



 Score = 37.4 bits (85), Expect = 0.59
 Identities = 35/127 (27%), Positives = 55/127 (43%), Gaps = 4/127 (3%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PL V KTR  +     + + + +   +  +L +I++ EG+RG+Y+G  P +     + A+
Sbjct: 140 PLWVTKTRLMLQYDAVVNSPHRQYKGMFDTLVKIYKYEGVRGLYKGFVPGLFG-TSHGAL 198

Query: 672 YFTIYEQLKSFLCSDDER---HELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGM- 839
            F  YE LK        R    +LS                    P  VV+ RLQ Q M 
Sbjct: 199 QFMAYELLKLKYNQHINRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMF 258

Query: 840 RAGVVGV 860
            +GV+ V
Sbjct: 259 YSGVIDV 265



>gb:AJ720037_2502224 Gallus gallus mRNA for hypothetical protein,
           clone 9m7.
          Length = 313

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 37/134 (27%), Positives = 60/134 (44%), Gaps = 14/134 (10%)
 Frame = +3

Query: 489 CPLDVIKTRFQVHG----LPKLGNTNIRGSLI----------VGSLEQIFQREGLRGMYR 626
           CPL+V+KTR Q       + ++    + G+ +          +  L+ I Q+EG R ++R
Sbjct: 25  CPLEVVKTRLQSSSVTLYISEVHLNTVNGASVNRVTRVSPGPLHCLKMILQKEGPRSLFR 84

Query: 627 GLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLW 806
           GL P ++ + P+ A+YF  Y   K  L  ++  +  S                   NP+W
Sbjct: 85  GLGPNLVGVAPSRAIYFAAYSNCKEKL--NNIFNPDSTQVHMISAGVAGFTAITMTNPIW 142

Query: 807 VVKTRLQTQGMRAG 848
           +VKTRLQ      G
Sbjct: 143 LVKTRLQLDARNRG 156



 Score = 38.1 bits (87), Expect = 0.34
 Identities = 32/135 (23%), Positives = 59/135 (43%), Gaps = 14/135 (10%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLE---QIFQREGLRGMYRGLSPTVLA 650
           T   P+ ++KTR Q+       +   RG   + + E   ++++ +G++G YRG+S +  A
Sbjct: 136 TMTNPIWLVKTRLQL-------DARNRGEKRMSAFECVRKVYRSDGIKGFYRGMSAS-YA 187

Query: 651 LLPNWAVYFTIYEQLK---------SFLCSDDE--RHELSIXXXXXXXXXXXXXXXXXXN 797
            +    ++F IYE +K         S + S+DE  +                        
Sbjct: 188 GISETVIHFVIYESIKRKLLEHKTASAMDSEDESAKEASDFVGMMMAAATSKTCATSIAY 247

Query: 798 PLWVVKTRLQTQGMR 842
           P  VV+TRL+ +G +
Sbjct: 248 PHEVVRTRLREEGTK 262



>gb:BC014064_1974369 Homo sapiens hypothetical protein FLJ10618,
           mRNA (cDNA clone MGC:19966 IMAGE:3842022), complete cds.
          Length = 311

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 37/133 (27%), Positives = 60/133 (45%), Gaps = 13/133 (9%)
 Frame = +3

Query: 489 CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGS-------------LEQIFQREGLRGMYRG 629
           CPL+V+KTR Q   +  L  + ++ + + G+             L+ I ++EG R ++RG
Sbjct: 25  CPLEVVKTRLQSSSVT-LYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKEGPRSLFRG 83

Query: 630 LSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWV 809
           L P ++ + P+ A+YF  Y   K  L  +D     S                   NP+W+
Sbjct: 84  LGPNLVGVAPSRAIYFAAYSNCKEKL--NDVFDPDSTQVHMISAAMAGFTAITATNPIWL 141

Query: 810 VKTRLQTQGMRAG 848
           +KTRLQ      G
Sbjct: 142 IKTRLQLDARNRG 154



 Score = 42.0 bits (97), Expect = 0.024
 Identities = 36/131 (27%), Positives = 58/131 (44%), Gaps = 14/131 (10%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLE---QIFQREGLRGMYRGLSPTVLALLPN 662
           P+ +IKTR Q+       +   RG   +G+ E   +++Q +GL+G YRG+S +  A +  
Sbjct: 138 PIWLIKTRLQL-------DARNRGERRMGAFECVRKVYQTDGLKGFYRGMSAS-YAGISE 189

Query: 663 WAVYFTIYEQLKSFL-----CSDDERHELSIXXXX------XXXXXXXXXXXXXXNPLWV 809
             ++F IYE +K  L      S  E  E S+                         P  V
Sbjct: 190 TVIHFVIYESIKQKLLEYKTASTMENDEESVKEASDFVGMMLAAATSKTCATTIAYPHEV 249

Query: 810 VKTRLQTQGMR 842
           V+TRL+ +G +
Sbjct: 250 VRTRLREEGTK 260



 Score = 34.3 bits (77), Expect = 5.0
 Identities = 21/70 (30%), Positives = 33/70 (47%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   P +V++TR +  G      T  R      +L  + Q EG   +YRGL+  ++  +P
Sbjct: 242 TIAYPHEVVRTRLREEG------TKYRS--FFQTLSLLVQEEGYGSLYRGLTTHLVRQIP 293

Query: 660 NWAVYFTIYE 689
           N A+    YE
Sbjct: 294 NTAIMMATYE 303



>gb:AB060253_1868687 Macaca fascicularis brain cDNA
           clone:QtrA-11259, full insert sequence.
          Length = 315

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 39/118 (33%), Positives = 54/118 (45%), Gaps = 4/118 (3%)
 Frame = +3

Query: 492 PLDVIKTRFQVH-GL---PKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PLD +K RF V  GL   PK          I+  L  I++ +GLRG+Y+G++P V     
Sbjct: 42  PLDPVKIRFAVSDGLELRPKYNG-------ILHCLTTIWKLDGLRGLYQGVTPNVWGAGL 94

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
           +W +YF  Y  +KS+  ++     L                    NPLWV KTRL  Q
Sbjct: 95  SWGLYFFFYNAIKSYK-TEGRAERLEATEYLVSAAEAGAMTLCITNPLWVTKTRLMLQ 151



 Score = 39.3 bits (90), Expect = 0.15
 Identities = 18/80 (22%), Positives = 42/80 (52%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P  V++ R Q        + ++  S ++  + + +++EG+ G Y+G++P ++ + P   +
Sbjct: 244 PYQVVRARLQ--------DQHMFYSGVIDVITKTWRKEGIGGFYKGIAPNLIRVTPACCI 295

Query: 672 YFTIYEQLKSFLCSDDERHE 731
            F +YE +  FL    E+ +
Sbjct: 296 TFVVYENVSHFLLDLREKRK 315



 Score = 37.4 bits (85), Expect = 0.59
 Identities = 35/127 (27%), Positives = 54/127 (42%), Gaps = 4/127 (3%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PL V KTR  +     + + + +   +  +L +I++ EG+RG+Y+G  P +       A+
Sbjct: 140 PLWVTKTRLMLQYDAVINSPHRQYKGMFDTLVKIYKYEGVRGLYKGFVPGLFG-TSRGAL 198

Query: 672 YFTIYEQLKSFLCSDDER---HELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGM- 839
            F  YE LK        R    +LS                    P  VV+ RLQ Q M 
Sbjct: 199 QFMAYELLKLKYNQHINRLPEAQLSTVEYISVAALSKIFAVAATYPYQVVRARLQDQHMF 258

Query: 840 RAGVVGV 860
            +GV+ V
Sbjct: 259 YSGVIDV 265



>gb:AX876835_1476714 Sequence 11740 from Patent
           EP1074617.>gb:AK001480_1908461 Homo sapiens cDNA
           FLJ10618 fis, clone NT2RP2005465, weakly similar to
           MITOCHONDRIAL CARRIER PROTEIN RIM2.
          Length = 310

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 37/133 (27%), Positives = 60/133 (45%), Gaps = 13/133 (9%)
 Frame = +3

Query: 489 CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGS-------------LEQIFQREGLRGMYRG 629
           CPL+V+KTR Q   +  L  + ++ + + G+             L+ I ++EG R ++RG
Sbjct: 25  CPLEVVKTRLQSSSVT-LYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKEGPRSLFRG 83

Query: 630 LSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWV 809
           L P ++ + P+ A+YF  Y   K  L  +D     S                   NP+W+
Sbjct: 84  LGPNLVGVAPSRAIYFAAYSNCKEKL--NDVFDPDSTQVHMISAAMAGFTAITATNPIWL 141

Query: 810 VKTRLQTQGMRAG 848
           +KTRLQ      G
Sbjct: 142 IKTRLQLDARNRG 154



 Score = 40.0 bits (92), Expect = 0.090
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 3/75 (4%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLE---QIFQREGLRGMYRGLSPTVLALLPN 662
           P+ +IKTR Q+       +   RG   +G+ E   +++Q +GL+G YRG+S +  A +  
Sbjct: 138 PIWLIKTRLQL-------DARNRGERRMGAFECVRKVYQTDGLKGFYRGMSAS-YAGISE 189

Query: 663 WAVYFTIYEQLKSFL 707
             ++F IYE +K  L
Sbjct: 190 TVIHFVIYESIKQKL 204



>gb:BC031874_2097283 Mus musculus mitochondrial folate
           transporter/carrier, mRNA (cDNA clone MGC:30372
           IMAGE:5149984), complete cds.
          Length = 316

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 36/114 (31%), Positives = 56/114 (49%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD++K RF V    ++     +G  I+  L  I++ +GLRG+Y+G++P V     +W +
Sbjct: 42  PLDLVKIRFAVSDGLEV-RPKYKG--ILHCLATIWKVDGLRGLYQGVTPNVWGAGLSWGL 98

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
           YF  Y  +KS+  ++    +L                    NPLWV KTRL  Q
Sbjct: 99  YFFFYNAIKSYK-TEGRAEQLEPLEYLVSAAEAGAMTLCITNPLWVTKTRLMLQ 151



 Score = 37.4 bits (85), Expect = 0.59
 Identities = 17/72 (23%), Positives = 37/72 (51%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P  V++ R Q   +   G T++        + + +++EG+ G Y+G++P ++ + P   +
Sbjct: 244 PYQVVRARLQDQHVSYGGVTDV--------ITKTWRKEGIGGFYKGIAPNLIRVTPACCI 295

Query: 672 YFTIYEQLKSFL 707
            F +YE +   L
Sbjct: 296 TFVVYENVSHLL 307



 Score = 37.0 bits (84), Expect = 0.77
 Identities = 36/126 (28%), Positives = 52/126 (41%), Gaps = 5/126 (3%)
 Frame = +3

Query: 492 PLDVIKTRF--QVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           PL V KTR   Q  G+        +G  +  +L +I++ EG+RG+Y+G  P +     + 
Sbjct: 140 PLWVTKTRLMLQYGGVASPSQRQYKG--MFDALVKIYKYEGVRGLYKGFVPGLFG-TSHG 196

Query: 666 AVYFTIYEQLKSFLCSDDER---HELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
           A+ F  YE LK        R    +LS                    P  VV+ RLQ Q 
Sbjct: 197 ALQFMAYELLKLKYNKHINRLPEAQLSTAEYISVAALSKIFAVAATYPYQVVRARLQDQH 256

Query: 837 MRAGVV 854
           +  G V
Sbjct: 257 VSYGGV 262



>gb:AX453452_1468808 Sequence 13 from Patent WO0242455.
          Length = 316

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 36/114 (31%), Positives = 56/114 (49%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD++K RF V    ++     +G  I+  L  I++ +GLRG+Y+G++P V     +W +
Sbjct: 42  PLDLVKIRFAVSDGLEV-RPKYKG--ILHCLATIWKVDGLRGLYQGVTPNVWGAGLSWGL 98

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
           YF  Y  +KS+  ++    +L                    NPLWV KTRL  Q
Sbjct: 99  YFFFYNAIKSYK-TEGRAEQLEPLEYLVSAAEAGAMTLCITNPLWVTKTRLMLQ 151



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 18/72 (25%), Positives = 38/72 (52%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P  V++ R Q   +   G T++        + + +++EG+ G Y+G++P ++ + P   +
Sbjct: 244 PYQVVRARLQDQHVSYGGVTDV--------ITKTWRKEGIGGFYKGIAPNLIRVTPACCI 295

Query: 672 YFTIYEQLKSFL 707
            F +YE +  FL
Sbjct: 296 TFVVYENVSHFL 307



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 36/126 (28%), Positives = 51/126 (40%), Gaps = 5/126 (3%)
 Frame = +3

Query: 492 PLDVIKTRF--QVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           PL V KTR   Q  G+        +G  +  +L  I++ EG+RG+Y+G  P +     + 
Sbjct: 140 PLWVTKTRLMLQYGGVASPSQRQYKG--MFDALVNIYKYEGVRGLYKGFVPGLFG-TSHG 196

Query: 666 AVYFTIYEQLKSFLCSDDER---HELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
           A+ F  YE LK        R    +LS                    P  VV+ RLQ Q 
Sbjct: 197 ALQFMAYELLKLKYNKHINRLPEAQLSTAEYISVAALSKIFAVAATYPYQVVRARLQDQH 256

Query: 837 MRAGVV 854
           +  G V
Sbjct: 257 VSYGGV 262



>gb:AX453450_1468807 Sequence 11 from Patent WO0242455.
          Length = 316

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 36/114 (31%), Positives = 56/114 (49%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD++K RF V    ++     +G  I+  L  I++ +GLRG+Y+G++P V     +W +
Sbjct: 42  PLDLVKIRFAVSDGLEV-RPKYKG--ILHCLATIWKVDGLRGLYQGVTPNVWGAGLSWGL 98

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
           YF  Y  +KS+  ++    +L                    NPLWV KTRL  Q
Sbjct: 99  YFFFYNAIKSYK-TEGRAEQLEPLEYLVSAAEAGAMTLCITNPLWVTKTRLMLQ 151



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 18/72 (25%), Positives = 38/72 (52%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P  V++ R Q   +   G T++        + + +++EG+ G Y+G++P ++ + P   +
Sbjct: 244 PYQVVRARLQDQHVSYGGVTDV--------ITKTWRKEGIGGFYKGIAPNLIRVTPACCI 295

Query: 672 YFTIYEQLKSFL 707
            F +YE +  FL
Sbjct: 296 TFVVYENVSHFL 307



 Score = 37.0 bits (84), Expect = 0.77
 Identities = 36/126 (28%), Positives = 52/126 (41%), Gaps = 5/126 (3%)
 Frame = +3

Query: 492 PLDVIKTRF--QVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           PL V KTR   Q  G+        +G  +  +L +I++ EG+RG+Y+G  P +     + 
Sbjct: 140 PLWVTKTRLMLQYGGVASPSQRQYKG--MFDALVKIYKYEGVRGLYKGFVPGLFG-TSHG 196

Query: 666 AVYFTIYEQLKSFLCSDDER---HELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
           A+ F  YE LK        R    +LS                    P  VV+ RLQ Q 
Sbjct: 197 ALQFMAYELLKLKYNKHINRLPEAQLSTAEYISVAALSKIFAVAATYPYQVVRARLQDQH 256

Query: 837 MRAGVV 854
           +  G V
Sbjct: 257 VSYGGV 262



>sp|Q8BMG8|MFTC_MOUSE Mitochondrial folate
           transporter/carrier.>gb:AK031187_1162338 Mus musculus 13
           days embryo forelimb cDNA, RIKEN full-length enriched
           library, clone:5930424M21 product:FOLATE
           TRANSPORTER/CARRIER homolog [Homo sapiens], full insert
           sequence.
          Length = 316

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 36/114 (31%), Positives = 56/114 (49%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD++K RF V    ++     +G  I+  L  I++ +GLRG+Y+G++P V     +W +
Sbjct: 42  PLDLVKIRFAVSDGLEV-RPKYKG--ILHCLATIWKVDGLRGLYQGVTPNVWGAGLSWGL 98

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
           YF  Y  +KS+  ++    +L                    NPLWV KTRL  Q
Sbjct: 99  YFFFYNAIKSYK-TEGRAEQLEPLEYLVSAAEAGAMTLCITNPLWVTKTRLMLQ 151



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 18/72 (25%), Positives = 38/72 (52%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P  V++ R Q   +   G T++        + + +++EG+ G Y+G++P ++ + P   +
Sbjct: 244 PYQVVRARLQDQHVSYGGVTDV--------ITKTWRKEGIGGFYKGIAPNLIRVTPACCI 295

Query: 672 YFTIYEQLKSFL 707
            F +YE +  FL
Sbjct: 296 TFVVYENVSHFL 307



 Score = 37.0 bits (84), Expect = 0.77
 Identities = 36/126 (28%), Positives = 52/126 (41%), Gaps = 5/126 (3%)
 Frame = +3

Query: 492 PLDVIKTRF--QVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           PL V KTR   Q  G+        +G  +  +L +I++ EG+RG+Y+G  P +     + 
Sbjct: 140 PLWVTKTRLMLQYGGVASPSQRQYKG--MFDALVKIYKYEGVRGLYKGFVPGLFG-TSHG 196

Query: 666 AVYFTIYEQLKSFLCSDDER---HELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
           A+ F  YE LK        R    +LS                    P  VV+ RLQ Q 
Sbjct: 197 ALQFMAYELLKLKYNKHINRLPEAQLSTAEYISVAALSKIFAVAATYPYQVVRARLQDQH 256

Query: 837 MRAGVV 854
           +  G V
Sbjct: 257 VSYGGV 262



>gb:AF495714_1905238 Homo sapiens mitochondrial carrier protein
           mRNA, complete cds; nuclear gene for mitochondrial
           product.>gb:AL928921_1933238 Human DNA sequence from
           clone RP13-392I16 on chromosome 1, complete
           sequence.>gb:AL954705_1933483 Human DNA sequence from
           clone RP13-15M17 on chromosome 1, complete
           sequence.>gb:BC004991_1969504 Homo sapiens mitochondrial
           carrier protein, mRNA (cDNA clone MGC:4399
           IMAGE:2905957), complete cds.>gb:BC073135_1989035 Homo
           sapiens mitochondrial carrier protein, mRNA (cDNA clone
           MGC:87888 IMAGE:6172562), complete cds.
          Length = 321

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 41/139 (29%), Positives = 64/139 (46%), Gaps = 22/139 (15%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGL-------PKLGNTNIRGSLIVGS----------LEQIFQREGL 611
           F CPL+VIKTR Q   L       P++    I G+ +V            L+ I ++EG 
Sbjct: 28  FTCPLEVIKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSVTPGLFQVLKSILEKEGP 87

Query: 612 RGMYRGLSPTVLALLPNWAVYFTIYEQLKS-----FLCSDDERHELSIXXXXXXXXXXXX 776
           + ++RGL P ++ + P+ AVYF  Y + K      F+ + +  H  S             
Sbjct: 88  KSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFNGIFVPNSNIVHIFS-------AGSAAF 140

Query: 777 XXXXXXNPLWVVKTRLQTQ 833
                 NP+W+VKTR+Q +
Sbjct: 141 ITNSLMNPIWMVKTRMQLE 159



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 34/128 (26%), Positives = 58/128 (45%), Gaps = 11/128 (8%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLE---QIFQREGLRGMYRGLSPTVLALLPN 662
           P+ ++KTR Q+          +RGS  + +L+    ++Q EG+RG YRGL+ +  A +  
Sbjct: 148 PIWMVKTRMQLE-------QKVRGSKQMNTLQCARYVYQTEGIRGFYRGLTAS-YAGISE 199

Query: 663 WAVYFTIYEQLKSFL--------CSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKT 818
             + F IYE LK +L         +  E++  S                    P  V++T
Sbjct: 200 TIICFAIYESLKKYLKEAPLASSANGTEKNSTSFFGLMAAAALSKGCASCIAYPHEVIRT 259

Query: 819 RLQTQGMR 842
           RL+ +G +
Sbjct: 260 RLREEGTK 267



 Score = 33.5 bits (75), Expect = 8.5
 Identities = 19/66 (28%), Positives = 31/66 (46%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P +VI+TR +  G         +    V +   +F+ EG    YRGL   ++  +PN A+
Sbjct: 253 PHEVIRTRLREEGT--------KYKSFVQTARLVFREEGYLAFYRGLFAQLIRQIPNTAI 304

Query: 672 YFTIYE 689
             + YE
Sbjct: 305 VLSTYE 310



>gb:AB017061_1513317 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K19E20.>gb:BT006239_1639131 Arabidopsis
           thaliana At5g48970 mRNA, complete
           cds.>gb:AK117372_1815411 Arabidopsis thaliana At5g48970
           mRNA for putative mitochondrial carrier protein,
           complete cds, clone: RAFL16-94-F04.
          Length = 339

 Score = 57.8 bits (138), Expect = 4e-07
 Identities = 43/157 (27%), Positives = 65/157 (41%), Gaps = 11/157 (7%)
 Frame = +3

Query: 399 TADAHGPSPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSL--- 569
           T D      K  L +            +   PLDVIK RFQV   P      +RG+L   
Sbjct: 7   TVDDEPGQIKRALIDASAGAISGGVSRSVTSPLDVIKIRFQVQLEPTTSWGLVRGNLSGA 66

Query: 570 -----IVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD---DER 725
                +V + + IF+ EG RG +RG  P +L ++P  ++ FT+  +LKSF       ++ 
Sbjct: 67  SKYTGMVQATKDIFREEGFRGFWRGNVPALLMVMPYTSIQFTVLHKLKSFASGSTKTEDH 126

Query: 726 HELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
             LS                    P  +++T L +QG
Sbjct: 127 IHLSPYLSFVSGALAGCAATLGSYPFDLLRTILASQG 163



 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 31/80 (38%), Positives = 43/80 (53%), Gaps = 6/80 (7%)
 Frame = +3

Query: 486 VC-PLDVIKTRFQVHGL---PKLGNTNIRGSL--IVGSLEQIFQREGLRGMYRGLSPTVL 647
           VC PLDV+K RFQ+ GL   P+ G    R +   ++  L QI   EG  G+Y+G+ P+ +
Sbjct: 255 VCHPLDVVKKRFQIEGLQRHPRYGARVERRAYRNMLDGLRQIMISEGWHGLYKGIVPSTV 314

Query: 648 ALLPNWAVYFTIYEQLKSFL 707
              P  AV F  YE    +L
Sbjct: 315 KAAPAGAVTFVAYEFTSDWL 334



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 26/82 (31%), Positives = 46/82 (56%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P D+++T     G PK+  T +R + +      I Q  G+RG+Y GL+PT++ ++P   +
Sbjct: 151 PFDLLRTILASQGEPKVYPT-MRSAFV-----DIIQSRGIRGLYNGLTPTLVEIVPYAGL 204

Query: 672 YFTIYEQLKSFLCSDDERHELS 737
            F  Y+  K ++  D  R++LS
Sbjct: 205 QFGTYDMFKRWM-MDWNRYKLS 225



>gb:BC076521_2559349 Danio rerio zgc:92447, mRNA (cDNA clone
           MGC:92447 IMAGE:7041398), complete cds.
          Length = 311

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 38/137 (27%), Positives = 64/137 (46%), Gaps = 17/137 (12%)
 Frame = +3

Query: 489 CPLDVIKTRFQVHG----LPKLGNTNIRGSLI--------VGSLEQIFQREGLRGMYRGL 632
           CPL+V+KTR Q       + ++  + + G+ +        +  L+ I ++EG R ++RGL
Sbjct: 25  CPLEVVKTRLQSSSVTFYISEVQLSTVNGASVARMAPPGPLHCLKLILEKEGPRSLFRGL 84

Query: 633 SPTVLALLPNWAVYFTIY----EQLKSFLCSDDER-HELSIXXXXXXXXXXXXXXXXXXN 797
            P ++ + P+ A+YF  Y    E+L +    D  + H LS                   N
Sbjct: 85  GPNLVGVAPSRAIYFAAYSTSKEKLNNVFDPDSTQVHMLS-------AGLAGFTAITATN 137

Query: 798 PLWVVKTRLQTQGMRAG 848
           P+W++KTRLQ      G
Sbjct: 138 PIWLIKTRLQLDARNRG 154



 Score = 40.4 bits (93), Expect = 0.069
 Identities = 33/128 (25%), Positives = 53/128 (41%), Gaps = 11/128 (8%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+ +IKTR Q+       N   R       + +++Q +GLRG YRG+S +  A +    +
Sbjct: 138 PIWLIKTRLQLDAR----NRGERRMSAFECVRRVYQSDGLRGFYRGMSAS-YAGISETVI 192

Query: 672 YFTIYEQLKSFLCS-------DDERHEL----SIXXXXXXXXXXXXXXXXXXNPLWVVKT 818
           +F IYE +K  L         DDE   +                         P  V++T
Sbjct: 193 HFVIYESIKRKLIEHKANSNMDDEDESVKDASDFVGMMLAAATSKTCATSIAYPHEVIRT 252

Query: 819 RLQTQGMR 842
           RL+ +G +
Sbjct: 253 RLREEGSK 260



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 20/66 (30%), Positives = 33/66 (50%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P +VI+TR +  G         +      +L  +F+ EG R +YRGL+  ++  +PN A+
Sbjct: 246 PHEVIRTRLREEGS--------KYRSFFQTLNMVFREEGYRALYRGLTTHLVRQIPNTAI 297

Query: 672 YFTIYE 689
               YE
Sbjct: 298 MMCTYE 303



>pir|S44092|S44092 probable carrier protein c2 - Caenorhabditis
           elegans>gb:CECAPO_1361656 C.elegans mRNA for unknown
           ORF, 1921bp.>gb:CET09F3_1367531 Caenorhabditis elegans
           cosmid T09F3, complete sequence.
          Length = 384

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 28/98 (28%), Positives = 46/98 (46%)
 Frame = +3

Query: 558 RGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELS 737
           RG++++  + Q+ + EG+  +Y+GL P ++ + P+ AVYF  Y   K F    +     S
Sbjct: 144 RGTIVIKYITQVIKTEGIGALYKGLIPNLVGVAPSKAVYFYTYSTSKRFWNESEVLIPNS 203

Query: 738 IXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMRAGV 851
                              NP+W+VKTRLQ      G+
Sbjct: 204 AIVHMVSAGSAGFVAASAVNPIWLVKTRLQLHQGHIGI 241



 Score = 39.3 bits (90), Expect = 0.15
 Identities = 35/158 (22%), Positives = 66/158 (41%), Gaps = 5/158 (3%)
 Frame = +3

Query: 423 PKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSL-IVGSLEQIFQ 599
           P   + +            + V P+ ++KTR Q+H          +G + I   +++++ 
Sbjct: 201 PNSAIVHMVSAGSAGFVAASAVNPIWLVKTRLQLH----------QGHIGIWQMIKRVYH 250

Query: 600 REGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDD---ERHELSIXXXXXXXXXX 770
           REG +G Y+G++ +  A +    + F IYE  +  L SD    ++ ++            
Sbjct: 251 REGFKGFYKGVTAS-YAGVSETMIQFCIYEYFRGVLLSDANEMDKRKMDFLNFMVAGGSA 309

Query: 771 XXXXXXXXNPLWVVKTRLQTQ-GMRAGVVGVHYRL*EE 881
                    P  VV+TRL+ + G   G     Y+L +E
Sbjct: 310 KFIACVVAYPHEVVRTRLREETGKSRGFFKTLYQLYKE 347



>gb:AK053646_1170509 Mus musculus 0 day neonate eyeball cDNA, RIKEN
           full-length enriched library, clone:E130118D21
           product:hypothetical Mitochondrial energy transfer
           proteins (carrier protein) containing protein, full
           insert sequence.>gb:AK078779_1172442 Mus musculus 15
           days embryo male testis cDNA, RIKEN full-length enriched
           library, clone:8030476B22 product:hypothetical
           Mitochondrial energy transfer proteins (carrier protein)
           containing protein, full insert
           sequence.>gb:BC008171_2090655 Mus musculus RIKEN cDNA
           C330005L02 gene, mRNA (cDNA clone MGC:12130
           IMAGE:3710468), complete cds.
          Length = 311

 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 35/133 (26%), Positives = 59/133 (44%), Gaps = 13/133 (9%)
 Frame = +3

Query: 489 CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGS-------------LEQIFQREGLRGMYRG 629
           CPL+V+KTR Q   +  L  + ++ + + G+             L+ I ++EG R ++RG
Sbjct: 25  CPLEVVKTRLQSSSVT-LYISEVQLNTMAGASVNRVVSPGPLHCLKAILEKEGPRSLFRG 83

Query: 630 LSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWV 809
           L P ++ + P+ A+YF  Y   K  L    +     +                  NP+W+
Sbjct: 84  LGPNLVGVAPSRAIYFAAYSNCKEKLNGVFDPDSTQV--HMASAAMAGFTAITATNPIWL 141

Query: 810 VKTRLQTQGMRAG 848
           +KTRLQ      G
Sbjct: 142 IKTRLQLDARTRG 154



 Score = 43.5 bits (101), Expect = 0.008
 Identities = 35/131 (26%), Positives = 59/131 (45%), Gaps = 14/131 (10%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLE---QIFQREGLRGMYRGLSPTVLALLPN 662
           P+ +IKTR Q+       +   RG   +G+ E   +++Q +GLRG YRG+S +  A +  
Sbjct: 138 PIWLIKTRLQL-------DARTRGEKQMGAFECVRKVYQTDGLRGFYRGMSAS-YAGISE 189

Query: 663 WAVYFTIYEQLK---------SFLCSDDE--RHELSIXXXXXXXXXXXXXXXXXXNPLWV 809
             ++F IYE +K         S + +D+E  +                        P  V
Sbjct: 190 TVIHFVIYESIKQKLLECKTASMMETDEESVKEASDFVRMMLAAATSKTCATTIAYPHEV 249

Query: 810 VKTRLQTQGMR 842
           V+TRL+ +G +
Sbjct: 250 VRTRLREEGTK 260



 Score = 35.0 bits (79), Expect = 2.9
 Identities = 22/70 (31%), Positives = 33/70 (47%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   P +V++TR +  G      T  R      +L  I Q EG   +YRGL+  ++  +P
Sbjct: 242 TIAYPHEVVRTRLREEG------TKYRS--FFQTLSLIVQEEGYGSLYRGLTTHLVRQIP 293

Query: 660 NWAVYFTIYE 689
           N A+    YE
Sbjct: 294 NTAIMMATYE 303



>pir|S54495|S54495 probable carrier protein YPR021c - yeast
           (Saccharomyces cerevisiae)>gb:SC9367_1705853
           S.cerevisiae chromosome XVI cosmid
           9367.>gb:SCCHRXVI_1707094 S.cerevisiae chromosome XVI
           165536 bp sequence, cen rightwards.
          Length = 902

 Score = 56.6 bits (135), Expect = 9e-07
 Identities = 38/124 (30%), Positives = 59/124 (47%), Gaps = 1/124 (0%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVH-GLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALL 656
           T V P+D IKTR Q    L +  N+       +  L +I  REG++G+Y GL P ++ + 
Sbjct: 546 TVVYPIDFIKTRMQAQRSLAQYKNS-------IDCLLKIISREGIKGLYSGLGPQLIGVA 598

Query: 657 PNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
           P  A+  T+ + +++ L   D+  +LS+                  NPL +VK RLQ Q 
Sbjct: 599 PEKAIKLTVNDFMRNRL--TDKNGKLSLFPEIISGASAGACQVIFTNPLEIVKIRLQVQS 656

Query: 837 MRAG 848
              G
Sbjct: 657 DYVG 660



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 35/120 (29%), Positives = 53/120 (44%), Gaps = 5/120 (4%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           F  PL+++K R QV         NI+ +    +  QI ++ GLRG+Y G++  ++  +P 
Sbjct: 641 FTNPLEIVKIRLQVQS--DYVGENIQQANETAT--QIVKKLGLRGLYNGVAACLMRDVPF 696

Query: 663 WAVYFTIYEQLKSFLCSDD-----ERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
            A+YF  Y  LK  L   D     +R+ L                     P  V+KTRLQ
Sbjct: 697 SAIYFPTYAHLKKDLFDFDPNDKTKRNRLKTWELLTAGAIAGMPAAFLTTPFDVIKTRLQ 756



 Score = 43.5 bits (101), Expect = 0.008
 Identities = 26/78 (33%), Positives = 36/78 (46%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P DVIKTR Q+   P+ G T   G  I  ++  I + E  R  ++G    VL   P +  
Sbjct: 747 PFDVIKTRLQID--PRKGETKYNG--IFHAIRTILKEESFRSFFKGGGARVLRSSPQFGF 802

Query: 672 YFTIYEQLKSFLCSDDER 725
               YE  K F+ S D +
Sbjct: 803 TLAAYELFKGFIPSPDNK 820



>gb:AK176255_1818243 Arabidopsis thaliana mRNA for mitochondrial
           carrier like protein, complete cds, clone:
           RAFL23-16-A14.
          Length = 337

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 28/102 (27%), Positives = 49/102 (48%)
 Frame = +3

Query: 408 AHGPSPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLE 587
           +H P+   L+ +            T   PLD+++ R QV G    G   +  + + G+ +
Sbjct: 235 SHRPNDSDLVVSLVSGGLAGAVSSTATYPLDLVRRRMQVEGAG--GRARVYNTGLFGTFK 292

Query: 588 QIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCS 713
            IF+ EG +G+YRG+ P    ++P   + F  Y+ L+  L S
Sbjct: 293 HIFKSEGFKGIYRGILPEYYKVVPGVGIVFMTYDALRRLLTS 334



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 31/123 (25%), Positives = 53/123 (43%), Gaps = 4/123 (3%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQ----REGLRGMYRGLSPTVL 647
           T   PLD+++TR              R ++    +E  F+     EG+ G+Y+GL  T+L
Sbjct: 164 TATYPLDLVRTRLAAQ----------RNAIYYQGIEHTFRTICREEGILGLYKGLGATLL 213

Query: 648 ALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
            + P+ A+ F  YE +K F  S    ++  +                   PL +V+ R+Q
Sbjct: 214 GVGPSLAINFAAYESMKLFWHS-HRPNDSDLVVSLVSGGLAGAVSSTATYPLDLVRRRMQ 272

Query: 828 TQG 836
            +G
Sbjct: 273 VEG 275



>gb:CR380957_1652615 Candida glabrata strain CBS138 chromosome K
           complete sequence.
          Length = 919

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 35/120 (29%), Positives = 57/120 (47%), Gaps = 1/120 (0%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVH-GLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALL 656
           T V P+D +KTR Q    L +  N+       +    +I  REG+RG+Y GL P ++ + 
Sbjct: 559 TIVYPIDFVKTRMQAQRSLSQYKNS-------IDCFLKILSREGIRGVYSGLGPQLIGVA 611

Query: 657 PNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
           P  A+  T+ + +++ L   D+  +L +                  NPL +VK RLQ +G
Sbjct: 612 PEKAIKLTVNDYMRNKL--KDKNGKLGLLSEIISGASAGACQVIFTNPLEIVKIRLQVKG 669



 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 40/139 (28%), Positives = 57/139 (41%), Gaps = 6/139 (4%)
 Frame = +3

Query: 429  GLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNT-NIRGSLIVGSLEQIFQRE 605
            GLL               F  PL+++K R QV G     N  N + + +     QI +R 
Sbjct: 636  GLLSEIISGASAGACQVIFTNPLEIVKIRLQVKGEYVAENAENAKLTAL-----QIIKRL 690

Query: 606  GLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDD-----ERHELSIXXXXXXXXXX 770
            GL G+Y+G +  +L  +P  A+YF  Y  LK  L + D     +R  L+           
Sbjct: 691  GLPGLYKGAAACLLRDVPFSAIYFPTYAHLKRDLFNFDPNDKNKRSRLNTWELLSAGALA 750

Query: 771  XXXXXXXXNPLWVVKTRLQ 827
                     P  V+KTRLQ
Sbjct: 751  GMPAAYLTTPFDVIKTRLQ 769



 Score = 37.4 bits (85), Expect = 0.59
 Identities = 26/88 (29%), Positives = 40/88 (45%), Gaps = 10/88 (11%)
 Frame = +3

Query: 492  PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
            P DVIKTR Q+   PK G T  +G  I+ +   I + E  +  ++G +  VL   P +  
Sbjct: 760  PFDVIKTRLQID--PKKGETIYKG--IIHAARTILREESFKSFFKGGAARVLRSSPQFGF 815

Query: 672  YFTIYEQLKS----------FLCSDDER 725
                YE   +          F+ S+D+R
Sbjct: 816  TLAAYELFHNIFPLPNDKDKFVISEDDR 843



>gb:AY128317_1580616 Arabidopsis thaliana putative mitochondrial
           carrier protein (At2g37890) mRNA, complete
           cds.>gb:BT000042_1634320 Arabidopsis thaliana putative
           mitochondrial carrier protein (At2g37890) mRNA, complete
           cds.>gb:AK175138_1817126 Arabidopsis thaliana mRNA for
           mitochondrial carrier like protein, complete cds, clone:
           RAFL21-55-H10.>gb:AK175263_1817251 Arabidopsis thaliana
           mRNA for mitochondrial carrier like protein, complete
           cds, clone: RAFL21-69-M13.
          Length = 337

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 28/102 (27%), Positives = 49/102 (48%)
 Frame = +3

Query: 408 AHGPSPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLE 587
           +H P+   L+ +            T   PLD+++ R QV G    G   +  + + G+ +
Sbjct: 235 SHRPNDSDLVVSLVSGGLAGAVSSTATYPLDLVRRRMQVEGAG--GRARVYNTGLFGTFK 292

Query: 588 QIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCS 713
            IF+ EG +G+YRG+ P    ++P   + F  Y+ L+  L S
Sbjct: 293 HIFKSEGFKGIYRGILPEYYKVVPGVGIVFMTYDALRRLLTS 334



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 31/123 (25%), Positives = 53/123 (43%), Gaps = 4/123 (3%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQ----REGLRGMYRGLSPTVL 647
           T   PLD+++TR              R ++    +E  F+     EG+ G+Y+GL  T+L
Sbjct: 164 TATYPLDLVRTRLAAQ----------RNAIYYQGIEHTFRTICREEGILGLYKGLGATLL 213

Query: 648 ALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
            + P+ A+ F  YE +K F  S    ++  +                   PL +V+ R+Q
Sbjct: 214 GVGPSLAINFAAYESMKLFWHS-HRPNDSDLVVSLVSGGLAGAVSSTATYPLDLVRRRMQ 272

Query: 828 TQG 836
            +G
Sbjct: 273 VEG 275



>gb:AC116957_1206699 Dictyostelium discoideum chromosome 2 map
           1685067-2090751 strain AX4, complete sequence.
          Length = 436

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 28/76 (36%), Positives = 45/76 (59%), Gaps = 6/76 (7%)
 Frame = +3

Query: 489 CPLDVIKTRFQVHGLPKL---GNTNIRGSLIVGS---LEQIFQREGLRGMYRGLSPTVLA 650
           CP+D++K + Q+ G+P      N N   +   G+    + I++ +GL G Y+GLSPT+  
Sbjct: 257 CPVDLVKIQMQIQGIPSSQPNSNNNNNNNKAKGNSYFTKLIYREKGLLGFYQGLSPTLFR 316

Query: 651 LLPNWAVYFTIYEQLK 698
            +P  A++FT YE LK
Sbjct: 317 DVPGLAIFFTTYETLK 332



 Score = 38.9 bits (89), Expect(2) = 0.029
 Identities = 31/119 (26%), Positives = 54/119 (45%), Gaps = 3/119 (2%)
 Frame = +3

Query: 492 PLDVIKTRFQVH--GLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGL-SPTVLALLPN 662
           PLD+IKTR Q+   G+   G TN   + I+   + + + EG+ G+++GL SP +L+ L  
Sbjct: 157 PLDLIKTRIQLSQSGVSGGGGTN---TSIIKIFKDVIKTEGVIGLFKGLSSPLILSALVT 213

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGM 839
            A+ F ++E    +                               P+ +VK ++Q QG+
Sbjct: 214 -AIQFGLFEDTLKYFRKHQYFKNHDTLSLLFSGSIAGFAQSFITCPVDLVKIQMQIQGI 271



 Score = 21.9 bits (45), Expect(2) = 0.029
 Identities = 10/30 (33%), Positives = 17/30 (56%)
 Frame = +2

Query: 824 SDSRNESWCCRGTLSALRRIAREKGILGLF 913
           S++ N +   +G     + I REKG+LG +
Sbjct: 278 SNNNNNNNKAKGNSYFTKLIYREKGLLGFY 307



>sp|Q9BQT8|ODC_HUMAN Mitochondrial 2-oxodicarboxylate
           carrier.>gb:HSA278148_2002287 Homo sapiens partial mRNA
           for oxodicarboxylate carrier (ODC gene).
          Length = 299

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 32/72 (44%), Positives = 40/72 (55%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLDV+KTRFQ+       N+      +V S   IFQ EGL G Y+G+ P +LA  P  AV
Sbjct: 33  PLDVVKTRFQIQRCATDPNSY---KSLVDSFRMIFQMEGLFGFYKGILPPILAETPKRAV 89

Query: 672 YFTIYEQLKSFL 707
            F  +EQ K  L
Sbjct: 90  KFFTFEQYKKLL 101



 Score = 40.4 bits (93), Expect = 0.069
 Identities = 23/72 (31%), Positives = 37/72 (51%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P DV K+R Q    P+     I+      ++  ++Q EG+  +Y+GL P ++ L P  AV
Sbjct: 227 PFDVAKSRIQG---PQPVPGEIKYRTCFKTMATVYQEEGILALYKGLLPKIMRLGPGGAV 283

Query: 672 YFTIYEQLKSFL 707
              +YE   S+L
Sbjct: 284 MLLVYEYTYSWL 295



>gb:AK096294_1914563 Homo sapiens cDNA FLJ38975 fis, clone
           NT2RI2004093, weakly similar to MITOCHONDRIAL CARRIER
           PROTEIN YMC2 PRECURSOR.
          Length = 237

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 40/119 (33%), Positives = 57/119 (47%), Gaps = 1/119 (0%)
 Frame = +3

Query: 489 CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA 668
           CP+++ KTR Q+           +GSL    L QI+  EGLRG+ RG+  T+L   P++ 
Sbjct: 45  CPMELAKTRLQLQDAGPA--RTYKGSL--DCLAQIYGHEGLRGVNRGMVSTLLRETPSFG 100

Query: 669 VYFTIYEQLKSFL-CSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMR 842
           VYF  Y+ L   L C   +R  L +                   P+ VVK+RLQ  G+R
Sbjct: 101 VYFLTYDALTRALGCEPGDR--LLVPKLLLAGGTSGIVSWLSTYPVDVVKSRLQADGLR 157



>gb:CNSLT1I6H_1180536 human full-length cDNA clone CS0DF030YI18 of
           Fetal brain of Homo sapiens (human).
          Length = 400

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 40/119 (33%), Positives = 57/119 (47%), Gaps = 1/119 (0%)
 Frame = +3

Query: 489 CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA 668
           CP+++ KTR Q+           +GSL    L QI+  EGLRG+ RG+  T+L   P++ 
Sbjct: 208 CPMELAKTRLQLQDAGPA--RTYKGSL--DCLAQIYGHEGLRGVNRGMVSTLLRETPSFG 263

Query: 669 VYFTIYEQLKSFL-CSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMR 842
           VYF  Y+ L   L C   +R  L +                   P+ VVK+RLQ  G+R
Sbjct: 264 VYFLTYDALTRALGCEPGDR--LLVPKLLLAGGTSGIVSWLSTYPVDVVKSRLQADGLR 320



>sp|Q8N8R3|CACL_HUMAN Mitchondrial carnitine/acylcarnitine carrier
           protein CACL (CACT-like).>gb:AK172788_1918156 Homo
           sapiens cDNA FLJ23949 fis, clone HEP08438.
          Length = 303

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 40/119 (33%), Positives = 57/119 (47%), Gaps = 1/119 (0%)
 Frame = +3

Query: 489 CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA 668
           CP+++ KTR Q+           +GSL    L QI+  EGLRG+ RG+  T+L   P++ 
Sbjct: 111 CPMELAKTRLQLQDAGPA--RTYKGSL--DCLAQIYGHEGLRGVNRGMVSTLLRETPSFG 166

Query: 669 VYFTIYEQLKSFL-CSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMR 842
           VYF  Y+ L   L C   +R  L +                   P+ VVK+RLQ  G+R
Sbjct: 167 VYFLTYDALTRALGCEPGDR--LLVPKLLLAGGTSGIVSWLSTYPVDVVKSRLQADGLR 223



>gb:BC006711_2090331 Mus musculus solute carrier family 25
           (mitochondrial carrier, palmitoylcarnitine transporter),
           member 29, mRNA (cDNA clone MGC:7958 IMAGE:3584570),
           complete cds.
          Length = 306

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 37/119 (31%), Positives = 60/119 (50%), Gaps = 1/119 (0%)
 Frame = +3

Query: 489 CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA 668
           CP+++ KTR Q+  +        +GSL    L QI++ EGLRG+ RG+  T+L   P++ 
Sbjct: 111 CPMELAKTRLQLQAVGPA--RTYKGSL--DCLVQIYRHEGLRGINRGMVSTLLRETPSFG 166

Query: 669 VYFTIYEQL-KSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMR 842
           VYF  Y+ + ++  C   +R  L +                   P+ VVK+RLQ  G++
Sbjct: 167 VYFLTYDVMTRAMGCEPGDR--LLVPKLLLAGGTSGITSWLSTYPMDVVKSRLQADGLQ 223



>gb:AE017347_1758054 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 340

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 32/120 (26%), Positives = 54/120 (45%), Gaps = 9/120 (7%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIR--------GSLIVGSLEQIFQREGLRGMYRGLSPTVL 647
           PLD++K RFQ+       N+++         G+ +  +L+     +G +G+YRGL P ++
Sbjct: 36  PLDLVKVRFQLADSKPHPNSHLPLHKTKPRLGTGVYMALKDAVMIDGWKGLYRGLVPNLV 95

Query: 648 ALLPNWAVYFTI-YEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRL 824
               +W +YF   Y  +K  +   D  +  S                   NP+WVVKTR+
Sbjct: 96  GGASSWGLYFLFSYNMIKKQMQGGDPSYRTSSGQHLLAAAEASAITAMLTNPIWVVKTRV 155



 Score = 35.8 bits (81), Expect = 1.7
 Identities = 22/72 (30%), Positives = 31/72 (43%), Gaps = 4/72 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           P  VI+ R Q       +PKL         I   +  +++ EG   MY+GL    L +LP
Sbjct: 257 PYQVIRARIQNFTPTPAIPKL--------TIPSVVSSVWRNEGALAMYKGLGTNALRILP 308

Query: 660 NWAVYFTIYEQL 695
                F +YE L
Sbjct: 309 GTCTTFVVYENL 320



 Score = 35.8 bits (81), Expect = 1.7
 Identities = 26/71 (36%), Positives = 40/71 (56%), Gaps = 2/71 (2%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALL--PNW 665
           P+ V+KTR  V G  K      RG  +   L  I + EG+RG+Y+G   ++LAL+   N 
Sbjct: 147 PIWVVKTR--VFGTAKNDAVAYRG--LWDGLRSISRTEGIRGLYKG---SLLALIGVSNG 199

Query: 666 AVYFTIYEQLK 698
           ++ F  YE++K
Sbjct: 200 SIQFATYEEIK 210



>gb:CQ782989_1452248 Sequence 3129 from Patent
           EP1396543.>gb:CQ783742_1452607 Sequence 3882 from Patent
           EP1396543.>gb:AK074912_1912773 Homo sapiens cDNA
           FLJ90431 fis, clone NT2RP3000676, weakly similar to
           PUTATIVE MITOCHONDRIAL CARRIER
           YMR166C.>gb:AK075002_1912833 Homo sapiens cDNA FLJ90521
           fis, clone NT2RP3004647, weakly similar to PUTATIVE
           MITOCHONDRIAL CARRIER YMR166C.>gb:AL135927_1918795 Human
           DNA sequence from clone RP11-54H19 on chromosome 1
           Contains the 3' end of the LMNA gene for lamin A/C, the
           gene for a novel protein similar to semaphorins
           (FLJ12287), a novel gene (KIAA0446), the PMF1 gene for
           polyamine-modulated factor 1, the BGLAP gene for bone
           gamma-carboxyglutamate (gla) protein (osteocalcin), the
           gene for progestin and adipoQ receptor family member VI
           (PAQR6) and the 3' end of the gene for Est1p-like
           protein B (EST1B), complete
           sequence.>gb:BC008843_1971628 Homo sapiens KIAA0446 gene
           product, mRNA (cDNA clone MGC:14293 IMAGE:4136523),
           complete cds.>gb:BC039854_1982657 Homo sapiens KIAA0446
           gene product, mRNA (cDNA clone MGC:48922 IMAGE:6061399),
           complete cds.
          Length = 314

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 40/127 (31%), Positives = 60/127 (47%), Gaps = 4/127 (3%)
 Frame = +3

Query: 513 RFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIY-- 686
           RFQV G P+ G   +        + QI Q +GLRG YRG   ++L  +PN AV++  Y  
Sbjct: 148 RFQVRGNPE-GQGVVAFGQTKDIIRQILQADGLRGFYRGYVASLLTYIPNSAVWWPFYHF 206

Query: 687 --EQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMRAGVVGV 860
             EQL S+LC  +  H   I                  NP+ V++TR+Q +G  + ++  
Sbjct: 207 YAEQL-SYLCPKECPH---IVFQAVSGPLAAATASILTNPMDVIRTRVQVEGKNSIILTF 262

Query: 861 HYRL*EE 881
              + EE
Sbjct: 263 RQLMAEE 269



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 24/69 (34%), Positives = 37/69 (53%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+DVI+TR QV G         + S+I+ +  Q+   EG  G+ +GLS  +++  P+  V
Sbjct: 242 PMDVIRTRVQVEG---------KNSIIL-TFRQLMAEEGPWGLMKGLSARIISATPSTIV 291

Query: 672 YFTIYEQLK 698
               YE LK
Sbjct: 292 IVVGYESLK 300



>gb:AE014134_1127042 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003585_1216571 Drosophila melanogaster
           chromosome 2L, section 6 of 83 of the complete
           sequence.>gb:AY058735_1291889 Drosophila melanogaster
           LP02521 full length cDNA.
          Length = 365

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 30/96 (31%), Positives = 44/96 (45%)
 Frame = +3

Query: 540 LGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDD 719
           + +T  +   IV  L  I Q EG R +++GL P ++ + P+ A+YF  Y Q K+ L S  
Sbjct: 101 ISSTTPKSMSIVQCLRHIVQNEGPRALFKGLGPNLVGVAPSRAIYFCTYSQTKNTLNSLG 160

Query: 720 ERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
                S                   NP+W VKTR+Q
Sbjct: 161 FVERDSPLVHIMSAASAGFVSSTATNPIWFVKTRMQ 196



 Score = 33.5 bits (75), Expect = 8.5
 Identities = 13/37 (35%), Positives = 23/37 (62%)
 Frame = +3

Query: 579 SLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYE 689
           +L  +++ EG  G+YRGL+  ++  +PN A+    YE
Sbjct: 309 TLHTVWKEEGRAGLYRGLATQLVRQIPNTAIMMATYE 345



>sp|Q8BL03|CACL_MOUSE Mitchondrial carnitine/acylcarnitine carrier
           protein CACL (CACT-like).>gb:AK047628_1168152 Mus
           musculus adult male corpus striatum cDNA, RIKEN
           full-length enriched library, clone:C030003J19
           product:hypothetical Mitochondrial energy transfer
           proteins (carrier protein) containing protein, full
           insert sequence.
          Length = 306

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 37/119 (31%), Positives = 60/119 (50%), Gaps = 1/119 (0%)
 Frame = +3

Query: 489 CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA 668
           CP+++ KTR Q+  +        +GSL    L QI++ EGLRG+ RG+  T+L   P++ 
Sbjct: 111 CPMELAKTRLQLQAVGPA--RTYKGSL--DCLVQIYRHEGLRGINRGMVSTLLRETPSFG 166

Query: 669 VYFTIYEQL-KSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMR 842
           VYF  Y+ + ++  C   +R  L +                   P+ VVK+RLQ  G++
Sbjct: 167 VYFLTYDVMTRAMGCEPGDR--LLVPKLLLAGGTSGITSWLSTYPMDVVKSRLQADGLQ 223



>gb:BT005998_1638920 Arabidopsis thaliana At3g20240 gene, complete
           cds.>gb:AP000383_1819918 Arabidopsis thaliana genomic
           DNA, chromosome 3, P1 clone:MAL21.
          Length = 348

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 35/122 (28%), Positives = 58/122 (47%), Gaps = 1/122 (0%)
 Frame = +3

Query: 480 TFVC-PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALL 656
           T VC PL+V+K R  V       +  I  SL + ++ +IF+ +G+RG Y GL PT++ +L
Sbjct: 174 TLVCHPLEVLKDRLTV-------SPEIYPSLSL-AIPRIFRADGIRGFYAGLGPTLVGML 225

Query: 657 PNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
           P    Y+ +Y+++K+  C    +  LS                    PL V + RL    
Sbjct: 226 PYSTCYYFMYDKMKTSYCKSKNKKALSRPEMLVLGALAGLTASTISFPLEVARKRLMVGA 285

Query: 837 MR 842
           ++
Sbjct: 286 LK 287



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 20/76 (26%), Positives = 37/76 (48%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PL+V + R  V  L      N+       ++ ++ ++EG+ G+YRG   + L ++P
Sbjct: 269 TISFPLEVARKRLMVGALKGECPPNM-----AAAIAEVVKKEGVMGLYRGWGASCLKVMP 323

Query: 660 NWAVYFTIYEQLKSFL 707
           +  + +  YE  K  L
Sbjct: 324 SSGITWVFYEAWKDIL 339



>gb:AY085067_1570149 Arabidopsis thaliana clone 126140 mRNA,
           complete sequence.
          Length = 346

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 35/122 (28%), Positives = 58/122 (47%), Gaps = 1/122 (0%)
 Frame = +3

Query: 480 TFVC-PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALL 656
           T VC PL+V+K R  V       +  I  SL + ++ +IF+ +G+RG Y GL PT++ +L
Sbjct: 172 TLVCHPLEVLKDRLTV-------SPEIYPSLSL-AIPRIFRADGIRGFYAGLGPTLVGML 223

Query: 657 PNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
           P    Y+ +Y+++K+  C    +  LS                    PL V + RL    
Sbjct: 224 PYSTCYYFMYDKMKTSYCKSKNKKALSRPEMLVLGALAGLTASTISFPLEVARKRLMVGA 283

Query: 837 MR 842
           ++
Sbjct: 284 LK 285



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 20/76 (26%), Positives = 37/76 (48%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PL+V + R  V  L      N+       ++ ++ ++EG+ G+YRG   + L ++P
Sbjct: 267 TISFPLEVARKRLMVGALKGECPPNM-----AAAIAEVVKKEGVMGLYRGWGASCLKVMP 321

Query: 660 NWAVYFTIYEQLKSFL 707
           +  + +  YE  K  L
Sbjct: 322 SSGITWVFYEAWKDIL 337



>gb:AY062478_1565134 Arabidopsis thaliana putative protein
           (F5K20.24) mRNA, complete cds.>gb:AY093262_1575216
           Arabidopsis thaliana putative protein (F5K20.24) mRNA,
           complete cds.
          Length = 365

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 27/100 (27%), Positives = 49/100 (49%)
 Frame = +3

Query: 408 AHGPSPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLE 587
           +H P+    + +            T   PLD+++ R Q+ G    G   +  + + G+ +
Sbjct: 263 SHRPNDSNAVVSLGCGSLSGIVSSTATFPLDLVRRRMQLEGAG--GRARVYTTGLFGTFK 320

Query: 588 QIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFL 707
            IF+ EG+RG+YRG+ P    ++P   + F  +E+LK  L
Sbjct: 321 HIFKTEGMRGLYRGIIPEYYKVVPGVGIAFMTFEELKKLL 360



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 29/115 (25%), Positives = 50/115 (43%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD+++TR            +I    +  +   I + EG+ G+Y+GL  T+L + P+ A+
Sbjct: 196 PLDLVRTRLSAQ------RNSIYYQGVGHAFRTICREEGILGLYKGLGATLLGVGPSLAI 249

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
            F  YE  K+F  S       ++                   PL +V+ R+Q +G
Sbjct: 250 SFAAYETFKTFWLSHRPNDSNAVVSLGCGSLSGIVSSTATF-PLDLVRRRMQLEG 303



 Score = 37.4 bits (85), Expect(2) = 0.014
 Identities = 33/124 (26%), Positives = 47/124 (37%), Gaps = 6/124 (4%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PL  +   FQ+ G+       +    I     +I + EG R  ++G   TV   LP
Sbjct: 85  TCTAPLARLTILFQIQGMQSEAAI-LSSPNIWHEASRIVKEEGFRAFWKGNLVTVAHRLP 143

Query: 660 NWAVYFTIYEQLKSFLCSDDERHE------LSIXXXXXXXXXXXXXXXXXXNPLWVVKTR 821
             AV F  YE+ K+FL S+           + I                   PL +V+TR
Sbjct: 144 YGAVNFYAYEEYKTFLHSNPVLQSYKGNAGVDISVHFVSGGLAGLTAASATYPLDLVRTR 203

Query: 822 LQTQ 833
           L  Q
Sbjct: 204 LSAQ 207



 Score = 24.6 bits (52), Expect(2) = 0.014
 Identities = 11/20 (55%), Positives = 14/20 (70%)
 Frame = +2

Query: 854 RGTLSALRRIAREKGILGLF 913
           +G   A R I RE+GILGL+
Sbjct: 214 QGVGHAFRTICREEGILGLY 233



>gb:AK041694_1166081 Mus musculus 3 days neonate thymus cDNA, RIKEN
           full-length enriched library, clone:A630030I10
           product:MOTOCHONDRIAL OXODICARBOXYLATE CARRIER homolog
           [Rattus norvegicus], full insert sequence.
          Length = 298

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 33/75 (44%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGL---PKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           PLDV+KTRFQV      P+   T      + GS + IF+ EGL G Y+G+ P +LA  P 
Sbjct: 32  PLDVVKTRFQVQRSVTDPQSYRT------VRGSFQMIFRTEGLFGFYKGIIPPILAETPK 85

Query: 663 WAVYFTIYEQLKSFL 707
            AV F+ +E  K FL
Sbjct: 86  RAVKFSTFELYKKFL 100



 Score = 40.0 bits (92), Expect = 0.090
 Identities = 24/75 (32%), Positives = 38/75 (50%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           F  P DV K+R Q    P+     I+      ++E I++ EG+  +Y+GL P V+ L P 
Sbjct: 223 FNIPFDVAKSRIQG---PQPVPGEIKYRSCFKTMEMIYREEGILALYKGLVPKVMRLGPG 279

Query: 663 WAVYFTIYEQLKSFL 707
             V   +YE   ++L
Sbjct: 280 GGVMLLVYEYTYAWL 294



>gb:AK036988_1164704 Mus musculus adult female vagina cDNA, RIKEN
           full-length enriched library, clone:9930033G19
           product:MOTOCHONDRIAL OXODICARBOXYLATE CARRIER homolog
           [Rattus norvegicus], full insert
           sequence.>gb:BC057980_2103000 Mus musculus solute
           carrier family 25 (mitochondrial oxodicarboxylate
           carrier), member 21, mRNA (cDNA clone MGC:67702
           IMAGE:5042653), complete cds.
          Length = 298

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 33/75 (44%), Positives = 43/75 (57%), Gaps = 3/75 (4%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGL---PKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           PLDV+KTRFQV      P+   T      + GS + IF+ EGL G Y+G+ P +LA  P 
Sbjct: 32  PLDVVKTRFQVQRSVTDPQSYRT------VRGSFQMIFRTEGLFGFYKGIIPPILAETPK 85

Query: 663 WAVYFTIYEQLKSFL 707
            AV F+ +E  K FL
Sbjct: 86  RAVKFSTFELYKKFL 100



 Score = 40.0 bits (92), Expect = 0.090
 Identities = 24/75 (32%), Positives = 38/75 (50%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           F  P DV K+R Q    P+     I+      ++E I++ EG+  +Y+GL P V+ L P 
Sbjct: 223 FNIPFDVAKSRIQG---PQPVPGEIKYRSCFKTMEMIYREEGILALYKGLVPKVMRLGPG 279

Query: 663 WAVYFTIYEQLKSFL 707
             V   +YE   ++L
Sbjct: 280 GGVMLLVYEYTYAWL 294



>pir|T45934|T45934 hypothetical protein F5K20.240 - Arabidopsis
           thaliana>gb:ATF5K20_1550798 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F5K20.
          Length = 358

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 27/100 (27%), Positives = 49/100 (49%)
 Frame = +3

Query: 408 AHGPSPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLE 587
           +H P+    + +            T   PLD+++ R Q+ G    G   +  + + G+ +
Sbjct: 256 SHRPNDSNAVVSLGCGSLSGIVSSTATFPLDLVRRRMQLEGAG--GRARVYTTGLFGTFK 313

Query: 588 QIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFL 707
            IF+ EG+RG+YRG+ P    ++P   + F  +E+LK  L
Sbjct: 314 HIFKTEGMRGLYRGIIPEYYKVVPGVGIAFMTFEELKKLL 353



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 30/115 (26%), Positives = 49/115 (42%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD+++TR    G+     T             I + EG+ G+Y+GL  T+L + P+ A+
Sbjct: 196 PLDLVRTRLSAQGVGHAFRT-------------ICREEGILGLYKGLGATLLGVGPSLAI 242

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
            F  YE  K+F  S       ++                   PL +V+ R+Q +G
Sbjct: 243 SFAAYETFKTFWLSHRPNDSNAVVSLGCGSLSGIVSSTATF-PLDLVRRRMQLEG 296



 Score = 40.0 bits (92), Expect(2) = 0.002
 Identities = 34/126 (26%), Positives = 49/126 (38%), Gaps = 6/126 (4%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PL  +   FQ+ G+       +    I     +I + EG R  ++G   TV   LP
Sbjct: 85  TCTAPLARLTILFQIQGMQSEAAI-LSSPNIWHEASRIVKEEGFRAFWKGNLVTVAHRLP 143

Query: 660 NWAVYFTIYEQLKSFLCSDDERHE------LSIXXXXXXXXXXXXXXXXXXNPLWVVKTR 821
             AV F  YE+ K+FL S+           + I                   PL +V+TR
Sbjct: 144 YGAVNFYAYEEYKTFLHSNPVLQSYKGNAGVDISVHFVSGGLAGLTAASATYPLDLVRTR 203

Query: 822 LQTQGM 839
           L  QG+
Sbjct: 204 LSAQGV 209



 Score = 24.6 bits (52), Expect(2) = 0.002
 Identities = 11/20 (55%), Positives = 14/20 (70%)
 Frame = +2

Query: 854 RGTLSALRRIAREKGILGLF 913
           +G   A R I RE+GILGL+
Sbjct: 207 QGVGHAFRTICREEGILGLY 226



>gb:BC089065_2110700 Rattus norvegicus solute carrier family 25
           (mitochondrial carrier, palmitoylcarnitine transporter),
           member 29 (predicted), mRNA (cDNA clone MGC:105631
           IMAGE:7319298), complete cds.
          Length = 306

 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 38/119 (31%), Positives = 59/119 (49%), Gaps = 1/119 (0%)
 Frame = +3

Query: 489 CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA 668
           CP+++ KTR Q+           +GSL    L QI++ EGLRG+ RG+  T+L   P++ 
Sbjct: 111 CPMELAKTRLQLQAAGPA--RAYKGSL--DCLVQIYRHEGLRGINRGMVSTLLRETPSFG 166

Query: 669 VYFTIYEQL-KSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMR 842
           VYF  Y+ L ++  C   +R  L +                   P+ VVK+RLQ  G++
Sbjct: 167 VYFLTYDVLTRAMGCEPGDR--LLVPKLLLAGGTSGITSWLSTYPMDVVKSRLQADGLQ 223



>gb:AE016818_1747896 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 365

 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 38/128 (29%), Positives = 61/128 (47%), Gaps = 15/128 (11%)
 Frame = +3

Query: 489 CPLDVIKTRFQ---VHGLPKL---GNTNI--RGSL----IVGSLEQIFQREGLRGMYRGL 632
           CP DV+KTR Q    HG  K      TN+  +G +     VG ++ ++ +EG R +++GL
Sbjct: 68  CPFDVVKTRLQSDVFHGAYKTQATARTNVVYQGLMHFRETVGIIQNVYTQEGFRSLFKGL 127

Query: 633 SPTVLALLPNWAVYFTIYEQLK---SFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPL 803
            P ++ ++P  ++ F  Y   K   S L +D +    +                   NP+
Sbjct: 128 GPNLVGVIPARSINFFTYGVTKDTASRLLNDGQE---APWIHFLAGATAGWATSTATNPI 184

Query: 804 WVVKTRLQ 827
           W+VKTRLQ
Sbjct: 185 WLVKTRLQ 192



 Score = 33.9 bits (76), Expect = 6.5
 Identities = 20/66 (30%), Positives = 35/66 (53%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P +V++TR +    PK  N  ++ + +  S   I + EG   MY GL+P ++  +PN  +
Sbjct: 296 PHEVVRTRLRQ--APK-ENGKLKYTGLFQSFSLIIKEEGFASMYSGLTPHLMRTVPNSII 352

Query: 672 YFTIYE 689
            F  +E
Sbjct: 353 MFGTWE 358



>gb:AK017628_1159245 Mus musculus 8 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:5730438N18
           product:hypothetical Mitochondrial energy transfer
           proteins (carrier protein) containing protein, full
           insert sequence.
          Length = 345

 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 40/139 (28%), Positives = 63/139 (45%), Gaps = 22/139 (15%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGL-------PKLGNTNIRGSLIVGS----------LEQIFQREGL 611
           F C L+VIKTR Q   L       P++    I G+ +V            L+ I ++EG 
Sbjct: 28  FTCHLEVIKTRLQSSRLALRTVYYPQVHLGTISGAGMVRPTSVTPGLLQVLKSILEKEGP 87

Query: 612 RGMYRGLSPTVLALLPNWAVYFTIYEQLKS-----FLCSDDERHELSIXXXXXXXXXXXX 776
           + ++RGL P ++ + P+ AVYF  Y + K      F+ + +  H LS             
Sbjct: 88  KSLFRGLGPNLVGVAPSRAVYFACYSKAKEQFNGIFVPNSNNVHILS-------AGSAAF 140

Query: 777 XXXXXXNPLWVVKTRLQTQ 833
                 NP+W+VK R+Q +
Sbjct: 141 VTNTLMNPIWMVKKRMQLE 159



 Score = 34.3 bits (77), Expect = 5.0
 Identities = 24/79 (30%), Positives = 41/79 (51%), Gaps = 3/79 (3%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLE---QIFQREGLRGMYRGLSPTVLA 650
           T + P+ ++K R Q+          +RG   + +L+   +++Q EG+RG YR L+ +  A
Sbjct: 144 TLMNPIWMVKKRMQLE-------RKVRGCKQMNTLQCARRVYQTEGVRGFYRVLTAS-YA 195

Query: 651 LLPNWAVYFTIYEQLKSFL 707
            +    + F IYE LK  L
Sbjct: 196 GISETIICFAIYESLKKCL 214



>gb:AE014297_1139018 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003692_1221011 Drosophila melanogaster
           chromosome 3R, section 30 of 118 of the complete
           sequence.
          Length = 318

 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 36/114 (31%), Positives = 51/114 (44%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           V P++ IK +F      + GN   RG      + QI + EG+ G+Y+GL+PT+L    N 
Sbjct: 149 VTPMETIKVKFIND--QRSGNPKFRG--FAHGVGQIIKSEGISGIYKGLTPTILKQGSNQ 204

Query: 666 AVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
           A+ F + E LK     DD    +                     PL VVKTR+Q
Sbjct: 205 AIRFFVLESLKDLYKGDDHTKPVPKLVVGVFGAIAGAASVFGNTPLDVVKTRMQ 258



>gb:AE014297_1139015 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE014297_1139016 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE014297_1139017
           Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003692_1221008 Drosophila melanogaster
           chromosome 3R, section 30 of 118 of the complete
           sequence.>gb:AE003692_1221009 Drosophila melanogaster
           chromosome 3R, section 30 of 118 of the complete
           sequence.>gb:AE003692_1221010 Drosophila melanogaster
           chromosome 3R, section 30 of 118 of the complete
           sequence.>gb:AY061503_1293306 Drosophila melanogaster
           LD46175 full length cDNA.>gb:BT001798_1356571 Drosophila
           melanogaster RH27308 full insert cDNA.
          Length = 317

 Score = 54.7 bits (130), Expect = 4e-06
 Identities = 36/114 (31%), Positives = 51/114 (44%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           V P++ IK +F      + GN   RG      + QI + EG+ G+Y+GL+PT+L    N 
Sbjct: 148 VTPMETIKVKFIND--QRSGNPKFRG--FAHGVGQIIKSEGISGIYKGLTPTILKQGSNQ 203

Query: 666 AVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
           A+ F + E LK     DD    +                     PL VVKTR+Q
Sbjct: 204 AIRFFVLESLKDLYKGDDHTKPVPKLVVGVFGAIAGAASVFGNTPLDVVKTRMQ 257



>gb:BC037087_2097986 Mus musculus solute carrier family 25
           (mitochondrial carrier, citrate transporter), member 1,
           mRNA (cDNA clone MGC:47055 IMAGE:5124403), complete cds.
          Length = 311

 Score = 54.3 bits (129), Expect = 5e-06
 Identities = 40/143 (27%), Positives = 62/143 (43%), Gaps = 2/143 (1%)
 Frame = +3

Query: 405 DAHG--PSPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVG 578
           DA G   S +GLLC               VCP++ IK +F +H      N   RG     
Sbjct: 114 DAQGRLDSRRGLLCGLGAGVAEAV---VVVCPMETIKVKF-IHDQTS-SNPKYRG--FFH 166

Query: 579 SLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXX 758
            + +I + +GL+G Y+GL+ TVL    N A+ F +   L+++   D+    ++       
Sbjct: 167 GVREIIREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYQGDNHNKPMNPLITGVF 226

Query: 759 XXXXXXXXXXXXNPLWVVKTRLQ 827
                        PL V+KTR+Q
Sbjct: 227 GATAGAASVFGNTPLDVIKTRMQ 249



 Score = 34.7 bits (78), Expect = 3.8
 Identities = 24/72 (33%), Positives = 35/72 (48%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLDVIKTR Q     K  NT   G        +I + EG +  Y+G  P +  +  + A+
Sbjct: 240 PLDVIKTRMQGLEAHKYRNTLDCGL-------KILKNEGPKAFYKGTVPRLGRVCLDVAI 292

Query: 672 YFTIYEQLKSFL 707
            F IY+++   L
Sbjct: 293 VFIIYDEVVKLL 304



>gb:AY122132_1301494 Drosophila melanogaster GH25190 full insert
           cDNA.
          Length = 520

 Score = 54.3 bits (129), Expect = 5e-06
 Identities = 32/122 (26%), Positives = 55/122 (45%), Gaps = 1/122 (0%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T + P++V+KTR  +    +          I  +  +I+++EG+R  YRG  P +L +LP
Sbjct: 394 TIIYPMEVLKTRLALRRTGQYAG-------IADAAVKIYKQEGVRSFYRGYVPNILGILP 446

Query: 660 NWAVYFTIYEQLK-SFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
              +   +YE LK  ++ + D   + S                    PL +V+TRLQ Q 
Sbjct: 447 YAGIDLAVYETLKRRYIANHDNNEQPSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQA 506

Query: 837 MR 842
            +
Sbjct: 507 AK 508



 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 40/146 (27%), Positives = 60/146 (41%), Gaps = 2/146 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD IK   QV    ++G        I   +  +    G R M+RG    VL + P
Sbjct: 301 TCTAPLDRIKVYLQVQ-TQRMG--------ISECMHIMLNEGGSRSMWRGNGINVLKIAP 351

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTR--LQTQ 833
             A  F  YEQ+K  +  DD   ++SI                   P+ V+KTR  L+  
Sbjct: 352 ETAFKFAAYEQMKRLIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRLALRRT 411

Query: 834 GMRAGVVGVHYRL*EE*LVKRAF*GY 911
           G  AG+     ++ ++  V+  + GY
Sbjct: 412 GQYAGIADAAVKIYKQEGVRSFYRGY 437



>pir|G86383|G86383 probable mitochondrial carrier protein [imported]
           - Arabidopsis thaliana>gb:AE005172_891459 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC079281_1732454 Arabidopsis thaliana
           chromosome 1 BAC F2J7 genomic sequence, complete
           sequence.
          Length = 311

 Score = 54.3 bits (129), Expect = 5e-06
 Identities = 48/186 (25%), Positives = 68/186 (36%), Gaps = 47/186 (25%)
 Frame = +3

Query: 420 SPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIR-GSLIVGS----- 581
           S + +  N            TFVCPLDVIKTR QV GLP+   +  R G L +GS     
Sbjct: 13  SIREVAANAGAGATAGAIAATFVCPLDVIKTRLQVLGLPEAPASGQRDGKLSIGSNMIAA 72

Query: 582 ---------------------------------------LEQIFQREGLRGMYRGLSPTV 644
                                                    +I   EG+RG+Y G+ P+ 
Sbjct: 73  AGAGAATSIATNPLWVVKTRLMTQGIRPGVVPYKSVMSAFSRICHEEGVRGLYSGILPS- 131

Query: 645 LALLPNWAVYFTIYEQLKSFLCSDDER--HELSIXXXXXXXXXXXXXXXXXXNPLWVVKT 818
           LA + + A+ F  YE++K ++   D      LS                    P  V++ 
Sbjct: 132 LAGVSHVAIQFPAYEKIKQYMAKMDNTSVENLSPGNVAIASSIAKVIASILTYPHEVIRA 191

Query: 819 RLQTQG 836
           +LQ QG
Sbjct: 192 KLQEQG 197



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 26/89 (29%), Positives = 45/89 (50%), Gaps = 9/89 (10%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P +VI+ + Q  G  ++ N   + S ++  + ++F+ EG+ G+YRG +  +L   P+  +
Sbjct: 185 PHEVIRAKLQEQG--QIRNAETKYSGVIDCITKVFRSEGIPGLYRGCATNLLRTTPSAVI 242

Query: 672 YFTIYEQLKSFL---------CSDDERHE 731
            FT YE +  F           SDD R E
Sbjct: 243 TFTTYEMMLRFFRQVVPPETNRSDDRRRE 271



 Score = 46.2 bits (108), Expect(2) = 2e-04
 Identities = 20/28 (71%), Positives = 25/28 (89%)
 Frame = +1

Query: 988  SGLVTALAGISHVAIQFPTYEKIKIYLA 1071
            SG++ +LAG+SHVAIQFP YEKIK Y+A
Sbjct: 126  SGILPSLAGVSHVAIQFPAYEKIKQYMA 153



 Score = 22.3 bits (46), Expect(2) = 2e-04
 Identities = 8/20 (40%), Positives = 13/20 (65%)
 Frame = +2

Query: 854 RGTLSALRRIAREKGILGLF 913
           +  +SA  RI  E+G+ GL+
Sbjct: 106 KSVMSAFSRICHEEGVRGLY 125



>gb:CR858050_1182238 Pongo pygmaeus mRNA; cDNA DKFZp459F1930 (from
           clone DKFZp459F1930).
          Length = 314

 Score = 53.9 bits (128), Expect = 6e-06
 Identities = 39/127 (30%), Positives = 60/127 (47%), Gaps = 4/127 (3%)
 Frame = +3

Query: 513 RFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIY-- 686
           RFQV G P+ G   +        + QI + +GLRG YRG   ++L  +PN AV++  Y  
Sbjct: 148 RFQVRGNPE-GQGVVAFGQTKDIIRQILRADGLRGFYRGYVASLLTYIPNSAVWWPFYHF 206

Query: 687 --EQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMRAGVVGV 860
             EQL S+LC  +  H   I                  NP+ V++TR+Q +G  + ++  
Sbjct: 207 YAEQL-SYLCPKECPH---IVFQAVSGPLAAATASILTNPMDVIRTRVQVEGKNSIILTF 262

Query: 861 HYRL*EE 881
              + EE
Sbjct: 263 RQLMAEE 269



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 24/69 (34%), Positives = 37/69 (53%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+DVI+TR QV G         + S+I+ +  Q+   EG  G+ +GLS  +++  P+  V
Sbjct: 242 PMDVIRTRVQVEG---------KNSIIL-TFRQLMAEEGPWGLMKGLSARIISATPSTIV 291

Query: 672 YFTIYEQLK 698
               YE LK
Sbjct: 292 IVVGYESLK 300



>gb:AE014296_1136007 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003541_1214669 Drosophila melanogaster
           chromosome 3L, section 44 of 83 of the complete
           sequence.>gb:AY119650_1301219 Drosophila melanogaster
           RE56970 full insert cDNA.
          Length = 363

 Score = 53.9 bits (128), Expect = 6e-06
 Identities = 32/119 (26%), Positives = 54/119 (45%), Gaps = 1/119 (0%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T + P++V+KTR  +    +          I  +  +I+++EG+R  YRG  P +L +LP
Sbjct: 174 TIIYPMEVLKTRLALRRTGQYAG-------IADAAVKIYKQEGVRSFYRGYVPNILGILP 226

Query: 660 NWAVYFTIYEQLK-SFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
              +   +YE LK  ++ + D   + S                    PL +V+TRLQ Q
Sbjct: 227 YAGIDLAVYETLKRRYIANHDNNEQPSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQ 285



 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 40/146 (27%), Positives = 60/146 (41%), Gaps = 2/146 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD IK   QV    ++G        I   +  +    G R M+RG    VL + P
Sbjct: 81  TCTAPLDRIKVYLQVQ-TQRMG--------ISECMHIMLNEGGSRSMWRGNGINVLKIAP 131

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTR--LQTQ 833
             A  F  YEQ+K  +  DD   ++SI                   P+ V+KTR  L+  
Sbjct: 132 ETAFKFAAYEQMKRLIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRLALRRT 191

Query: 834 GMRAGVVGVHYRL*EE*LVKRAF*GY 911
           G  AG+     ++ ++  V+  + GY
Sbjct: 192 GQYAGIADAAVKIYKQEGVRSFYRGY 217



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 13/79 (16%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSL-------------IVGSLEQIFQREGLRGMYRGL 632
           PL +++TR Q      + N   +  +             + G   +I ++EGL G+YRG+
Sbjct: 274 PLALVRTRLQAQAAETIANQKRKTQIPLKSSDAHSGEETMTGLFRKIVRQEGLTGLYRGI 333

Query: 633 SPTVLALLPNWAVYFTIYE 689
           +P  L +LP  ++ + +YE
Sbjct: 334 TPNFLKVLPAVSISYVVYE 352



>gb:AE014296_1136005 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE014296_1136006 Drosophila melanogaster
           chromosome 3L, complete sequence.>gb:AE003541_1214667
           Drosophila melanogaster chromosome 3L, section 44 of 83
           of the complete sequence.>gb:AE003541_1214668 Drosophila
           melanogaster chromosome 3L, section 44 of 83 of the
           complete sequence.
          Length = 583

 Score = 53.9 bits (128), Expect = 6e-06
 Identities = 32/119 (26%), Positives = 54/119 (45%), Gaps = 1/119 (0%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T + P++V+KTR  +    +          I  +  +I+++EG+R  YRG  P +L +LP
Sbjct: 394 TIIYPMEVLKTRLALRRTGQYAG-------IADAAVKIYKQEGVRSFYRGYVPNILGILP 446

Query: 660 NWAVYFTIYEQLK-SFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
              +   +YE LK  ++ + D   + S                    PL +V+TRLQ Q
Sbjct: 447 YAGIDLAVYETLKRRYIANHDNNEQPSFLVLLACGSTSSTLGQLCSYPLALVRTRLQAQ 505



 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 40/146 (27%), Positives = 60/146 (41%), Gaps = 2/146 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD IK   QV    ++G        I   +  +    G R M+RG    VL + P
Sbjct: 301 TCTAPLDRIKVYLQVQ-TQRMG--------ISECMHIMLNEGGSRSMWRGNGINVLKIAP 351

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTR--LQTQ 833
             A  F  YEQ+K  +  DD   ++SI                   P+ V+KTR  L+  
Sbjct: 352 ETAFKFAAYEQMKRLIRGDDGSRQMSIVERFYAGAAAGGISQTIIYPMEVLKTRLALRRT 411

Query: 834 GMRAGVVGVHYRL*EE*LVKRAF*GY 911
           G  AG+     ++ ++  V+  + GY
Sbjct: 412 GQYAGIADAAVKIYKQEGVRSFYRGY 437



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 13/79 (16%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSL-------------IVGSLEQIFQREGLRGMYRGL 632
           PL +++TR Q      + N   +  +             + G   +I ++EGL G+YRG+
Sbjct: 494 PLALVRTRLQAQAAETIANQKRKTQIPLKSSDAHSGEETMTGLFRKIVRQEGLTGLYRGI 553

Query: 633 SPTVLALLPNWAVYFTIYE 689
           +P  L +LP  ++ + +YE
Sbjct: 554 TPNFLKVLPAVSISYVVYE 572



>gb:BC080378_2561685 Xenopus laevis MGC81556 protein, mRNA (cDNA
           clone MGC:81556 IMAGE:6862964), complete cds.
          Length = 246

 Score = 53.5 bits (127), Expect = 8e-06
 Identities = 33/117 (28%), Positives = 56/117 (47%)
 Frame = +3

Query: 489 CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA 668
           CP+++ KTR Q+ G  +  + +      +  L +I+++EGLRG+ RG+  T L   P++ 
Sbjct: 56  CPMELAKTRLQLQGTGEYKSKSKTYKNSLDCLLKIYRKEGLRGINRGMVTTFLRETPSFG 115

Query: 669 VYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGM 839
            YF  Y+ L  +L S +      I                   P+ V+K+RLQ  G+
Sbjct: 116 FYFLTYDYLSRYL-SCEINDTFIIPKLLFAGGMSGIVSWLSTYPIDVIKSRLQADGI 171



 Score = 37.7 bits (86), Expect = 0.45
 Identities = 24/80 (30%), Positives = 40/80 (50%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+DVIK+R Q  G+  + N N     I+  + + ++ EG R   RGL+ T+L   P  A 
Sbjct: 158 PIDVIKSRLQADGIGGVNNYN----GIMDCVRKSYKEEGWRVFSRGLTSTLLRAFPVNAA 213

Query: 672 YFTIYEQLKSFLCSDDERHE 731
            F        ++  ++E +E
Sbjct: 214 TFATVTLFLMYMRGENEVNE 233



>gb:AJ720668_2502855 Gallus gallus mRNA for hypothetical protein,
           clone 23c2.
          Length = 301

 Score = 53.5 bits (127), Expect = 8e-06
 Identities = 36/142 (25%), Positives = 58/142 (40%), Gaps = 1/142 (0%)
 Frame = +3

Query: 435 LCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSL-EQIFQREGL 611
           L N              +CP +++K R Q     +L    ++G   V S+ + + Q++G 
Sbjct: 107 LQNAAAGSFASAFATLVLCPTELVKCRLQAMHEMQLSGKIVQGQSTVWSVVKSVIQKDGP 166

Query: 612 RGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXX 791
            G YRGLS T+L  +P +  +F  YE  ++F  S   + EL                   
Sbjct: 167 LGFYRGLSSTLLREVPGYFFFFGGYELSRTFFASGRSKDELGPIPLLLSGGFGGSCLWIA 226

Query: 792 XNPLWVVKTRLQTQGMRAGVVG 857
             P+  VK+R+Q   M     G
Sbjct: 227 VYPVDCVKSRIQVLSMAGKQTG 248



>gb:AE016817_1747335 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 912

 Score = 53.5 bits (127), Expect = 8e-06
 Identities = 34/117 (29%), Positives = 56/117 (47%), Gaps = 1/117 (0%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVH-GLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           V P+D++KTR Q      K  N+       +  L +I  +EG+RG+Y GL P ++ + P 
Sbjct: 542 VYPIDMVKTRMQAQRDFSKYKNS-------IDCLLKILSKEGVRGLYSGLGPQLIGVAPE 594

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
            A+  T+ + +++ L   D +  LS+                  NPL +VK RLQ +
Sbjct: 595 KAIKLTVNDHMRATLAGRDGK--LSLPCEIISGATAGACQVVFTNPLEIVKIRLQVK 649



 Score = 44.3 bits (103), Expect = 0.005
 Identities = 34/139 (24%), Positives = 55/139 (39%), Gaps = 7/139 (5%)
 Frame = +3

Query: 432  LLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHG--LPKLGNTNIRGSLIVGSLEQIFQRE 605
            L C              F  PL+++K R QV    +      ++    ++ +L       
Sbjct: 618  LPCEIISGATAGACQVVFTNPLEIVKIRLQVKSDYVADAARNSVNAISVIKNL------- 670

Query: 606  GLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCS-----DDERHELSIXXXXXXXXXX 770
            GL G+YRG    +L  +P  A+YF  Y  +KS + +      D+R++L+           
Sbjct: 671  GLIGLYRGAGACLLRDIPFSAIYFPTYAHIKSNVFNFDPKDSDKRNKLNTWQLLVSGGLA 730

Query: 771  XXXXXXXXNPLWVVKTRLQ 827
                     P  V+KTRLQ
Sbjct: 731  GMPAAFLTTPFDVIKTRLQ 749



 Score = 34.7 bits (78), Expect = 3.8
 Identities = 22/66 (33%), Positives = 31/66 (46%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P DVIKTR Q+   PK G +   G  I  +   I + EG++  ++G    VL   P +  
Sbjct: 740 PFDVIKTRLQID--PKKGESVYNG--IWDAARTILKEEGIKSFFKGGPARVLRSSPQFGF 795

Query: 672 YFTIYE 689
               YE
Sbjct: 796 TLAAYE 801



>gb:AK032960_1163145 Mus musculus 12 days embryo male wolffian duct
           includes surrounding region cDNA, RIKEN full-length
           enriched library, clone:6720482A19 product:hypothetical
           Mitochondrial energy transfer proteins (carrier protein)
           containing protein, full insert
           sequence.>gb:AK046586_1167845 Mus musculus 4 days
           neonate male adipose cDNA, RIKEN full-length enriched
           library, clone:B430110G05 product:hypothetical
           Mitochondrial energy transfer proteins (carrier protein)
           containing protein, full insert
           sequence.>gb:AK083273_1173889 Mus musculus adult male
           hippocampus cDNA, RIKEN full-length enriched library,
           clone:C630032N01 product:hypothetical Mitochondrial
           energy transfer proteins (carrier protein) containing
           protein, full insert sequence.>gb:AK083470_1173978 Mus
           musculus 9 days embryo whole body cDNA, RIKEN
           full-length enriched library, clone:D030022M20
           product:hypothetical Mitochondrial energy transfer
           proteins (carrier protein) containing protein, full
           insert sequence.>gb:BC052771_2101267 Mus musculus RIKEN
           cDNA B430110G05 gene, mRNA (cDNA clone MGC:56884
           IMAGE:6310271), complete cds.
          Length = 314

 Score = 53.5 bits (127), Expect = 8e-06
 Identities = 42/131 (32%), Positives = 61/131 (46%), Gaps = 8/131 (6%)
 Frame = +3

Query: 513 RFQVHGLPKLGNTNIRGSLIVGS----LEQIFQREGLRGMYRGLSPTVLALLPNWAVYFT 680
           RFQVHG     N   +G +  G     + QI + +GLRG YRG   ++L  +PN AV++ 
Sbjct: 148 RFQVHG-----NLEGQGVIAFGQTKDIIRQILRADGLRGFYRGYVASLLTYIPNSAVWWP 202

Query: 681 IY----EQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMRAG 848
            Y    EQL S LC  +  H   I                  NP+ V++TR+Q +G  + 
Sbjct: 203 FYHFYAEQL-SRLCPQECPH---IVFQAISGPLAAATASILTNPMDVIRTRVQVEGKSSI 258

Query: 849 VVGVHYRL*EE 881
           V+     + EE
Sbjct: 259 VLTFRQLMAEE 269



 Score = 40.4 bits (93), Expect = 0.069
 Identities = 25/69 (36%), Positives = 35/69 (50%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+DVI+TR QV G           S IV +  Q+   EG  G+ +GLS  +++  P+  V
Sbjct: 242 PMDVIRTRVQVEGK----------SSIVLTFRQLMAEEGPWGLMKGLSARIISATPSTIV 291

Query: 672 YFTIYEQLK 698
               YE LK
Sbjct: 292 IVVGYESLK 300



>gb:BC041303_2547930 Xenopus laevis solute carrier family 25
           (mitochondrial carrier; citrate transporter), member 1,
           mRNA (cDNA clone MGC:53598 IMAGE:4683857), complete cds.
          Length = 332

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 40/142 (28%), Positives = 60/142 (42%)
 Frame = +3

Query: 402 ADAHGPSPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGS 581
           AD    S + LLC               VCP++ IK +F +H      N   RG      
Sbjct: 136 ADGKLDSKRSLLCGLGAGVAEAV---VVVCPMETIKVKF-IHDQCS-PNPKYRG--FFHG 188

Query: 582 LEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXX 761
           + +I + EG++G Y+GL+ TVL    N A+ F +   L+++   DD    ++        
Sbjct: 189 VREIIRVEGIKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYRGDDPNRPMNPLVTGAFG 248

Query: 762 XXXXXXXXXXXNPLWVVKTRLQ 827
                       PL VVKTR+Q
Sbjct: 249 AIAGAASVFGNTPLDVVKTRMQ 270



 Score = 34.7 bits (78), Expect = 3.8
 Identities = 22/70 (31%), Positives = 36/70 (51%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P + +KT+ Q+    K      RG  I   ++Q     G++G+YRGLS  +   +P  AV
Sbjct: 66  PTEYVKTQLQLD--EKANPPRYRG--IWDCVKQTVDGHGVKGLYRGLSSLLYGSIPKAAV 121

Query: 672 YFTIYEQLKS 701
            F ++E L +
Sbjct: 122 RFGMFEFLSN 131



>gb:CR382125_1657818 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 906

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 34/130 (26%), Positives = 61/130 (46%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T V P+D++KTR Q          +++    +  + +IFQ +G+RG+Y GL P ++ + P
Sbjct: 520 TVVYPIDLVKTRMQAQ------RNSVQYKNSIDCVVKIFQTKGIRGLYSGLGPQLIGVAP 573

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGM 839
             A+  T+ + ++ +    ++   +                    NPL +VK RLQ   M
Sbjct: 574 EKAIKLTVNDFMRQYFM--NKSRTIKWYQEILSGATAGACQVVFTNPLEIVKIRLQ---M 628

Query: 840 RAGVVGVHYR 869
           R+  VG + R
Sbjct: 629 RSDYVGENAR 638



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 36/121 (29%), Positives = 54/121 (44%), Gaps = 6/121 (4%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGLPKLGNTNIRGSL-IVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           F  PL+++K R Q+         N R  L  VG + Q+    GLRG+Y+G +  +L  +P
Sbjct: 615 FTNPLEIVKIRLQMRS--DYVGENARPQLGAVGIIRQL----GLRGLYKGAAACLLRDVP 668

Query: 660 NWAVYFTIYEQLKSFLCSDD-----ERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRL 824
             A+YF  Y  LK  + + D     +R++L                     P  V+KTRL
Sbjct: 669 FSAIYFPTYAHLKKDVFNFDPNDKNKRNKLKTWELLLAGGIAGMPAAYLTTPFDVIKTRL 728

Query: 825 Q 827
           Q
Sbjct: 729 Q 729



 Score = 38.1 bits (87), Expect = 0.34
 Identities = 22/80 (27%), Positives = 36/80 (45%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P DVIKTR Q+   P+ G T   G  ++ +   I + E ++  ++G    VL   P +  
Sbjct: 720 PFDVIKTRLQID--PRKGETTYTG--VIHAARTILKEESIKSFFKGGPARVLRSSPQFGF 775

Query: 672 YFTIYEQLKSFLCSDDERHE 731
               +E  +    S  + HE
Sbjct: 776 TLAAFEMFQGLFPSHFKNHE 795



>gb:AC115584_1205707 Dictyostelium discoideum chromosome 2 map
           complement(3622543-3568102) strain AX4, complete
           sequence.
          Length = 301

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 35/126 (27%), Positives = 61/126 (48%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P++++K R QV GL          S    SL+++    G++G+Y+G + T+L  +P   +
Sbjct: 139 PMELVKIRMQVSGL----------SGKKASLKEVVSELGIKGLYKGTASTLLRDVPFSMI 188

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMRAGV 851
           YF+IY ++K  L +D E  E+ +                   P  V+KTR+Q   ++ G 
Sbjct: 189 YFSIYGRMKHNL-TDQETGEIGLPKILLCGITAGSIAASVSTPFDVIKTRIQ---VKPGP 244

Query: 852 VGVHYR 869
              HY+
Sbjct: 245 NDPHYK 250



 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 1/119 (0%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREG-LRGMYRGLSPTVLALLPN 662
           V PLD +KTR Q   +   G+    G  I+   +++ + EG +RG+YRGLS  ++ ++P 
Sbjct: 38  VFPLDFVKTRLQQQRVSIDGSKQYNG--IIDCFKKVIKNEGGVRGLYRGLSSNLIGIIPE 95

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGM 839
            A+   + +  ++    D  R  + +                  NP+ +VK R+Q  G+
Sbjct: 96  KALKLAMNDYFRTRFQGD--RSYIKLWEEVASGGLAGMCQVVATNPMELVKIRMQVSGL 152



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 30/97 (30%), Positives = 43/97 (44%)
 Frame = +3

Query: 423 PKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQR 602
           PK LLC                 P DVIKTR QV   P   + + +G  I     +  Q 
Sbjct: 211 PKILLCGITAGSIAASVST----PFDVIKTRIQVK--PGPNDPHYKG--IADCFRKTIQS 262

Query: 603 EGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCS 713
           EG + +++G+ P V  + P + +   +YE  KSF  S
Sbjct: 263 EGPKALFKGVLPRVCIISPLFGITLVVYEIQKSFYAS 299



>gb:CR857243_1181488 Pongo pygmaeus mRNA; cDNA DKFZp469I0832 (from
           clone DKFZp469I0832).
          Length = 299

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 31/72 (43%), Positives = 39/72 (54%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLDV+KTRFQ+       N+      +V S   IFQ E L G Y+G+ P +LA  P  AV
Sbjct: 33  PLDVVKTRFQIQRCATDPNSY---KSLVDSFRMIFQTERLFGFYKGILPPILAETPKRAV 89

Query: 672 YFTIYEQLKSFL 707
            F  +EQ K  L
Sbjct: 90  KFFTFEQYKKLL 101



 Score = 40.4 bits (93), Expect = 0.069
 Identities = 23/72 (31%), Positives = 37/72 (51%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P DV K+R Q    P+     I+      ++  ++Q EG+  +Y+GL P ++ L P  AV
Sbjct: 227 PFDVAKSRIQG---PQPVPGEIKYRTCFKTMATVYQEEGILALYKGLLPKIMRLGPGGAV 283

Query: 672 YFTIYEQLKSFL 707
              +YE   S+L
Sbjct: 284 MLLVYEYTYSWL 295



>gb:HAMCTP_1996072 H.sapiens gene encoding mitochondrial citrate
           transport protein.
          Length = 318

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 40/143 (27%), Positives = 62/143 (43%), Gaps = 2/143 (1%)
 Frame = +3

Query: 405 DAHG--PSPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVG 578
           DA G   S +GLLC               VCP++ IK +F +H      N   RG     
Sbjct: 121 DAQGRLDSTRGLLCGLGAGVAEAV---VVVCPMETIKVKF-IHDQTS-PNPKYRG--FFH 173

Query: 579 SLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXX 758
            + +I + +GL+G Y+GL+ TVL    N A+ F +   L+++   D+    ++       
Sbjct: 174 GVREIVREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYRGDNPNKPMNPLITGVF 233

Query: 759 XXXXXXXXXXXXNPLWVVKTRLQ 827
                        PL V+KTR+Q
Sbjct: 234 GAIAGAASVFGNTPLDVIKTRMQ 256



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 26/72 (36%), Positives = 37/72 (51%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLDVIKTR Q     K  NT   G        QI ++EGL+  Y+G  P +  +  + A+
Sbjct: 247 PLDVIKTRMQGLEAHKYRNTWDCGL-------QILKKEGLKAFYKGTVPRLGRVCLDVAI 299

Query: 672 YFTIYEQLKSFL 707
            F IY+++   L
Sbjct: 300 VFVIYDEVVKLL 311



>gb:AP004622_1842244 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0689E12.>gb:AP005509_1853078 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1003_A09.
          Length = 385

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 37/137 (27%), Positives = 57/137 (41%), Gaps = 3/137 (2%)
 Frame = +3

Query: 423 PKGLLCNXXXXXXXXXXXXTFVC-PLDVIKTRFQVH--GLPKLGNTNIRGSLIVGSLEQI 593
           P  LL              T VC PL+V+K R  V+    P +G           +  +I
Sbjct: 194 PLHLLSPIAVGGAAAGIVSTLVCHPLEVLKDRLTVNREAYPSIGL----------AFNKI 243

Query: 594 FQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXX 773
           +Q +G+ G+Y GL PT++ +LP    Y+ +YE +K+  C   ++  LS            
Sbjct: 244 YQTDGIGGLYAGLCPTLVGMLPYSTCYYFMYETIKTSYCRAHKKKSLSRPELLIIGALSG 303

Query: 774 XXXXXXXNPLWVVKTRL 824
                   PL V + RL
Sbjct: 304 LTASTISFPLEVARKRL 320



 Score = 40.4 bits (93), Expect = 0.069
 Identities = 22/80 (27%), Positives = 41/80 (51%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PL+V + R  V  L      ++     + +L ++FQ EG++G+YRG + + L ++P
Sbjct: 308 TISFPLEVARKRLMVGTLQGKCPPHM-----IAALAEVFQEEGIKGLYRGWAASSLKVMP 362

Query: 660 NWAVYFTIYEQLKSFLCSDD 719
              + +  YE  K  L + +
Sbjct: 363 TSGITWMFYEAWKDILLAPE 382



>gb:CR382128_1661239 Yarrowia lipolytica chromosome B of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 317

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 27/81 (33%), Positives = 46/81 (56%), Gaps = 1/81 (1%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGS-LIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA 668
           PLDV+KT  Q        +  +R +    G+++ I++ +GLRG +RGL P ++A +P+ A
Sbjct: 235 PLDVVKTFLQTRRAMGSESLEVRSTKTFAGAVKIIYREDGLRGFFRGLRPRIVANMPSTA 294

Query: 669 VYFTIYEQLKSFLCSDDERHE 731
           + +T YE  K +L    +  E
Sbjct: 295 ICWTSYEMAKFYLAPKAKTQE 315



 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 41/154 (26%), Positives = 58/154 (37%), Gaps = 8/154 (5%)
 Frame = +3

Query: 429 GLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREG 608
           G+  N            T + P+D IKTR QV      G T      IV ++  I  +EG
Sbjct: 16  GIGANMLAGAFAGIMEHTVMYPVDAIKTRMQVGP----GGTGSVYKGIVQAVSSISAKEG 71

Query: 609 LRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLC--------SDDERHELSIXXXXXXXX 764
              ++RG+S  ++   P  AVYF +YE  K  +         S DE H +          
Sbjct: 72  ASSLWRGISSVIVGAGPAHAVYFGVYEFTKKNMLLYQGHTEDSSDEHHPV---ITSLAGA 128

Query: 765 XXXXXXXXXXNPLWVVKTRLQTQGMRAGVVGVHY 866
                     NP  V+K R+Q      G  G  +
Sbjct: 129 AATTSSDALMNPFDVIKQRMQLPASAGGSAGATF 162



 Score = 38.1 bits (87), Expect = 0.34
 Identities = 33/114 (28%), Positives = 44/114 (38%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P DVIK R Q   LP     +  G+    + + IF+ EG    Y     T+   +P  A+
Sbjct: 140 PFDVIKQRMQ---LPASAGGSA-GATFAQTAKNIFKNEGFGAFYVSYPTTLAMNVPFTAI 195

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
            FT+YE     L    +   L                     PL VVKT LQT+
Sbjct: 196 NFTVYESASKILNPSRKYDPLG---HCVAGGVAGAVAAAVTTPLDVVKTFLQTR 246



>pir|G01789|G01789 citrate transporter protein -
           human>gb:HSU25147_2022976 Human citrate transporter
           protein mRNA, nuclear gene encoding mitochondrial
           protein, complete cds.
          Length = 311

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 40/143 (27%), Positives = 62/143 (43%), Gaps = 2/143 (1%)
 Frame = +3

Query: 405 DAHG--PSPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVG 578
           DA G   S +GLLC               VCP++ IK +F +H      N   RG     
Sbjct: 114 DAQGRLDSTRGLLCGLGAGVAEAV---VVVCPMETIKVKF-IHDQTS-PNPKYRG--FFH 166

Query: 579 SLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXX 758
            + +I + +GL+G Y+GL+ TVL    N A+ F +   L+++   D+    ++       
Sbjct: 167 GVREIVREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYRGDNPNKPMNPLITGVF 226

Query: 759 XXXXXXXXXXXXNPLWVVKTRLQ 827
                        PL V+KTR+Q
Sbjct: 227 GAIAGAASVFGNTPLDVIKTRMQ 249



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 26/72 (36%), Positives = 37/72 (51%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLDVIKTR Q     K  NT   G        QI ++EGL+  Y+G  P +  +  + A+
Sbjct: 240 PLDVIKTRMQGLEAHKYRNTWDCGL-------QILKKEGLKAFYKGTVPRLGRVCLDVAI 292

Query: 672 YFTIYEQLKSFL 707
            F IY+++   L
Sbjct: 293 VFVIYDEVVKLL 304



>sp|P32089|TXTP_RAT Tricarboxylate transport protein, mitochondrial
           precursor (Citrate transport protein) (CTP)
           (Tricarboxylate carrier protein).>pir|A46595|A46595
           tricarboxylate transport protein precursor,
           mitochondrial - rat>gb:RATCTP2X_2131925 Rat
           tricarboxylate transport protein mRNA, complete cds.
          Length = 311

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 39/143 (27%), Positives = 62/143 (43%), Gaps = 2/143 (1%)
 Frame = +3

Query: 405 DAHG--PSPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVG 578
           DA G   S +GLLC               VCP++ +K +F +H      N   RG     
Sbjct: 114 DAQGRLDSRRGLLCGLGAGVAEAV---VVVCPMETVKVKF-IHDQTS-SNPKYRG--FFH 166

Query: 579 SLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXX 758
            + +I + +GL+G Y+GL+ TVL    N A+ F +   L+++   D+    ++       
Sbjct: 167 GVREIVREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYQGDNPNKPMNPLITGVF 226

Query: 759 XXXXXXXXXXXXNPLWVVKTRLQ 827
                        PL V+KTR+Q
Sbjct: 227 GAVAGAASVFGNTPLDVIKTRMQ 249



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 25/72 (34%), Positives = 35/72 (48%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLDVIKTR Q     K  NT   G        QI + EG +  Y+G  P +  +  + A+
Sbjct: 240 PLDVIKTRMQGLEAHKYRNTLDCGV-------QILKNEGPKAFYKGTVPRLGRVCLDVAI 292

Query: 672 YFTIYEQLKSFL 707
            F IY+++   L
Sbjct: 293 VFVIYDEVVKLL 304



>sp|P53007|TXTP_HUMAN Tricarboxylate transport protein,
           mitochondrial precursor (Citrate transport protein)
           (CTP) (Tricarboxylate carrier
           protein).>gb:BC004980_1969494 Homo sapiens solute
           carrier family 25 (mitochondrial carrier; citrate
           transporter), member 1, mRNA (cDNA clone MGC:3876
           IMAGE:2957917), complete cds.>gb:BC008061_1971186 Homo
           sapiens solute carrier family 25 (mitochondrial carrier;
           citrate transporter), member 1, mRNA (cDNA clone
           MGC:2151 IMAGE:2958945), complete cds.>gb:HUMCTP_2030370
           Homo sapiens citrate transport protein mRNA, complete
           cds; nuclear gene for mitochondrial
           product.>gb:HUMCTPG_2030371 Homo sapiens citrate
           transport protein gene, complete cds; nuclear gene for
           mitochondrial product.
          Length = 311

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 40/143 (27%), Positives = 62/143 (43%), Gaps = 2/143 (1%)
 Frame = +3

Query: 405 DAHG--PSPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVG 578
           DA G   S +GLLC               VCP++ IK +F +H      N   RG     
Sbjct: 114 DAQGRLDSTRGLLCGLGAGVAEAV---VVVCPMETIKVKF-IHDQTS-PNPKYRG--FFH 166

Query: 579 SLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXX 758
            + +I + +GL+G Y+GL+ TVL    N A+ F +   L+++   D+    ++       
Sbjct: 167 GVREIVREQGLKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYRGDNPNKPMNPLITGVF 226

Query: 759 XXXXXXXXXXXXNPLWVVKTRLQ 827
                        PL V+KTR+Q
Sbjct: 227 GAIAGAASVFGNTPLDVIKTRMQ 249



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 26/72 (36%), Positives = 37/72 (51%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLDVIKTR Q     K  NT   G        QI ++EGL+  Y+G  P +  +  + A+
Sbjct: 240 PLDVIKTRMQGLEAHKYRNTWDCGL-------QILKKEGLKAFYKGTVPRLGRVCLDVAI 292

Query: 672 YFTIYEQLKSFL 707
            F IY+++   L
Sbjct: 293 VFVIYDEVVKLL 304



>gb:BC055369_2102017 Mus musculus solute carrier family 25
           (mitochondrial carrier, phosphate carrier), member 24,
           mRNA (cDNA clone MGC:60830 IMAGE:30055307), complete
           cds.
          Length = 475

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 37/128 (28%), Positives = 52/128 (40%), Gaps = 2/128 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVHG   +         I G   Q+ +  G+R ++RG    V+ + P
Sbjct: 210 TSTAPLDRLKVMMQVHGSKSMN--------IFGGFRQMVKEGGIRSLWRGNGTNVIKIAP 261

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQT--Q 833
             AV F  YEQ K  L   +E  +L                     P+ V+KTRL     
Sbjct: 262 ETAVKFWAYEQYKKLL--TEEGQKLGTFERFISGSMAGATAQTFIYPMEVLKTRLAVAKT 319

Query: 834 GMRAGVVG 857
           G  +G+ G
Sbjct: 320 GQYSGIYG 327



 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 37/138 (26%), Positives = 62/138 (44%), Gaps = 7/138 (5%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           TF+ P++V+KTR  V    K G      S I G  ++I + EG    Y+G  P +L ++P
Sbjct: 302 TFIYPMEVLKTRLAV---AKTGQY----SGIYGCAKKILKHEGFGAFYKGYIPNLLGIIP 354

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELS--IXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
              +   +YE LKS+   +  +  ++  +                   PL +V+TR+Q Q
Sbjct: 355 YAGIDLAVYELLKSYWLDNFAKDSVNPGVMVLLSCGALSSTCGQLASYPLALVRTRMQAQ 414

Query: 834 GMRAG-----VVGVHYRL 872
               G     +VG+  R+
Sbjct: 415 ATVEGAPQLSMVGLFQRI 432



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 25/76 (32%), Positives = 43/76 (56%), Gaps = 4/76 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    V G P+L         +VG  ++I  +EG+ G+YRG++P  + +LP
Sbjct: 403 PLALVRTRMQAQATVEGAPQLS--------MVGLFQRIVSKEGVSGLYRGITPNFMKVLP 454

Query: 660 NWAVYFTIYEQLKSFL 707
              + + +YE +K  L
Sbjct: 455 AVGISYVVYENMKQTL 470



>gb:BC005163_1969651 Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 25,
           mRNA (cDNA clone IMAGE:3530123), partial cds.
          Length = 308

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 41/133 (30%), Positives = 58/133 (43%), Gaps = 2/133 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVH       +N  G  IVG   Q+ +  G R ++RG    VL + P
Sbjct: 41  TCTAPLDRLKVLMQVHA----SRSNNMG--IVGGFTQMIREGGARSLWRGNGINVLKIAP 94

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTR--LQTQ 833
             A+ F  YEQ+K  + SD E   L I                   P+ V+KTR  L+  
Sbjct: 95  ESAIKFMAYEQIKRLVGSDQE--TLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKT 152

Query: 834 GMRAGVVGVHYRL 872
           G  +G++    R+
Sbjct: 153 GQYSGMLDCARRI 165



 Score = 42.0 bits (97), Expect = 0.024
 Identities = 21/73 (28%), Positives = 41/73 (56%), Gaps = 4/73 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    + G P++  +++         + I + EG  G+YRGL+P  + ++P
Sbjct: 236 PLALVRTRMQAQASIEGAPEVTMSSL--------FKHILRTEGAFGLYRGLAPNFMKVIP 287

Query: 660 NWAVYFTIYEQLK 698
             ++ + +YE LK
Sbjct: 288 AVSISYVVYENLK 300



 Score = 38.1 bits (87), Expect = 0.34
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           + P++V+KTR     L K G      S ++    +I  REG+   Y+G  P +L ++P  
Sbjct: 137 IYPMEVLKTRM---ALRKTGQY----SGMLDCARRILAREGVAAFYKGYVPNMLGIIPYA 189

Query: 666 AVYFTIYEQLKS 701
            +   +YE LK+
Sbjct: 190 GIDLAVYETLKN 201



>gb:AY358515_1947394 Homo sapiens clone DNA59609 LCLC549 (UNQ549)
           mRNA, complete cds.
          Length = 469

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 41/133 (30%), Positives = 58/133 (43%), Gaps = 2/133 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVH       +N  G  IVG   Q+ +  G R ++RG    VL + P
Sbjct: 202 TCTAPLDRLKVLMQVHA----SRSNNMG--IVGGFTQMIREGGARSLWRGNGINVLKIAP 255

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTR--LQTQ 833
             A+ F  YEQ+K  + SD E   L I                   P+ V+KTR  L+  
Sbjct: 256 ESAIKFMAYEQIKRLVGSDQE--TLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKT 313

Query: 834 GMRAGVVGVHYRL 872
           G  +G++    R+
Sbjct: 314 GQYSGMLDCARRI 326



 Score = 42.0 bits (97), Expect = 0.024
 Identities = 21/73 (28%), Positives = 41/73 (56%), Gaps = 4/73 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    + G P++  +++         + I + EG  G+YRGL+P  + ++P
Sbjct: 397 PLALVRTRMQAQASIEGAPEVTMSSL--------FKHILRTEGAFGLYRGLAPNFMKVIP 448

Query: 660 NWAVYFTIYEQLK 698
             ++ + +YE LK
Sbjct: 449 AVSISYVVYENLK 461



 Score = 38.1 bits (87), Expect = 0.34
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           + P++V+KTR     L K G      S ++    +I  REG+   Y+G  P +L ++P  
Sbjct: 298 IYPMEVLKTRM---ALRKTGQY----SGMLDCARRILAREGVAAFYKGYVPNMLGIIPYA 350

Query: 666 AVYFTIYEQLKS 701
            +   +YE LK+
Sbjct: 351 GIDLAVYETLKN 362



>gb:AL360268_1926110 Human DNA sequence from clone RP11-379C10 on
           chromosome 9 Contains the gene for a novel protein, the
           5' end of the PCSCL gene for likely ortholog of rat
           peroxisomal Ca-dependent solute carrier-like protein
           (KIAA1896), two novel genes and a CpG island, complete
           sequence.>gb:AL590708_1929838 Human DNA sequence from
           clone RP11-395P17 on chromosome 9 Contains the PCSCL
           gene for likely ortholog of rat peroxisomal Ca-dependent
           solute carrier-like protein (KIAA1896), the PTGES2 gene
           for prostaglandin E synthase 2 (GBF1, GBF-1, C9orf15,
           FLJ14038), the LCN2 gene for lipocalin 2 (oncogene 24p3)
           (NGAL), the C9orf16 gene for chromosome 9 open reading
           frame 16 (MGC4639, EST00098, FLJ12823), the CIZ1 gene
           for Cip1-interacting zinc finger protein (LSFR1), the
           DNM1 gene for dynamin 1 (DNM), the GOLGA2 gene for golgi
           autoantigen, golgin subfamily a, 2 (GM130, MGC20672),
           the gene for a novel protein and seven CpG islands,
           complete sequence.
          Length = 501

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 41/133 (30%), Positives = 58/133 (43%), Gaps = 2/133 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVH       +N  G  IVG   Q+ +  G R ++RG    VL + P
Sbjct: 234 TCTAPLDRLKVLMQVHA----SRSNNMG--IVGGFTQMIREGGARSLWRGNGINVLKIAP 287

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTR--LQTQ 833
             A+ F  YEQ+K  + SD E   L I                   P+ V+KTR  L+  
Sbjct: 288 ESAIKFMAYEQIKRLVGSDQE--TLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKT 345

Query: 834 GMRAGVVGVHYRL 872
           G  +G++    R+
Sbjct: 346 GQYSGMLDCARRI 358



 Score = 42.0 bits (97), Expect = 0.024
 Identities = 21/73 (28%), Positives = 41/73 (56%), Gaps = 4/73 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    + G P++  +++         + I + EG  G+YRGL+P  + ++P
Sbjct: 429 PLALVRTRMQAQASIEGAPEVTMSSL--------FKHILRTEGAFGLYRGLAPNFMKVIP 480

Query: 660 NWAVYFTIYEQLK 698
             ++ + +YE LK
Sbjct: 481 AVSISYVVYENLK 493



 Score = 38.1 bits (87), Expect = 0.34
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           + P++V+KTR     L K G      S ++    +I  REG+   Y+G  P +L ++P  
Sbjct: 330 IYPMEVLKTRM---ALRKTGQY----SGMLDCARRILAREGVAAFYKGYVPNMLGIIPYA 382

Query: 666 AVYFTIYEQLKS 701
            +   +YE LK+
Sbjct: 383 GIDLAVYETLKN 394



>gb:AL360268_1926109 Human DNA sequence from clone RP11-379C10 on
           chromosome 9 Contains the gene for a novel protein, the
           5' end of the PCSCL gene for likely ortholog of rat
           peroxisomal Ca-dependent solute carrier-like protein
           (KIAA1896), two novel genes and a CpG island, complete
           sequence.>gb:AL590708_1929837 Human DNA sequence from
           clone RP11-395P17 on chromosome 9 Contains the PCSCL
           gene for likely ortholog of rat peroxisomal Ca-dependent
           solute carrier-like protein (KIAA1896), the PTGES2 gene
           for prostaglandin E synthase 2 (GBF1, GBF-1, C9orf15,
           FLJ14038), the LCN2 gene for lipocalin 2 (oncogene 24p3)
           (NGAL), the C9orf16 gene for chromosome 9 open reading
           frame 16 (MGC4639, EST00098, FLJ12823), the CIZ1 gene
           for Cip1-interacting zinc finger protein (LSFR1), the
           DNM1 gene for dynamin 1 (DNM), the GOLGA2 gene for golgi
           autoantigen, golgin subfamily a, 2 (GM130, MGC20672),
           the gene for a novel protein and seven CpG islands,
           complete sequence.
          Length = 515

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 41/133 (30%), Positives = 58/133 (43%), Gaps = 2/133 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVH       +N  G  IVG   Q+ +  G R ++RG    VL + P
Sbjct: 248 TCTAPLDRLKVLMQVHA----SRSNNMG--IVGGFTQMIREGGARSLWRGNGINVLKIAP 301

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTR--LQTQ 833
             A+ F  YEQ+K  + SD E   L I                   P+ V+KTR  L+  
Sbjct: 302 ESAIKFMAYEQIKRLVGSDQE--TLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKT 359

Query: 834 GMRAGVVGVHYRL 872
           G  +G++    R+
Sbjct: 360 GQYSGMLDCARRI 372



 Score = 42.0 bits (97), Expect = 0.024
 Identities = 21/73 (28%), Positives = 41/73 (56%), Gaps = 4/73 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    + G P++  +++         + I + EG  G+YRGL+P  + ++P
Sbjct: 443 PLALVRTRMQAQASIEGAPEVTMSSL--------FKHILRTEGAFGLYRGLAPNFMKVIP 494

Query: 660 NWAVYFTIYEQLK 698
             ++ + +YE LK
Sbjct: 495 AVSISYVVYENLK 507



 Score = 38.1 bits (87), Expect = 0.34
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           + P++V+KTR     L K G      S ++    +I  REG+   Y+G  P +L ++P  
Sbjct: 344 IYPMEVLKTRM---ALRKTGQY----SGMLDCARRILAREGVAAFYKGYVPNMLGIIPYA 396

Query: 666 AVYFTIYEQLKS 701
            +   +YE LK+
Sbjct: 397 GIDLAVYETLKN 408



>gb:AJ619992_1907010 Homo sapiens mRNA for small calcium-binding
           mitochondrial carrier 2, isoform d (SCAMC-2 gene).
          Length = 366

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 41/133 (30%), Positives = 58/133 (43%), Gaps = 2/133 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVH       +N  G  IVG   Q+ +  G R ++RG    VL + P
Sbjct: 99  TCTAPLDRLKVLMQVHA----SRSNNMG--IVGGFTQMIREGGARSLWRGNGINVLKIAP 152

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTR--LQTQ 833
             A+ F  YEQ+K  + SD E   L I                   P+ V+KTR  L+  
Sbjct: 153 ESAIKFMAYEQIKRLVGSDQE--TLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKT 210

Query: 834 GMRAGVVGVHYRL 872
           G  +G++    R+
Sbjct: 211 GQYSGMLDCARRI 223



 Score = 42.0 bits (97), Expect = 0.024
 Identities = 21/73 (28%), Positives = 41/73 (56%), Gaps = 4/73 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    + G P++  +++         + I + EG  G+YRGL+P  + ++P
Sbjct: 294 PLALVRTRMQAQASIEGAPEVTMSSL--------FKHILRTEGAFGLYRGLAPNFMKVIP 345

Query: 660 NWAVYFTIYEQLK 698
             ++ + +YE LK
Sbjct: 346 AVSISYVVYENLK 358



 Score = 38.1 bits (87), Expect = 0.34
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           + P++V+KTR     L K G      S ++    +I  REG+   Y+G  P +L ++P  
Sbjct: 195 IYPMEVLKTRM---ALRKTGQY----SGMLDCARRILAREGVAAFYKGYVPNMLGIIPYA 247

Query: 666 AVYFTIYEQLKS 701
            +   +YE LK+
Sbjct: 248 GIDLAVYETLKN 259



>gb:AJ619990_1907008 Homo sapiens mRNA for small calcium-binding
           mitochondrial carrier 2, isoform b (SCAMC-2 gene).
          Length = 503

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 41/133 (30%), Positives = 58/133 (43%), Gaps = 2/133 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVH       +N  G  IVG   Q+ +  G R ++RG    VL + P
Sbjct: 236 TCTAPLDRLKVLMQVHA----SRSNNMG--IVGGFTQMIREGGARSLWRGNGINVLKIAP 289

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTR--LQTQ 833
             A+ F  YEQ+K  + SD E   L I                   P+ V+KTR  L+  
Sbjct: 290 ESAIKFMAYEQIKRLVGSDQE--TLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKT 347

Query: 834 GMRAGVVGVHYRL 872
           G  +G++    R+
Sbjct: 348 GQYSGMLDCARRI 360



 Score = 42.0 bits (97), Expect = 0.024
 Identities = 21/73 (28%), Positives = 41/73 (56%), Gaps = 4/73 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    + G P++  +++         + I + EG  G+YRGL+P  + ++P
Sbjct: 431 PLALVRTRMQAQASIEGAPEVTMSSL--------FKHILRTEGAFGLYRGLAPNFMKVIP 482

Query: 660 NWAVYFTIYEQLK 698
             ++ + +YE LK
Sbjct: 483 AVSISYVVYENLK 495



 Score = 38.1 bits (87), Expect = 0.34
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           + P++V+KTR     L K G      S ++    +I  REG+   Y+G  P +L ++P  
Sbjct: 332 IYPMEVLKTRM---ALRKTGQY----SGMLDCARRILAREGVAAFYKGYVPNMLGIIPYA 384

Query: 666 AVYFTIYEQLKS 701
            +   +YE LK+
Sbjct: 385 GIDLAVYETLKN 396



>gb:AJ619989_1907007 Homo sapiens mRNA for small calcium-binding
           mitochondrial carrier 2, isoform a (SCAMC-2
           gene).>gb:AL360268_1926111 Human DNA sequence from clone
           RP11-379C10 on chromosome 9 Contains the gene for a
           novel protein, the 5' end of the PCSCL gene for likely
           ortholog of rat peroxisomal Ca-dependent solute
           carrier-like protein (KIAA1896), two novel genes and a
           CpG island, complete sequence.>gb:AL590708_1929839 Human
           DNA sequence from clone RP11-395P17 on chromosome 9
           Contains the PCSCL gene for likely ortholog of rat
           peroxisomal Ca-dependent solute carrier-like protein
           (KIAA1896), the PTGES2 gene for prostaglandin E synthase
           2 (GBF1, GBF-1, C9orf15, FLJ14038), the LCN2 gene for
           lipocalin 2 (oncogene 24p3) (NGAL), the C9orf16 gene for
           chromosome 9 open reading frame 16 (MGC4639, EST00098,
           FLJ12823), the CIZ1 gene for Cip1-interacting zinc
           finger protein (LSFR1), the DNM1 gene for dynamin 1
           (DNM), the GOLGA2 gene for golgi autoantigen, golgin
           subfamily a, 2 (GM130, MGC20672), the gene for a novel
           protein and seven CpG islands, complete
           sequence.>gb:BC089448_1990042 Homo sapiens solute
           carrier family 25 (mitochondrial carrier; phosphate
           carrier), member 25, transcript variant 1, mRNA (cDNA
           clone MGC:105138 IMAGE:30558551), complete cds.
          Length = 469

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 41/133 (30%), Positives = 58/133 (43%), Gaps = 2/133 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVH       +N  G  IVG   Q+ +  G R ++RG    VL + P
Sbjct: 202 TCTAPLDRLKVLMQVHA----SRSNNMG--IVGGFTQMIREGGARSLWRGNGINVLKIAP 255

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTR--LQTQ 833
             A+ F  YEQ+K  + SD E   L I                   P+ V+KTR  L+  
Sbjct: 256 ESAIKFMAYEQIKRLVGSDQE--TLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKT 313

Query: 834 GMRAGVVGVHYRL 872
           G  +G++    R+
Sbjct: 314 GQYSGMLDCARRI 326



 Score = 42.0 bits (97), Expect = 0.024
 Identities = 21/73 (28%), Positives = 41/73 (56%), Gaps = 4/73 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    + G P++  +++         + I + EG  G+YRGL+P  + ++P
Sbjct: 397 PLALVRTRMQAQASIEGAPEVTMSSL--------FKHILRTEGAFGLYRGLAPNFMKVIP 448

Query: 660 NWAVYFTIYEQLK 698
             ++ + +YE LK
Sbjct: 449 AVSISYVVYENLK 461



 Score = 38.1 bits (87), Expect = 0.34
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           + P++V+KTR     L K G      S ++    +I  REG+   Y+G  P +L ++P  
Sbjct: 298 IYPMEVLKTRM---ALRKTGQY----SGMLDCARRILAREGVAAFYKGYVPNMLGIIPYA 350

Query: 666 AVYFTIYEQLKS 701
            +   +YE LK+
Sbjct: 351 GIDLAVYETLKN 362



>gb:AJ619963_1907004 Homo sapiens partial mRNA for mitochondrial
           ATP-Mg/Pi carrier isoform 3, (SLC25A25
           gene).>gb:AJ619991_1907009 Homo sapiens mRNA for small
           calcium-binding mitochondrial carrier 2, isoform c
           (SCAMC-2 gene).
          Length = 489

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 41/133 (30%), Positives = 58/133 (43%), Gaps = 2/133 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVH       +N  G  IVG   Q+ +  G R ++RG    VL + P
Sbjct: 222 TCTAPLDRLKVLMQVHA----SRSNNMG--IVGGFTQMIREGGARSLWRGNGINVLKIAP 275

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTR--LQTQ 833
             A+ F  YEQ+K  + SD E   L I                   P+ V+KTR  L+  
Sbjct: 276 ESAIKFMAYEQIKRLVGSDQE--TLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKT 333

Query: 834 GMRAGVVGVHYRL 872
           G  +G++    R+
Sbjct: 334 GQYSGMLDCARRI 346



 Score = 42.0 bits (97), Expect = 0.024
 Identities = 21/73 (28%), Positives = 41/73 (56%), Gaps = 4/73 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    + G P++  +++         + I + EG  G+YRGL+P  + ++P
Sbjct: 417 PLALVRTRMQAQASIEGAPEVTMSSL--------FKHILRTEGAFGLYRGLAPNFMKVIP 468

Query: 660 NWAVYFTIYEQLK 698
             ++ + +YE LK
Sbjct: 469 AVSISYVVYENLK 481



 Score = 38.1 bits (87), Expect = 0.34
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           + P++V+KTR     L K G      S ++    +I  REG+   Y+G  P +L ++P  
Sbjct: 318 IYPMEVLKTRM---ALRKTGQY----SGMLDCARRILAREGVAAFYKGYVPNMLGIIPYA 370

Query: 666 AVYFTIYEQLKS 701
            +   +YE LK+
Sbjct: 371 GIDLAVYETLKN 382



>gb:AB067483_1870791 Homo sapiens mRNA for KIAA1896 protein, partial
           cds.
          Length = 568

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 41/133 (30%), Positives = 58/133 (43%), Gaps = 2/133 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVH       +N  G  IVG   Q+ +  G R ++RG    VL + P
Sbjct: 301 TCTAPLDRLKVLMQVHA----SRSNNMG--IVGGFTQMIREGGARSLWRGNGINVLKIAP 354

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTR--LQTQ 833
             A+ F  YEQ+K  + SD E   L I                   P+ V+KTR  L+  
Sbjct: 355 ESAIKFMAYEQIKRLVGSDQE--TLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKT 412

Query: 834 GMRAGVVGVHYRL 872
           G  +G++    R+
Sbjct: 413 GQYSGMLDCARRI 425



 Score = 42.0 bits (97), Expect = 0.024
 Identities = 21/73 (28%), Positives = 41/73 (56%), Gaps = 4/73 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    + G P++  +++         + I + EG  G+YRGL+P  + ++P
Sbjct: 496 PLALVRTRMQAQASIEGAPEVTMSSL--------FKHILRTEGAFGLYRGLAPNFMKVIP 547

Query: 660 NWAVYFTIYEQLK 698
             ++ + +YE LK
Sbjct: 548 AVSISYVVYENLK 560



 Score = 38.1 bits (87), Expect = 0.34
 Identities = 22/72 (30%), Positives = 37/72 (51%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           + P++V+KTR     L K G      S ++    +I  REG+   Y+G  P +L ++P  
Sbjct: 397 IYPMEVLKTRM---ALRKTGQY----SGMLDCARRILAREGVAAFYKGYVPNMLGIIPYA 449

Query: 666 AVYFTIYEQLKS 701
            +   +YE LK+
Sbjct: 450 GIDLAVYETLKN 461



>gb:AB007915_1864032 Homo sapiens mRNA for KIAA0446 protein, partial
           cds.
          Length = 351

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 40/135 (29%), Positives = 60/135 (44%), Gaps = 12/135 (8%)
 Frame = +3

Query: 513 RFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIY-- 686
           RFQV G P+ G   +        + QI Q +GLRG YRG   ++L  +PN AV++  Y  
Sbjct: 177 RFQVRGNPE-GQGVVAFGQTKDIIRQILQADGLRGFYRGYVASLLTYIPNSAVWWPFYHF 235

Query: 687 ----------EQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
                     EQL S+LC  +  H   I                  NP+ V++TR+Q +G
Sbjct: 236 YAAIVFPWIPEQL-SYLCPKECPH---IVFQAVSGPLAAATASILTNPMDVIRTRVQVEG 291

Query: 837 MRAGVVGVHYRL*EE 881
             + ++     + EE
Sbjct: 292 KNSIILTFRQLMAEE 306



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 24/69 (34%), Positives = 37/69 (53%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+DVI+TR QV G         + S+I+ +  Q+   EG  G+ +GLS  +++  P+  V
Sbjct: 279 PMDVIRTRVQVEG---------KNSIIL-TFRQLMAEEGPWGLMKGLSARIISATPSTIV 328

Query: 672 YFTIYEQLK 698
               YE LK
Sbjct: 329 IVVGYESLK 337



>gb:AP005003_1847110 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0495C02.
          Length = 426

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 33/119 (27%), Positives = 59/119 (49%), Gaps = 7/119 (5%)
 Frame = +3

Query: 492 PLDVIKTR--FQVHGLPKLGNTNIRGSL-----IVGSLEQIFQREGLRGMYRGLSPTVLA 650
           PLD+++T+  +QV G  KL     + S      I+  ++ I+++ GLRG+YRG++P++  
Sbjct: 207 PLDLVRTKLAYQVKGAVKLSLREYKPSEQVYKGILDCVKTIYRQNGLRGLYRGMAPSLYG 266

Query: 651 LLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
           + P   + F  YE +K+++    E H   I                   PL VV+ ++Q
Sbjct: 267 IFPYSGLKFYFYETMKTYV---PEEHRKDIIAKLACGSVAGLLGQTITYPLDVVRRQMQ 322



 Score = 38.9 bits (89), Expect = 0.20
 Identities = 24/91 (26%), Positives = 40/91 (43%)
 Frame = +3

Query: 561 GSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSI 740
           GS ++GS   I + EGL G YRG   +V  ++P  A+++  YE+ + ++       E   
Sbjct: 128 GSGLIGSFRTISRTEGLLGFYRGNGASVARIVPYAALHYMAYEEYRRWIILGFPNVEQGP 187

Query: 741 XXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
                              PL +V+T+L  Q
Sbjct: 188 ILDLVAGSIAGGTAVICTYPLDLVRTKLAYQ 218



>gb:AP003246_1826180 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0423A12.>gb:AP003266_1826738 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0492G09.
          Length = 336

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 31/80 (38%), Positives = 46/80 (57%), Gaps = 6/80 (7%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGL---PKLGNTNIRGSLIVG---SLEQIFQREGLRGMYRGLSPTVLAL 653
           PLDV+K RFQ+ GL   P+ G   I  S   G   +L++I  +EG  G+Y+GL P+++  
Sbjct: 253 PLDVVKKRFQIEGLKRHPRYG-ARIESSTYKGMYHALKEIVAKEGFGGLYKGLFPSLVKS 311

Query: 654 LPNWAVYFTIYEQLKSFLCS 713
            P  AV F  YE +  ++ S
Sbjct: 312 APAGAVTFVAYEYISDWIGS 331



 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 39/130 (30%), Positives = 57/130 (43%), Gaps = 11/130 (8%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSL--------IVGSLEQIFQREGLRGMYRGLS 635
           T   PLDVIK RFQV   P      +R  +        ++ + + I + EGL G +RG  
Sbjct: 29  TVTSPLDVIKIRFQVQLEPTTSWGVLRRDVYGPSKYTGLLQASKDILREEGLPGFWRGNV 88

Query: 636 PTVLALLPNWAVYFTIYEQLKSFL--CSDDERH-ELSIXXXXXXXXXXXXXXXXXXNPLW 806
           P +L  +P  A+ FT+  +LK+F    S  E H  LS                    P  
Sbjct: 89  PALLMYMPYTAIQFTVLHKLKTFASGSSKTEDHLHLSPYLSYVSGAIAGCAATVGSYPFD 148

Query: 807 VVKTRLQTQG 836
           +++T L +QG
Sbjct: 149 LLRTILASQG 158



 Score = 44.3 bits (103), Expect = 0.005
 Identities = 33/128 (25%), Positives = 55/128 (42%), Gaps = 11/128 (8%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P D+++T     G PK+   ++R + +      I +  G RG+Y GL+PT++ ++P   +
Sbjct: 146 PFDLLRTILASQGEPKV-YPDMRSAFL-----DIMKTRGFRGLYAGLTPTLVEIIPYAGL 199

Query: 672 YFTIYEQLK-----------SFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKT 818
            F  Y+  K           S L S  E   +S                   +PL VVK 
Sbjct: 200 QFGSYDTFKRSMMTWNRYRYSHLNSGSEDDSVSSFQLFLCGFAAGTFSKAACHPLDVVKK 259

Query: 819 RLQTQGMR 842
           R Q +G++
Sbjct: 260 RFQIEGLK 267



>gb:AP001080_1820751 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0499C11.>gb:AP001383_1821237
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 1, clone:P0453A06.
          Length = 381

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 33/118 (27%), Positives = 53/118 (44%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   Q H +  +G +  +G   + ++ +I + EGL+G ++G  P V+ ++P
Sbjct: 105 TITAPLDRVKLLMQTHSVRVVGESTKKGIGFLEAIAEIGKEEGLKGYWKGNLPQVIRIVP 164

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
             AV    YE  K F    D   EL++                   PL V++ RL  Q
Sbjct: 165 YSAVQLFSYEVYKKFFRRKD--GELTVFGRLAAGACAGMTSTLVTYPLDVLRLRLAVQ 220



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 24/85 (28%), Positives = 46/85 (54%), Gaps = 1/85 (1%)
 Frame = +3

Query: 480 TFVC-PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALL 656
           T +C PLD ++ + Q+ G P         + ++ ++  I +R+GL G+YRG  P  L  L
Sbjct: 294 TLMCYPLDTVRRQMQMKGSPY--------NTVLDAIPGIVERDGLIGLYRGFVPNALKNL 345

Query: 657 PNWAVYFTIYEQLKSFLCSDDERHE 731
           PN ++  T ++ +K+ + +  +  E
Sbjct: 346 PNSSIKLTAFDTVKTLISTGQKELE 370



>gb:AC150162_1745056 Solanum demissum chromosome 5 clone PGEC160O2
           map MAP_LOC, complete sequence.
          Length = 281

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 33/122 (27%), Positives = 56/122 (45%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   P+D+IKT+ Q+HG   + +  I    +V    +I + +G+ G+Y+GLSP ++  + 
Sbjct: 5   TVTFPVDLIKTKLQLHGESLVSSRRISAVRVVA---EILRNDGILGLYKGLSPAIIRHMF 61

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGM 839
              +    YE L++ L   D  H LS+                  +P  +VK R+Q    
Sbjct: 62  YTPIRIVNYEFLRNSLVPAD--HTLSLSSKAIIGGISGVIAQVVASPADLVKVRMQADSR 119

Query: 840 RA 845
            A
Sbjct: 120 MA 121



 Score = 43.5 bits (101), Expect = 0.008
 Identities = 26/73 (35%), Positives = 36/73 (49%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T  CP DVIKTR       K GN   R S     L +  + EGL+ +++G  PT   L P
Sbjct: 203 TLSCPADVIKTRMMNQAADKQGNCKYRNS--YDCLVKTVRVEGLKALWKGFFPTWARLGP 260

Query: 660 NWAVYFTIYEQLK 698
              V++  YE+ +
Sbjct: 261 WQFVFWASYEKFR 273



>gb:AC135208_1742064 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1364E02, complete
           sequence.>gb:AC139168_1743984 Oryza sativa (japonica
           cultivar-group) chromosome 3 clone OJA1364E02, complete
           sequence.
          Length = 333

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 29/83 (34%), Positives = 44/83 (53%), Gaps = 3/83 (3%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD+++ R Q+ G    G   +  + + G+   I + E LRG+YRG+ P    ++P
Sbjct: 253 TITFPLDLVRRRMQLEGAA--GRARVYQTGLFGTFGHIVRTESLRGLYRGILPEYCKVVP 310

Query: 660 NWAVYFTIYEQLKSF---LCSDD 719
           +  + F  YE LKS    L SDD
Sbjct: 311 SVGIVFMTYETLKSILTELASDD 333



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 31/115 (26%), Positives = 55/115 (47%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD+++TR       +      RG  I  +L  I + EG++G+Y+GL  T+L + P+ A+
Sbjct: 162 PLDLVRTRLAA----QTNTAYYRG--ISHALYAICRDEGVKGLYKGLGATLLGVGPSIAI 215

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
            F +YE L+S     +  ++  +                   PL +V+ R+Q +G
Sbjct: 216 SFCVYETLRSH-WQIERPYDSPVLISLACGSLSGIASSTITFPLDLVRRRMQLEG 269



>gb:AK032806_1163075 Mus musculus 12 days embryo male wolffian duct
           includes surrounding region cDNA, RIKEN full-length
           enriched library, clone:6720455K09 product:PEROXISOMAL
           CA-DEPENDENT SOLUTE CARRIER homolog [Oryctolagus
           cuniculus], full insert sequence.
          Length = 475

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 37/128 (28%), Positives = 52/128 (40%), Gaps = 2/128 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVHG   +         I G   Q+ +  G+R ++RG    V+ + P
Sbjct: 210 TSTAPLDRLKVMMQVHGSKSMN--------IFGGFRQMVKEGGIRSLWRGNGTNVIKIAP 261

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQT--Q 833
             AV F  YEQ K  L   +E  +L                     P+ V+KTRL     
Sbjct: 262 ETAVKFWAYEQYKKLL--TEEGQKLGTFERFISGSMAGATAQTFIYPMEVLKTRLAVAKT 319

Query: 834 GMRAGVVG 857
           G  +G+ G
Sbjct: 320 GQYSGIYG 327



 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 37/138 (26%), Positives = 62/138 (44%), Gaps = 7/138 (5%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           TF+ P++V+KTR  V    K G      S I G  ++I + EG    Y+G  P +L ++P
Sbjct: 302 TFIYPMEVLKTRLAV---AKTGQY----SGIYGCAKKILKHEGFGAFYKGYIPNLLGIIP 354

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELS--IXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
              +   +YE LKS+   +  +  ++  +                   PL +V+TR+Q Q
Sbjct: 355 YAGIDLAVYELLKSYWLDNFAKDSVNPGVMVLLSCGALSSTCGQLASYPLALVRTRMQAQ 414

Query: 834 GMRAG-----VVGVHYRL 872
               G     +VG+  R+
Sbjct: 415 ATVEGAPQLSMVGLFQRI 432



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 25/76 (32%), Positives = 43/76 (56%), Gaps = 4/76 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    V G P+L         +VG  ++I  +EG+ G+YRG++P  + +LP
Sbjct: 403 PLALVRTRMQAQATVEGAPQLS--------MVGLFQRIVSKEGVSGLYRGITPNFMKVLP 454

Query: 660 NWAVYFTIYEQLKSFL 707
              + + +YE +K  L
Sbjct: 455 AVGISYVVYENMKQTL 470



>gb:BC056033_2551616 Xenopus laevis hypothetical protein MGC68982,
           mRNA (cDNA clone MGC:68982 IMAGE:4962716), complete cds.
          Length = 473

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 36/115 (31%), Positives = 51/115 (44%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVHG    GN+NI     +  L+Q+ +  G+R ++RG    V+ + P
Sbjct: 210 TGTAPLDRLKVMMQVHG--SKGNSNI-----ITGLKQMVKEGGIRSLWRGNGVNVIKIAP 262

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRL 824
             A+ F  YEQ K    S  E  +L                     P+ V+KTRL
Sbjct: 263 ETAMKFWAYEQYKKLFTS--ESGKLGTAERFVAGSLAGATAQTSIYPMEVLKTRL 315



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 32/125 (25%), Positives = 57/125 (45%), Gaps = 2/125 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T + P++V+KTR  V      G T  + S +    ++I Q+EG+R  Y+G  P +L ++P
Sbjct: 303 TSIYPMEVLKTRLAV------GRTG-QYSGMFDCAKKIMQKEGIRAFYKGYIPNILGIIP 355

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELS--IXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
              +   IYE LK++   +  +   +  +                   PL +++TR+Q Q
Sbjct: 356 YAGIDLAIYETLKNYWLQNHAKDSANPGVLVLLGCGTASSTCGQLASYPLALIRTRMQAQ 415

Query: 834 GMRAG 848
               G
Sbjct: 416 ASIEG 420



 Score = 45.1 bits (105), Expect = 0.003
 Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 4/73 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +I+TR Q    + G P+L         + G   +I  +EG  G+YRG+ P  L +LP
Sbjct: 404 PLALIRTRMQAQASIEGAPQLN--------MGGLFRKIVAKEGFLGLYRGIGPNFLKVLP 455

Query: 660 NWAVYFTIYEQLK 698
             ++ + +YE++K
Sbjct: 456 AVSISYVVYEKMK 468



>gb:AE016820_1749644 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VII, complete sequence.
          Length = 362

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 37/126 (29%), Positives = 52/126 (41%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD IK R Q++     G T   G L  G+   I+  EGL   Y+GL   V+ ++P  A+
Sbjct: 77  PLDTIKVRMQIYRRANEG-TKPPGFLRTGA--NIYSGEGLLAFYKGLGAVVIGIIPKMAI 133

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMRAGV 851
            F+ YE  ++ L         +                   NP+ VVK RLQ Q +    
Sbjct: 134 RFSSYEFYRTLLADRQTGVVSTGNTFLAGVGAGVTEAVLVVNPMEVVKIRLQAQHLHGAA 193

Query: 852 VGVHYR 869
               YR
Sbjct: 194 EQQKYR 199



 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 27/72 (37%), Positives = 41/72 (56%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD IKTR Q     +  +  +R + I     Q+ Q EG R +Y+G++P V+ + P  AV
Sbjct: 277 PLDTIKTRLQKDKSTRNLSNWVRITTIG---RQLVQEEGFRALYKGITPRVMRVAPGQAV 333

Query: 672 YFTIYEQLKSFL 707
            FT+YE ++  L
Sbjct: 334 TFTVYEFVRRHL 345



 Score = 37.0 bits (84), Expect = 0.77
 Identities = 32/117 (27%), Positives = 46/117 (39%), Gaps = 3/117 (2%)
 Frame = +3

Query: 486 VCPLDVIKTRFQ---VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALL 656
           V P++V+K R Q   +HG  +      R ++    L  I + EG+  +YRG+S T     
Sbjct: 174 VNPMEVVKIRLQAQHLHGAAE--QQKYRNAIQAAYL--IVKEEGIGALYRGVSLTAARQA 229

Query: 657 PNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
            N    FT+Y +L   L        L                     PL  +KTRLQ
Sbjct: 230 TNQGANFTVYSKLMERLQEYHGSQNLPSWETSLIGLVSGAIGPFSNAPLDTIKTRLQ 286



>gb:SCACR1PRA_1706453 S.cerevisiae ACR1-protein gene, complete CDS.
          Length = 321

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 31/114 (27%), Positives = 53/114 (46%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD IK R Q++     G  +++    + +   I+Q+EG   +Y+GL   V+ ++P  A+
Sbjct: 30  PLDTIKVRMQIYRRVA-GIEHVKPPGFIKTGRTIYQKEGFLALYKGLGAVVIGIIPKMAI 88

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
            F+ YE  ++ L + +     +                   NP+ VVK RLQ Q
Sbjct: 89  RFSSYEFYRTLLVNKESGIVSTGNTFVAGVGAGITEAVLVVNPMEVVKIRLQAQ 142



 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 26/70 (37%), Positives = 41/70 (58%), Gaps = 1/70 (1%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGN-TNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA 668
           PLD IKTR Q      L   + ++  + +G+  Q+ + EG R +Y+G++P V+ + P  A
Sbjct: 234 PLDTIKTRLQKDKSISLEKQSGMKKIITIGA--QLLKEEGFRALYKGITPRVMRVAPGQA 291

Query: 669 VYFTIYEQLK 698
           V FT+YE  K
Sbjct: 292 VTFTVYEYRK 301



 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 33/115 (28%), Positives = 49/115 (42%), Gaps = 1/115 (0%)
 Frame = +3

Query: 486 VCPLDVIKTRFQV-HGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           V P++V+K R Q  H  P   N   + +  + +   I + EG+  +YRG+S T      N
Sbjct: 129 VNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATN 188

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
               FT+Y +LK FL +  +   L                     PL  +KTRLQ
Sbjct: 189 QGANFTVYSKLKEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQ 243



>gb:CR380956_1652054 Candida glabrata strain CBS138 chromosome J
           complete sequence.
          Length = 327

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 43/142 (30%), Positives = 64/142 (45%), Gaps = 17/142 (11%)
 Frame = +3

Query: 492 PLDVIKTRFQVH--GLPKLGNTNIRGSLIVGS------LEQIFQREG-LRGMYRGLSPTV 644
           PLD+++TR  V    L KL  +  R S I         L + +  EG + G+YRG+ PT 
Sbjct: 143 PLDLVRTRLSVQTANLSKLSKS--RASDIAKPPGVWKLLSKAYAEEGGIMGLYRGVWPTS 200

Query: 645 LALLPNWAVYFTIYEQLKSFLCSD--------DERHELSIXXXXXXXXXXXXXXXXXXNP 800
           L ++P  A+ F +YEQLK F+ SD        D  ++LS+                   P
Sbjct: 201 LGIVPYVALNFAVYEQLKEFMPSDENGNSSMRDSLYKLSMGAISGGVAQTITY------P 254

Query: 801 LWVVKTRLQTQGMRAGVVGVHY 866
             +++ R Q   M    +G HY
Sbjct: 255 FDLLRRRFQVLAMGGNELGFHY 276



 Score = 38.5 bits (88), Expect = 0.26
 Identities = 23/71 (32%), Positives = 39/71 (54%), Gaps = 1/71 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNT-NIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALL 656
           T   P D+++ RFQV  L   GN      + +  +L  I + EG +G Y+GL+  +  ++
Sbjct: 250 TITYPFDLLRRRFQV--LAMGGNELGFHYNSVWDALVTIGKTEGFKGYYKGLTANLFKVV 307

Query: 657 PNWAVYFTIYE 689
           P+ AV + +YE
Sbjct: 308 PSTAVSWLVYE 318



>gb:BT020902_1436260 Bos taurus solute carrier family 25
           (mitochondrial oxodicarboxylate carrier), member 21
           (SLC25A21), mRNA, complete cds.
          Length = 244

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 30/72 (41%), Positives = 39/72 (54%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLDV+KTRFQ+       N+      +  S   IF+ EGL G Y+G+ P +LA  P  AV
Sbjct: 33  PLDVVKTRFQIQRCTTDPNSY---KSLGDSFRMIFRTEGLFGFYKGILPPILAETPKRAV 89

Query: 672 YFTIYEQLKSFL 707
            F  +EQ K  L
Sbjct: 90  KFFTFEQYKKLL 101



 Score = 40.8 bits (94), Expect = 0.053
 Identities = 23/72 (31%), Positives = 37/72 (51%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P DV K+R Q    P+     I+      ++  ++Q EG+  +Y+GL P ++ L P  AV
Sbjct: 172 PFDVAKSRIQG---PQPVPGEIKYKTCFKTMATVYQEEGILALYKGLLPKIMRLGPGGAV 228

Query: 672 YFTIYEQLKSFL 707
              +YE   S+L
Sbjct: 229 MLLVYEYTYSWL 240



>gb:AC116925_1206488 Dictyostelium discoideum chromosome 2 map
           4189423-4228998 strain AX4, complete
           sequence.>gb:AY392437_1325143 Dictyostelium discoideum
           carrier protein RIM and asparaginase genes, complete
           cds.
          Length = 338

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 28/97 (28%), Positives = 42/97 (43%), Gaps = 4/97 (4%)
 Frame = +3

Query: 573 VGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDD----ERHELSI 740
           +   + I + EG +G Y+G+SPT+L    NW VYF+IY     +  S D    +    + 
Sbjct: 96  IAMAKSILRNEGFKGFYQGVSPTILGNAVNWGVYFSIYRATNHWWNSTDINGNQYQGPAW 155

Query: 741 XXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMRAGV 851
                             NP WV+K RL T    +G+
Sbjct: 156 VGHSVSAITAGVITTAIVNPFWVLKIRLATSKKYSGM 192



>gb:CR859982_1184078 Pongo pygmaeus mRNA; cDNA DKFZp459L1427 (from
           clone DKFZp459L1427).
          Length = 314

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 35/126 (27%), Positives = 56/126 (44%), Gaps = 3/126 (2%)
 Frame = +3

Query: 513 RFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN---WAVYFTI 683
           RFQV G P+ G   +        + QI + +GLRG YRG   ++L  +PN   W  ++  
Sbjct: 148 RFQVRGNPE-GQGVVAFGQTKDIIRQILRADGLRGFYRGYVASLLTYIPNSAVWWPFYHF 206

Query: 684 YEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMRAGVVGVH 863
           Y    S+LC  +  H   I                  NP+ V++TR+Q +G  + ++   
Sbjct: 207 YAGQLSYLCPKECPH---IVFQAVSGPLAAATASILTNPMDVIRTRVQVEGKNSIILTFR 263

Query: 864 YRL*EE 881
             + EE
Sbjct: 264 QLMAEE 269



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 24/69 (34%), Positives = 37/69 (53%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+DVI+TR QV G         + S+I+ +  Q+   EG  G+ +GLS  +++  P+  V
Sbjct: 242 PMDVIRTRVQVEG---------KNSIIL-TFRQLMAEEGPWGLMKGLSARIISATPSTIV 291

Query: 672 YFTIYEQLK 698
               YE LK
Sbjct: 292 IVVGYESLK 300



>sp|P33303|SFC1_YEAST Succinate/fumarate mitochondrial transporter
           (Regulator of acetyl-CoA synthetase
           activity).>pir|S57116|S57116 probable carrier protein
           ACR1 - yeast (Saccharomyces
           cerevisiae)>gb:AY692924_1622971 Saccharomyces cerevisiae
           clone FLH158262.01X YJR095W gene, complete
           cds.>gb:SCYJR095W_1712893 S.cerevisiae chromosome X
           reading frame ORF YJR095w.
          Length = 322

 Score = 52.0 bits (123), Expect = 2e-05
 Identities = 31/114 (27%), Positives = 53/114 (46%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD IK R Q++     G  +++    + +   I+Q+EG   +Y+GL   V+ ++P  A+
Sbjct: 30  PLDTIKVRMQIYRRVA-GIEHVKPPGFIKTGRTIYQKEGFLALYKGLGAVVIGIIPKMAI 88

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
            F+ YE  ++ L + +     +                   NP+ VVK RLQ Q
Sbjct: 89  RFSSYEFYRTLLVNKESGIVSTGNTFVAGVGAGITEAVLVVNPMEVVKIRLQAQ 142



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 26/73 (35%), Positives = 43/73 (58%), Gaps = 1/73 (1%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGN-TNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA 668
           PLD IKTR Q      L   + ++  + +G+  Q+ + EG R +Y+G++P V+ + P  A
Sbjct: 234 PLDTIKTRLQKDKSISLEKQSGMKKIITIGA--QLLKEEGFRALYKGITPRVMRVAPGQA 291

Query: 669 VYFTIYEQLKSFL 707
           V FT+YE ++  L
Sbjct: 292 VTFTVYEYVREHL 304



 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 33/115 (28%), Positives = 49/115 (42%), Gaps = 1/115 (0%)
 Frame = +3

Query: 486 VCPLDVIKTRFQV-HGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           V P++V+K R Q  H  P   N   + +  + +   I + EG+  +YRG+S T      N
Sbjct: 129 VNPMEVVKIRLQAQHLTPSEPNAGPKYNNAIHAAYTIVKEEGVSALYRGVSLTAARQATN 188

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
               FT+Y +LK FL +  +   L                     PL  +KTRLQ
Sbjct: 189 QGANFTVYSKLKEFLQNYHQMDVLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQ 243



>gb:BC084172_2563563 Xenopus tropicalis hypothetical LOC496457, mRNA
           (cDNA clone MGC:79557 IMAGE:6978438), complete cds.
          Length = 473

 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 36/115 (31%), Positives = 50/115 (43%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVHG    GN NI     +  L+Q+ +  G+R ++RG    V+ + P
Sbjct: 210 TGTAPLDRLKVMMQVHG--SKGNANI-----ITGLKQMVKEGGIRSLWRGNGVNVIKIAP 262

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRL 824
             A+ F  YEQ K    S  E  +L                     P+ V+KTRL
Sbjct: 263 ETAMKFWAYEQYKKLFTS--ESGKLGTAERFIAGSLAGATAQTSIYPMEVLKTRL 315



 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 34/125 (27%), Positives = 56/125 (44%), Gaps = 2/125 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T + P++V+KTR  V      G T  + S +    ++I QREG+R  Y+G  P +L ++P
Sbjct: 303 TSIYPMEVLKTRLAV------GKTG-QYSGMFDCAKKIMQREGVRAFYKGYIPNILGIIP 355

Query: 660 NWAVYFTIYEQLKSFLCSD--DERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
              +   IYE LK+F   +   +     +                   PL +++TR+Q Q
Sbjct: 356 YAGIDLAIYETLKTFWLQNYATDSANPGVLVLLGCGTASSTCGQLASYPLALIRTRMQAQ 415

Query: 834 GMRAG 848
               G
Sbjct: 416 ASIEG 420



 Score = 45.1 bits (105), Expect = 0.003
 Identities = 24/73 (32%), Positives = 41/73 (56%), Gaps = 4/73 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +I+TR Q    + G P+L         + G   +I  +EG  G+YRG++P  L +LP
Sbjct: 404 PLALIRTRMQAQASIEGAPQLN--------MGGLFRKIVAKEGFFGLYRGIAPNFLKVLP 455

Query: 660 NWAVYFTIYEQLK 698
             ++ + +YE++K
Sbjct: 456 AVSISYVVYEKMK 468



>gb:BC043993_2548403 Xenopus laevis hypothetical protein LOC398474,
           mRNA (cDNA clone IMAGE:5570594), partial cds.
          Length = 535

 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 36/115 (31%), Positives = 51/115 (44%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVHG    GN+NI     +  L+Q+ +  G+R ++RG    V+ + P
Sbjct: 272 TGTAPLDRLKVMMQVHGTK--GNSNI-----ITGLKQMVKEGGVRSLWRGNGVNVIKIAP 324

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRL 824
             A+ F  YEQ K    S  E  +L                     P+ V+KTRL
Sbjct: 325 ETAMKFWAYEQYKKLFTS--ESGKLGTAERFIAGSLAGATAQTSIYPMEVLKTRL 377



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 31/125 (24%), Positives = 56/125 (44%), Gaps = 2/125 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T + P++V+KTR  V      G T  + S +    ++I Q+EG+   Y+G  P +L ++P
Sbjct: 365 TSIYPMEVLKTRLAV------GKTG-QYSGMFDCAKKIMQKEGILAFYKGYIPNILGIIP 417

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELS--IXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
              +   IYE LK++   +  +   +  +                   PL +++TR+Q Q
Sbjct: 418 YAGIDLAIYETLKNYWLQNYAKDSANPGVLVLLGCGTVSSTCGQLASYPLALIRTRMQAQ 477

Query: 834 GMRAG 848
               G
Sbjct: 478 ASIEG 482



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 23/73 (31%), Positives = 40/73 (54%), Gaps = 4/73 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +I+TR Q    + G P+L         + G   +I  +EG  G+Y G++P  L +LP
Sbjct: 466 PLALIRTRMQAQASIEGAPQLN--------MGGLFRKIVAKEGFFGLYTGIAPNFLKVLP 517

Query: 660 NWAVYFTIYEQLK 698
             ++ + +YE++K
Sbjct: 518 AVSISYVVYEKMK 530



>pir|T50686|T50686 peroxisomal Ca-dependent solute carrier
           [imported] - rabbit>gb:AF004161_1411234 Oryctolagus
           cuniculus peroxisomal Ca-dependent solute carrier mRNA,
           complete cds.
          Length = 475

 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 33/115 (28%), Positives = 48/115 (41%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVHG   +         I G   Q+ +  G+R ++RG    V+ + P
Sbjct: 210 TSTAPLDRLKVMMQVHGSKSMN--------IFGGFRQMIKEGGVRSLWRGNGTNVIKIAP 261

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRL 824
             AV F +YEQ K  L   +E  ++                     P+ V+KTRL
Sbjct: 262 ETAVKFWVYEQYKKLL--TEEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRL 314



 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 25/76 (32%), Positives = 42/76 (55%), Gaps = 4/76 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    + G P+L         +VG   +I  +EGL G+YRG++P  + +LP
Sbjct: 403 PLALVRTRMQAQAMLEGAPQLN--------MVGLFRRIISKEGLPGLYRGITPNFMKVLP 454

Query: 660 NWAVYFTIYEQLKSFL 707
              + + +YE +K  L
Sbjct: 455 AVGISYVVYENMKQTL 470



 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 34/125 (27%), Positives = 56/125 (44%), Gaps = 2/125 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           TF+ P++V+KTR  V      G T  + S I    ++I + EG    Y+G  P +L ++P
Sbjct: 302 TFIYPMEVMKTRLAV------GKTG-QYSGIYDCAKKILKYEGFGAFYKGYVPNLLGIIP 354

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELS--IXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
              +   +YE LKS    +  +  ++  +                   PL +V+TR+Q Q
Sbjct: 355 YAGIDLAVYELLKSHWLDNFAKDSVNPGVLVLLGCGALSSTCGQLASYPLALVRTRMQAQ 414

Query: 834 GMRAG 848
            M  G
Sbjct: 415 AMLEG 419



>pir|T39385|T39385 probable mitochondrial carrier protein - fission
           yeast  (Schizosaccharomyces pombe)
          Length = 500

 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 3/82 (3%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQ---REGLRGMYRGLSPTVLA 650
           T V PL+VI+TR Q  G      T+   +   G ++  ++    EG RG+Y+GLSP +L 
Sbjct: 351 TIVFPLNVIRTRLQTQG------TSAHPATYDGFIDCFYKTTKNEGFRGLYKGLSPNLLK 404

Query: 651 LLPNWAVYFTIYEQLKSFLCSD 716
           + P+ A+ + +YE  K +L  D
Sbjct: 405 VAPSVAISYLVYENCKKWLGLD 426



 Score = 46.6 bits (109), Expect = 0.001
 Identities = 36/129 (27%), Positives = 58/129 (44%), Gaps = 8/129 (6%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           F+ P+D +K R Q   L +  +     S+I+ + +++++  G+RG YRG+   +L + P 
Sbjct: 245 FIYPVDTLKFRIQCSDLSRGQHGK---SIILSNAKELYKSVGIRGYYRGVLVGILGMFPY 301

Query: 663 WAVYFTIYEQLK----SFLCS----DDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKT 818
            A     +E LK      L S    D +  +L                     PL V++T
Sbjct: 302 SATDLGTFEGLKRTWIGILASRDNVDPQDVKLPNGLVMAFGALSGSTGATIVFPLNVIRT 361

Query: 819 RLQTQGMRA 845
           RLQTQG  A
Sbjct: 362 RLQTQGTSA 370



>pir|T47703|T47703 Ca-dependent solute carrier-like protein -
           Arabidopsis thaliana>gb:ATF1I16_1549357 Arabidopsis
           thaliana DNA chromosome 3, BAC clone
           F1I16.>gb:AY063072_1565649 Arabidopsis thaliana putative
           Ca-dependent solute carrier protein (At3g55640) mRNA,
           complete cds.>gb:AF370255_1792140 Arabidopsis thaliana
           putative Ca-dependent solute carrier protein (At3g55640)
           mRNA, complete cds.
          Length = 332

 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 26/75 (34%), Positives = 44/75 (58%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD+++ R Q+ G+   G   +  + ++G+L++I Q EG RG+YRG+ P    ++P
Sbjct: 252 TATFPLDLVRRRKQLEGIG--GRAVVYKTGLLGTLKRIVQTEGARGLYRGILPEYYKVVP 309

Query: 660 NWAVYFTIYEQLKSF 704
              + F  YE LK +
Sbjct: 310 GVGICFMTYETLKLY 324



 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 33/116 (28%), Positives = 54/116 (46%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD+++TR             I  S I  +L  I   EG+ G+Y+GL  T++ + P+ A+
Sbjct: 161 PLDLVRTRLAAQ------TKVIYYSGIWHTLRSITTDEGILGLYKGLGTTLVGVGPSIAI 214

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGM 839
            F++YE L+S+  S    H+  I                   PL +V+ R Q +G+
Sbjct: 215 SFSVYESLRSYWRS-TRPHDSPIMVSLACGSLSGIASSTATFPLDLVRRRKQLEGI 269



 Score = 38.5 bits (88), Expect(2) = 0.064
 Identities = 35/127 (27%), Positives = 51/127 (40%), Gaps = 9/127 (7%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTN---IRGSLIVGSLEQIFQREGLRGMYRGLSPTVLA 650
           T   PL  +   FQV G+    +TN   +R   I+    +I   EGL+  ++G   T+  
Sbjct: 50  TCTAPLSRLTILFQVQGM----HTNAAALRKPSILHEASRILNEEGLKAFWKGNLVTIAH 105

Query: 651 LLPNWAVYFTIYEQLKSF--LCSDDERHELSIXX----XXXXXXXXXXXXXXXXNPLWVV 812
            LP  +V F  YE  K F  + +  E H+  I                       PL +V
Sbjct: 106 RLPYSSVNFYAYEHYKKFMYMVTGMENHKEGISSNLFVHFVAGGLAGITAASATYPLDLV 165

Query: 813 KTRLQTQ 833
           +TRL  Q
Sbjct: 166 RTRLAAQ 172



 Score = 21.2 bits (43), Expect(2) = 0.064
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = +2

Query: 857 GTLSALRRIAREKGILGLF 913
           G    LR I  ++GILGL+
Sbjct: 180 GIWHTLRSITTDEGILGLY 198



>pir|T01729|T01729 mitochondrial solute carrier protein homolog -
           Arabidopsis thaliana>gb:ATCHRIV3_1544796 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           3.>gb:AY056343_1563653 Arabidopsis thaliana putative
           carrier protein (At4g01100) mRNA, complete
           cds.>gb:IG002N01_1683051 Arabidopsis thaliana BAC
           IG002N01.>gb:AF360168_1791124 Arabidopsis thaliana
           putative carrier protein (At4g01100) mRNA, complete
           cds.>gb:AF412085_1797338 Arabidopsis thaliana
           AT4g01100/F2N1_16 mRNA, complete cds.
          Length = 352

 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 31/122 (25%), Positives = 59/122 (48%), Gaps = 5/122 (4%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+D+++ R  V    +  N+  +   I  +L  + + EG R +YRG  P+V+ ++P   +
Sbjct: 161 PMDMVRGRLTV----QTANSPYQYRGIAHALATVLREEGPRALYRGWLPSVIGVVPYVGL 216

Query: 672 YFTIYEQLKSFLCSDD-----ERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
            F++YE LK +L  ++     E +EL++                   PL V++ R+Q  G
Sbjct: 217 NFSVYESLKDWLVKENPYGLVENNELTVVTRLTCGAIAGTVGQTIAYPLDVIRRRMQMVG 276

Query: 837 MR 842
            +
Sbjct: 277 WK 278



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 27/71 (38%), Positives = 38/71 (53%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T V PL+ +K   QV         NI+ S  V  L+ I++ EGLRG+++G       ++P
Sbjct: 54  TAVAPLERMKILLQVQN-----PHNIKYSGTVQGLKHIWRTEGLRGLFKGNGTNCARIVP 108

Query: 660 NWAVYFTIYEQ 692
           N AV F  YEQ
Sbjct: 109 NSAVKFFSYEQ 119



 Score = 40.0 bits (92), Expect = 0.090
 Identities = 26/85 (30%), Positives = 40/85 (47%), Gaps = 9/85 (10%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKL-----GNTNIRGSL----IVGSLEQIFQREGLRGMYRGL 632
           T   PLDVI+ R Q+ G         G      SL    +V +  +  + EG   +Y+GL
Sbjct: 260 TIAYPLDVIRRRMQMVGWKDASAIVTGEGRSTASLEYTGMVDAFRKTVRHEGFGALYKGL 319

Query: 633 SPTVLALLPNWAVYFTIYEQLKSFL 707
            P  + ++P+ A+ F  YE +K  L
Sbjct: 320 VPNSVKVVPSIAIAFVTYEMVKDVL 344



>pir|D84798|D84798 probable mitochondrial carrier protein [imported]
           - Arabidopsis thaliana>gb:AC007661_1536101 Arabidopsis
           thaliana chromosome II section 205 of 255 of the
           complete sequence. Sequence from clones F13M22, T8P21,
           F16M14.
          Length = 348

 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 24/74 (32%), Positives = 41/74 (55%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD+++ R QV G    G   +  + + G+ + IF+ EG +G+YRG+ P    ++P   +
Sbjct: 274 PLDLVRRRMQVEGAG--GRARVYNTGLFGTFKHIFKSEGFKGIYRGILPEYYKVVPGVGI 331

Query: 672 YFTIYEQLKSFLCS 713
            F  Y+ L+  L S
Sbjct: 332 VFMTYDALRRLLTS 345



 Score = 42.0 bits (97), Expect = 0.024
 Identities = 24/79 (30%), Positives = 39/79 (49%), Gaps = 4/79 (5%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQ----REGLRGMYRGLSPTVL 647
           T   PLD+++TR              R ++    +E  F+     EG+ G+Y+GL  T+L
Sbjct: 164 TATYPLDLVRTRLAAQ----------RNAIYYQGIEHTFRTICREEGILGLYKGLGATLL 213

Query: 648 ALLPNWAVYFTIYEQLKSF 704
            + P+ A+ F  YE +K F
Sbjct: 214 GVGPSLAINFAAYESMKLF 232



>pir|T04273|T04273 hypothetical protein F20B18.290 - Arabidopsis
           thaliana>gb:ATCHRIV64_1546499 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           64.>gb:ATF20B18_1549466 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F20B18 (ESSA project).
          Length = 325

 Score = 46.2 bits (108), Expect(2) = 4e-05
 Identities = 34/146 (23%), Positives = 62/146 (42%), Gaps = 4/146 (2%)
 Frame = +3

Query: 426 KGLLCNXXXXXXXXXXXXTFVCPLDVIKTRF----QVHGLPKLGNTNIRGSLIVGSLEQI 593
           +G L +             F  PLD+++T+     QV  +P +     RG  IV    + 
Sbjct: 111 RGPLLDLVAGSFAGGTAVLFTYPLDLVRTKLAYQTQVKAIP-VEQIIYRG--IVDCFSRT 167

Query: 594 FQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXX 773
           ++  G RG+YRG++P++  + P   + F  YE++K  +      H+  I           
Sbjct: 168 YRESGARGLYRGVAPSLYGIFPYAGLKFYFYEEMKRHV---PPEHKQDISLKLVCGSVAG 224

Query: 774 XXXXXXXNPLWVVKTRLQTQGMRAGV 851
                   PL VV+ ++Q + + + V
Sbjct: 225 LLGQTLTYPLDVVRRQMQVERLYSAV 250



 Score = 42.0 bits (97), Expect = 0.024
 Identities = 24/76 (31%), Positives = 40/76 (52%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T V PL+ IK  FQ            +   +VGS+ +I + EGL G YRG   +V  ++P
Sbjct: 33  TAVAPLERIKILFQTR------RDEFKRIGLVGSINKIGKTEGLMGFYRGNGASVARIVP 86

Query: 660 NWAVYFTIYEQLKSFL 707
             A+++  YE+ + ++
Sbjct: 87  YAALHYMAYEEYRRWI 102



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 24/76 (31%), Positives = 41/76 (53%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLDV++ + QV  L        R   +  +L +I + EG + ++ GLS   L ++P
Sbjct: 229 TLTYPLDVVRRQMQVERLYSAVKEETRRGTMQ-TLFKIAREEGWKQLFSGLSINYLKVVP 287

Query: 660 NWAVYFTIYEQLKSFL 707
           + A+ FT+Y+ +K  L
Sbjct: 288 SVAIGFTVYDIMKLHL 303



 Score = 24.6 bits (52), Expect(2) = 4e-05
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = +2

Query: 854 RGTLSALRRIAREKGILGLFFYLNV 928
           RGT+  L +IARE+G   LF  L++
Sbjct: 256 RGTMQTLFKIAREEGWKQLFSGLSI 280



>gb:BC064874_2553915 Xenopus tropicalis hypothetical protein
           MGC76218, mRNA (cDNA clone MGC:76218 IMAGE:5336306),
           complete cds.
          Length = 332

 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 40/143 (27%), Positives = 62/143 (43%), Gaps = 2/143 (1%)
 Frame = +3

Query: 405 DAHGP--SPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVG 578
           DA+G   S + LLC               VCP++ IK +F +H      N   RG     
Sbjct: 135 DANGKLDSKRSLLCGLGAGVAEAV---VVVCPMETIKVKF-IHDQCS-PNPKYRG--FFH 187

Query: 579 SLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXX 758
            + +I + +G++G Y+GL+ TVL    N A+ F +   L+++   DD    ++       
Sbjct: 188 GVREIIRVQGIKGTYQGLTATVLKQGSNQAIRFFVMTSLRNWYRGDDPNKPMNPLVTGAF 247

Query: 759 XXXXXXXXXXXXNPLWVVKTRLQ 827
                        PL VVKTR+Q
Sbjct: 248 GAIAGAASVFGNTPLDVVKTRMQ 270



 Score = 35.0 bits (79), Expect = 2.9
 Identities = 22/70 (31%), Positives = 36/70 (51%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P + +KT+ Q+    K      RG  I   + Q  +  G++G+YRGLS  +   +P  AV
Sbjct: 66  PTEYVKTQLQLD--EKANPPRYRG--IWDCVRQTVEGHGVKGLYRGLSSLLYGSIPKAAV 121

Query: 672 YFTIYEQLKS 701
            F ++E L +
Sbjct: 122 RFGMFEFLSN 131



>gb:BC068561_1987697 Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 24,
           transcript variant 1, mRNA (cDNA clone MGC:87498
           IMAGE:5259336), complete cds.
          Length = 477

 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 35/125 (28%), Positives = 58/125 (46%), Gaps = 2/125 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           TF+ P++V+KTR  V      G T  + S I    ++I + EGL   Y+G  P +L ++P
Sbjct: 304 TFIYPMEVMKTRLAV------GKTG-QYSGIYDCAKKILKHEGLGAFYKGYVPNLLGIIP 356

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELS--IXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
              +   +YE LKS+   +  +  ++  +                   PL +V+TR+Q Q
Sbjct: 357 YAGIDLAVYELLKSYWLDNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQ 416

Query: 834 GMRAG 848
            M  G
Sbjct: 417 AMLEG 421



 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 35/115 (30%), Positives = 48/115 (41%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVHG  K    NI      G   Q+ +  G+R ++RG    V+ + P
Sbjct: 210 TSTAPLDRLKIMMQVHG-SKSDKMNI-----FGGFRQMVKEGGIRSLWRGNGTNVIKIAP 263

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRL 824
             AV F  YEQ K  L   +E  ++                     P+ V+KTRL
Sbjct: 264 ETAVKFWAYEQYKKLL--TEEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRL 316



 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 24/76 (31%), Positives = 42/76 (55%), Gaps = 4/76 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    + G P+L         +VG   +I  +EG+ G+YRG++P  + +LP
Sbjct: 405 PLALVRTRMQAQAMLEGSPQLN--------MVGLFRRIISKEGIPGLYRGITPNFMKVLP 456

Query: 660 NWAVYFTIYEQLKSFL 707
              + + +YE +K  L
Sbjct: 457 AVGISYVVYENMKQTL 472



>gb:AJ619987_1907005 Homo sapiens mRNA for small calcium-binding
           mitochondrial carrier 1 (SCAMC-1
           gene).>gb:AL359258_1925431 Human DNA sequence from clone
           RP11-483I13 on chromosome 1 Contains the 5' end of the
           SLC25A24 gene for solute carrier family 25
           (mitochondrial carrier; phosphate carrier) member 24,
           the gene for a novel protein, two novel genes, a
           pseudogene similar to solute carrier family 25
           (mitochondrial carrier; phosphate carrier) member 24
           (SLC25A24) and two CpG islands, complete
           sequence.>gb:AL390036_1926462 Human DNA sequence from
           clone RP11-356N1 on chromosome 1 Contains the 3' end of
           a novel gene, a novel gene, the 3' end of the SLC25A24
           gene for solute carrier family 25 (mitochondrial
           carrier; phosphate carrier) member 24 and two CpG
           islands, complete sequence.>gb:BC014519_1974662 Homo
           sapiens solute carrier family 25 (mitochondrial carrier;
           phosphate carrier), member 24, transcript variant 1,
           mRNA (cDNA clone MGC:10669 IMAGE:3842039), complete cds.
          Length = 477

 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 35/125 (28%), Positives = 58/125 (46%), Gaps = 2/125 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           TF+ P++V+KTR  V      G T  + S I    ++I + EGL   Y+G  P +L ++P
Sbjct: 304 TFIYPMEVMKTRLAV------GKTG-QYSGIYDCAKKILKHEGLGAFYKGYVPNLLGIIP 356

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELS--IXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
              +   +YE LKS+   +  +  ++  +                   PL +V+TR+Q Q
Sbjct: 357 YAGIDLAVYELLKSYWLDNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQ 416

Query: 834 GMRAG 848
            M  G
Sbjct: 417 AMLEG 421



 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 35/115 (30%), Positives = 48/115 (41%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVHG  K    NI      G   Q+ +  G+R ++RG    V+ + P
Sbjct: 210 TSTAPLDRLKIMMQVHG-SKSDKMNI-----FGGFRQMVKEGGIRSLWRGNGTNVIKIAP 263

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRL 824
             AV F  YEQ K  L   +E  ++                     P+ V+KTRL
Sbjct: 264 ETAVKFWAYEQYKKLL--TEEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRL 316



 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 24/76 (31%), Positives = 42/76 (55%), Gaps = 4/76 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    + G P+L         +VG   +I  +EG+ G+YRG++P  + +LP
Sbjct: 405 PLALVRTRMQAQAMLEGSPQLN--------MVGLFRRIISKEGIPGLYRGITPNFMKVLP 456

Query: 660 NWAVYFTIYEQLKSFL 707
              + + +YE +K  L
Sbjct: 457 AVGISYVVYENMKQTL 472



>gb:AJ619961_1907002 Homo sapiens partial mRNA for mitochondrial
           ATP-Mg/Pi carrier isoform 1, (SLC25A24 gene).
          Length = 458

 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 35/125 (28%), Positives = 58/125 (46%), Gaps = 2/125 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           TF+ P++V+KTR  V      G T  + S I    ++I + EGL   Y+G  P +L ++P
Sbjct: 285 TFIYPMEVMKTRLAV------GKTG-QYSGIYDCAKKILKHEGLGAFYKGYVPNLLGIIP 337

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELS--IXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
              +   +YE LKS+   +  +  ++  +                   PL +V+TR+Q Q
Sbjct: 338 YAGIDLAVYELLKSYWLDNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQ 397

Query: 834 GMRAG 848
            M  G
Sbjct: 398 AMLEG 402



 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 35/115 (30%), Positives = 48/115 (41%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVHG  K    NI      G   Q+ +  G+R ++RG    V+ + P
Sbjct: 191 TSTAPLDRLKIMMQVHG-SKSDKMNI-----FGGFRQMVKEGGIRSLWRGNGTNVIKIAP 244

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRL 824
             AV F  YEQ K  L   +E  ++                     P+ V+KTRL
Sbjct: 245 ETAVKFWAYEQYKKLL--TEEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRL 297



 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 24/76 (31%), Positives = 42/76 (55%), Gaps = 4/76 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    + G P+L         +VG   +I  +EG+ G+YRG++P  + +LP
Sbjct: 386 PLALVRTRMQAQAMLEGSPQLN--------MVGLFRRIISKEGIPGLYRGITPNFMKVLP 437

Query: 660 NWAVYFTIYEQLKSFL 707
              + + +YE +K  L
Sbjct: 438 AVGISYVVYENMKQTL 453



>gb:AE016820_1749907 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VII, complete sequence.
          Length = 316

 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 33/82 (40%), Positives = 48/82 (58%), Gaps = 7/82 (8%)
 Frame = +3

Query: 492 PLDVIKTRFQVH--GLPKLGNTNI----RGSLIVGSLEQIFQREG-LRGMYRGLSPTVLA 650
           PLD+++TR  +    L KL  +      R   IV  L +IF+ EG LRG YRG+ PT L 
Sbjct: 135 PLDLVRTRLSIQTANLAKLHRSKAHDIRRPPGIVELLRRIFREEGGLRGWYRGVYPTSLG 194

Query: 651 LLPNWAVYFTIYEQLKSFLCSD 716
           ++P  A+ F +YE+LK+ +  D
Sbjct: 195 VVPFVALNFALYERLKALIPHD 216



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 27/72 (37%), Positives = 44/72 (61%), Gaps = 2/72 (2%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQV--HGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLAL 653
           T V P D+++ RFQV   G  +LG    R + +  +L  I ++EGLRG Y+GL+  ++ +
Sbjct: 239 TVVYPFDLLRRRFQVLTMGQSELG---FRYASVADALWTIGRQEGLRGYYKGLTANLVKV 295

Query: 654 LPNWAVYFTIYE 689
           +P  AV + +YE
Sbjct: 296 VPAMAVQWFVYE 307



 Score = 42.4 bits (98), Expect = 0.018
 Identities = 30/120 (25%), Positives = 52/120 (43%), Gaps = 2/120 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T V P++ +K   QV       +T      +V +++Q+++ EG++G++RG     L + P
Sbjct: 32  TVVSPVERVKILLQVQS-----STTAYNGGLVHAVKQVYKEEGVKGLFRGNGINCLRIFP 86

Query: 660 NWAVYFTIYEQLKS--FLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
             AV + +YE  K+  F        +L                     PL +V+TRL  Q
Sbjct: 87  YSAVQYAVYEFCKTRVFHVGQSGHEQLRSWERLVGGALGGGASVLVTYPLDLVRTRLSIQ 146



>gb:SPBC12D12_1718900 S.pombe chromosome II cosmid c12D12.
          Length = 426

 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 28/79 (35%), Positives = 45/79 (56%), Gaps = 3/79 (3%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQ---REGLRGMYRGLSPTVLA 650
           T V PL+VI+TR Q  G      T+   +   G ++  ++    EG RG+Y+GLSP +L 
Sbjct: 351 TIVFPLNVIRTRLQTQG------TSAHPATYDGFIDCFYKTTKNEGFRGLYKGLSPNLLK 404

Query: 651 LLPNWAVYFTIYEQLKSFL 707
           + P+ A+ + +YE  K +L
Sbjct: 405 VAPSVAISYLVYENCKKWL 423



 Score = 46.6 bits (109), Expect = 0.001
 Identities = 36/129 (27%), Positives = 58/129 (44%), Gaps = 8/129 (6%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           F+ P+D +K R Q   L +  +     S+I+ + +++++  G+RG YRG+   +L + P 
Sbjct: 245 FIYPVDTLKFRIQCSDLSRGQHGK---SIILSNAKELYKSVGIRGYYRGVLVGILGMFPY 301

Query: 663 WAVYFTIYEQLK----SFLCS----DDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKT 818
            A     +E LK      L S    D +  +L                     PL V++T
Sbjct: 302 SATDLGTFEGLKRTWIGILASRDNVDPQDVKLPNGLVMAFGALSGSTGATIVFPLNVIRT 361

Query: 819 RLQTQGMRA 845
           RLQTQG  A
Sbjct: 362 RLQTQGTSA 370



>gb:CR382135_1668468 Debaryomyces hansenii chromosome C of strain
           CBS767 of Debaryomyces hansenii.
          Length = 318

 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 32/129 (24%), Positives = 62/129 (48%), Gaps = 4/129 (3%)
 Frame = +3

Query: 492 PLDVIKTRFQVH--GLPKLGNTN-IRGSLIVGSLEQIFQREG-LRGMYRGLSPTVLALLP 659
           PLD+++ R  V    L KL     ++   +V +L ++++ EG LR +Y+G+ PT + + P
Sbjct: 140 PLDLVRARITVQTASLAKLAKGRLVKPPSVVETLVEVYKHEGGLRALYKGIVPTTMGVAP 199

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGM 839
             A+ FT+YE+++ ++ +    +   +                   PL +++ R Q   M
Sbjct: 200 YVAINFTLYEKMRDYMDNSPADYSNPLWKLSAGAFSSFVGGVLIY-PLDLLRKRYQVASM 258

Query: 840 RAGVVGVHY 866
             G +G  Y
Sbjct: 259 AGGELGFQY 267



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 22/71 (30%), Positives = 40/71 (56%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           + PLD+++ R+QV  +   G    + S +  +L  IF  EG  G Y+GL+  +  ++P+ 
Sbjct: 243 IYPLDLLRKRYQVASMAG-GELGFQYSSVARALISIFTTEGFFGAYKGLTANLYKIVPSM 301

Query: 666 AVYFTIYEQLK 698
           AV +  Y+ +K
Sbjct: 302 AVSWLCYDNIK 312



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 27/119 (22%), Positives = 53/119 (44%), Gaps = 1/119 (0%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T V P +  K   Q+ G    G  +  G  +  ++ +++  EG RG++RG     + ++P
Sbjct: 38  TVVSPFERAKILLQLQGP---GFKSYNG--MFPTIFKMYAEEGWRGLFRGNLLNCIRIVP 92

Query: 660 NWAVYFTIYEQLKSFLCSD-DERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
             AV + ++E+ K+ + ++ D   EL +                   PL +V+ R+  Q
Sbjct: 93  YSAVQYAVFEKCKAIMMANKDGSSELQVHERLIAGSIGGIASVAATYPLDLVRARITVQ 151



>sp|P23500|MRS4_YEAST Mitochondrial RNA splicing protein
           MRS4.>pir|S13533|S13533 mtRNA splice defect-suppressing
           mitochondrial carrier MRS4 - yeast (Saccharomyces
           cerevisiae)>gb:SCMRS4_1708784 Yeast nuclear DNA fragment
           H61/2.6 with MRS4 gene, involved in mtRNA
           splicing.>gb:SCYKR052C_1713265 S.cerevisiae chromosome
           XI reading frame ORF YKR052c.
          Length = 304

 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 32/112 (28%), Positives = 47/112 (41%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+D +KTR Q  GL K  +T      ++  + +I   EG   +++G+   +L   P  AV
Sbjct: 43  PIDALKTRVQAAGLNKAASTG-----MISQISKISTMEGSMALWKGVQSVILGAGPAHAV 97

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
           YF  YE  K+ L S ++                        NP   VK RLQ
Sbjct: 98  YFGTYEFCKARLISPEDMQTHQPMKTALSGTIATIAADALMNPFDTVKQRLQ 149



 Score = 35.0 bits (79), Expect = 2.9
 Identities = 30/115 (26%), Positives = 43/115 (37%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P D +K R Q+       +TN+R   +    +QI+Q EG    Y     T+   +P  A 
Sbjct: 140 PFDTVKQRLQL-------DTNLR---VWNVTKQIYQNEGFAAFYYSYPTTLAMNIPFAAF 189

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
            F IYE    F    +  + L                     PL  +KT LQ +G
Sbjct: 190 NFMIYESASKFFNPQNSYNPL---IHCLCGGISGATCAALTTPLDCIKTVLQVRG 241



>gb:BC066998_2105893 Mus musculus solute carrier family 25
           (mitochondrial carrier, phosphate carrier), member 25,
           mRNA (cDNA clone MGC:91351 IMAGE:5703622), complete cds.
          Length = 501

 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 38/133 (28%), Positives = 56/133 (42%), Gaps = 2/133 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVH       +      IVG   Q+ +  G + ++RG    VL + P
Sbjct: 234 TCTAPLDRLKVLMQVHA------SRSNNMCIVGGFTQMIREGGAKSLWRGNGINVLKIAP 287

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTR--LQTQ 833
             A+ F  YEQ+K  + SD E   L I                   P+ V+KTR  L+  
Sbjct: 288 ESAIKFMAYEQMKRLVGSDQE--TLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKT 345

Query: 834 GMRAGVVGVHYRL 872
           G  +G++    R+
Sbjct: 346 GQYSGMLDCARRI 358



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 4/73 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    + G P++  +++         +QI + EG  G+YRGL+P  + ++P
Sbjct: 429 PLALVRTRMQAQASIEGAPEVTMSSL--------FKQILRTEGAFGLYRGLAPNFMKVIP 480

Query: 660 NWAVYFTIYEQLK 698
             ++ + +YE LK
Sbjct: 481 AVSISYVVYENLK 493



 Score = 37.4 bits (85), Expect = 0.59
 Identities = 30/126 (23%), Positives = 54/126 (42%), Gaps = 5/126 (3%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           + P++V+KTR     L K G      S ++    +I  +EG+   Y+G  P +L ++P  
Sbjct: 330 IYPMEVLKTRM---ALRKTGQY----SGMLDCARRILAKEGVAAFYKGYIPNMLGIIPYA 382

Query: 666 AVYFTIYEQLKSFLCSDDERHELS-----IXXXXXXXXXXXXXXXXXXNPLWVVKTRLQT 830
            +   +YE LK+      +R+ ++     +                   PL +V+TR+Q 
Sbjct: 383 GIDLAVYETLKNTWL---QRYAVNSADPGVFVLLACGTISSTCGQLASYPLALVRTRMQA 439

Query: 831 QGMRAG 848
           Q    G
Sbjct: 440 QASIEG 445



>gb:BC037109_2097999 Mus musculus solute carrier family 25
           (mitochondrial carrier, phosphate carrier), member 25,
           mRNA (cDNA clone MGC:47196 IMAGE:5368306), complete cds.
          Length = 514

 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 38/133 (28%), Positives = 56/133 (42%), Gaps = 2/133 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVH       +      IVG   Q+ +  G + ++RG    VL + P
Sbjct: 247 TCTAPLDRLKVLMQVHA------SRSNNMCIVGGFTQMIREGGAKSLWRGNGINVLKIAP 300

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTR--LQTQ 833
             A+ F  YEQ+K  + SD E   L I                   P+ V+KTR  L+  
Sbjct: 301 ESAIKFMAYEQMKRLVGSDQE--TLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKT 358

Query: 834 GMRAGVVGVHYRL 872
           G  +G++    R+
Sbjct: 359 GQYSGMLDCARRI 371



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 4/73 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    + G P++  +++         +QI + EG  G+YRGL+P  + ++P
Sbjct: 442 PLALVRTRMQAQASIEGAPEVTMSSL--------FKQILRTEGAFGLYRGLAPNFMKVIP 493

Query: 660 NWAVYFTIYEQLK 698
             ++ + +YE LK
Sbjct: 494 AVSISYVVYENLK 506



 Score = 37.4 bits (85), Expect = 0.59
 Identities = 30/126 (23%), Positives = 54/126 (42%), Gaps = 5/126 (3%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           + P++V+KTR     L K G      S ++    +I  +EG+   Y+G  P +L ++P  
Sbjct: 343 IYPMEVLKTRM---ALRKTGQY----SGMLDCARRILAKEGVAAFYKGYIPNMLGIIPYA 395

Query: 666 AVYFTIYEQLKSFLCSDDERHELS-----IXXXXXXXXXXXXXXXXXXNPLWVVKTRLQT 830
            +   +YE LK+      +R+ ++     +                   PL +V+TR+Q 
Sbjct: 396 GIDLAVYETLKNTWL---QRYAVNSADPGVFVLLACGTISSTCGQLASYPLALVRTRMQA 452

Query: 831 QGMRAG 848
           Q    G
Sbjct: 453 QASIEG 458



>gb:BC019978_2093181 Mus musculus solute carrier family 25
           (mitochondrial carrier, phosphate carrier), member 25,
           mRNA (cDNA clone MGC:28954 IMAGE:4239441), complete
           cds.>gb:BC022114_2093736 Mus musculus solute carrier
           family 25 (mitochondrial carrier, phosphate carrier),
           member 25, mRNA (cDNA clone MGC:36388 IMAGE:5098924),
           complete cds.
          Length = 366

 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 38/133 (28%), Positives = 56/133 (42%), Gaps = 2/133 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVH       +      IVG   Q+ +  G + ++RG    VL + P
Sbjct: 99  TCTAPLDRLKVLMQVHA------SRSNNMCIVGGFTQMIREGGAKSLWRGNGINVLKIAP 152

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTR--LQTQ 833
             A+ F  YEQ+K  + SD E   L I                   P+ V+KTR  L+  
Sbjct: 153 ESAIKFMAYEQMKRLVGSDQE--TLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKT 210

Query: 834 GMRAGVVGVHYRL 872
           G  +G++    R+
Sbjct: 211 GQYSGMLDCARRI 223



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 4/73 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    + G P++  +++         +QI + EG  G+YRGL+P  + ++P
Sbjct: 294 PLALVRTRMQAQASIEGAPEVTMSSL--------FKQILRTEGAFGLYRGLAPNFMKVIP 345

Query: 660 NWAVYFTIYEQLK 698
             ++ + +YE LK
Sbjct: 346 AVSISYVVYENLK 358



 Score = 37.4 bits (85), Expect = 0.59
 Identities = 30/126 (23%), Positives = 54/126 (42%), Gaps = 5/126 (3%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           + P++V+KTR     L K G      S ++    +I  +EG+   Y+G  P +L ++P  
Sbjct: 195 IYPMEVLKTRM---ALRKTGQY----SGMLDCARRILAKEGVAAFYKGYIPNMLGIIPYA 247

Query: 666 AVYFTIYEQLKSFLCSDDERHELS-----IXXXXXXXXXXXXXXXXXXNPLWVVKTRLQT 830
            +   +YE LK+      +R+ ++     +                   PL +V+TR+Q 
Sbjct: 248 GIDLAVYETLKNTWL---QRYAVNSADPGVFVLLACGTISSTCGQLASYPLALVRTRMQA 304

Query: 831 QGMRAG 848
           Q    G
Sbjct: 305 QASIEG 310



>gb:AK122568_2069233 Mus musculus mRNA for mKIAA1896 protein.
          Length = 515

 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 38/133 (28%), Positives = 56/133 (42%), Gaps = 2/133 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVH       +      IVG   Q+ +  G + ++RG    VL + P
Sbjct: 248 TCTAPLDRLKVLMQVHA------SRSNNMCIVGGFTQMIREGGAKSLWRGNGINVLKIAP 301

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTR--LQTQ 833
             A+ F  YEQ+K  + SD E   L I                   P+ V+KTR  L+  
Sbjct: 302 ESAIKFMAYEQMKRLVGSDQE--TLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKT 359

Query: 834 GMRAGVVGVHYRL 872
           G  +G++    R+
Sbjct: 360 GQYSGMLDCARRI 372



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 4/73 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    + G P++  +++         +QI + EG  G+YRGL+P  + ++P
Sbjct: 443 PLALVRTRMQAQASIEGAPEVTMSSL--------FKQILRTEGAFGLYRGLAPNFMKVIP 494

Query: 660 NWAVYFTIYEQLK 698
             ++ + +YE LK
Sbjct: 495 AVSISYVVYENLK 507



 Score = 37.4 bits (85), Expect = 0.59
 Identities = 30/126 (23%), Positives = 54/126 (42%), Gaps = 5/126 (3%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           + P++V+KTR     L K G      S ++    +I  +EG+   Y+G  P +L ++P  
Sbjct: 344 IYPMEVLKTRM---ALRKTGQY----SGMLDCARRILAKEGVAAFYKGYIPNMLGIIPYA 396

Query: 666 AVYFTIYEQLKSFLCSDDERHELS-----IXXXXXXXXXXXXXXXXXXNPLWVVKTRLQT 830
            +   +YE LK+      +R+ ++     +                   PL +V+TR+Q 
Sbjct: 397 GIDLAVYETLKNTWL---QRYAVNSADPGVFVLLACGTISSTCGQLASYPLALVRTRMQA 453

Query: 831 QGMRAG 848
           Q    G
Sbjct: 454 QASIEG 459



>gb:NC3H10_1688523 Neurospora crassa DNA linkage group V Cosmid
           contig 3H10.
          Length = 706

 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 31/117 (26%), Positives = 54/117 (46%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           V P+D++KTR Q       G+     S  +    ++ + EG RG+Y G+ P ++ + P  
Sbjct: 367 VYPIDLVKTRMQNQRGASPGSRLYDNS--IDCFRKVIRNEGFRGLYSGVLPQLVGVAPEK 424

Query: 666 AVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
           A+  T+ + ++      D++  +S+                  NPL +VK RLQ QG
Sbjct: 425 AIKLTVNDLVRG--AFTDKQGNISVIHEIIAGGTAGGCQVVFTNPLEIVKIRLQVQG 479



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 33/120 (27%), Positives = 54/120 (45%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           F  PL+++K R QV G       ++ G+    ++  I +  GL G+Y+G S  +L  +P 
Sbjct: 464 FTNPLEIVKIRLQVQGEVA---KSVEGAPKRSAM-WIVRNLGLVGLYKGASACLLRDVPF 519

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMR 842
            A+YF  Y  LK  L  + +  +L +                   P  V+KTRLQ +  +
Sbjct: 520 SAIYFPTYSHLKKDLFGESKTKKLGVLQLLTAGAIAGMPAAYLTTPCDVIKTRLQVEARK 579



>gb:CR382139_1672894 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 318

 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 26/77 (33%), Positives = 42/77 (54%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD IKTR Q        +  +R   IV    Q+ + EG+  +Y+G++P ++ + P  AV
Sbjct: 233 PLDTIKTRLQKTTYASNESGLVR---IVKIANQLIKEEGIHALYKGITPRIMRVAPGQAV 289

Query: 672 YFTIYEQLKSFLCSDDE 722
            FT+YE +K  L  + +
Sbjct: 290 TFTVYEYMKRVLAGETQ 306



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 33/114 (28%), Positives = 47/114 (41%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD IK R Q++   +       G +  G    I Q+E    +Y+GL   V+ ++P  A+
Sbjct: 34  PLDTIKVRMQLY---RKSGQKPPGFIKTGI--NIVQKETFMSLYKGLGAVVIGIVPKMAL 88

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
            F+ YE  +S L   D                         NP+ VVK RLQ Q
Sbjct: 89  RFSSYEFYRSLLYRPDGSISTG-NTFLAGVGAGITEAVMVVNPMEVVKIRLQAQ 141



 Score = 41.2 bits (95), Expect = 0.041
 Identities = 34/122 (27%), Positives = 46/122 (37%), Gaps = 8/122 (6%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVH--------GLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPT 641
           V P++V+K R Q           +PK  N      LIV       + EG   +YRG+S T
Sbjct: 128 VNPMEVVKIRLQAQHHSMADPLDVPKYRNAPHAAYLIV-------KEEGFSTLYRGVSLT 180

Query: 642 VLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTR 821
                 N  V FT+Y ++K +L        L                     PL  +KTR
Sbjct: 181 AARQATNQGVNFTVYSKIKEYLQGYHNTEVLPAWETSCIGLISGALGPLSNAPLDTIKTR 240

Query: 822 LQ 827
           LQ
Sbjct: 241 LQ 242



>gb:CR382135_1668169 Debaryomyces hansenii chromosome C of strain
           CBS767 of Debaryomyces hansenii.
          Length = 323

 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 26/76 (34%), Positives = 43/76 (56%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T + P+D +KTR Q+       NTN     ++ S+ +I   EG+  ++RG+S  VL   P
Sbjct: 43  TVMFPIDSLKTRMQM-----ASNTNELSKSVITSISKIASSEGIYSLWRGVSSVVLGAGP 97

Query: 660 NWAVYFTIYEQLKSFL 707
             A+YF+++E  K+ L
Sbjct: 98  AHAIYFSVFEATKTML 113



 Score = 41.2 bits (95), Expect = 0.041
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 3/75 (4%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVG---SLEQIFQREGLRGMYRGLSPTVLALLPN 662
           PLD IKT  Q  G+ +  N N++   + G   +   +F+  G+    RGL P ++  +P+
Sbjct: 250 PLDCIKTALQTKGISR--NENMK--YVTGFKSATRALFKESGMSAFTRGLKPRIIFNVPS 305

Query: 663 WAVYFTIYEQLKSFL 707
            A+ +T YE  K  L
Sbjct: 306 TAISWTAYEMAKELL 320



 Score = 37.7 bits (86), Expect = 0.45
 Identities = 30/117 (25%), Positives = 49/117 (41%), Gaps = 1/117 (0%)
 Frame = +3

Query: 492 PLDVIKTRFQVHG-LPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA 668
           P DV+K R Q    L +  NT+++   ++     I+++EG    Y     T+   +P  A
Sbjct: 153 PFDVLKQRMQASSQLRQTENTSVK---LLQVASDIYKKEGFSAFYISYPTTLFTNIPFAA 209

Query: 669 VYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGM 839
           + F  YE   S L   +  +  +                   NPL  +KT LQT+G+
Sbjct: 210 LNFGFYEYSSSVL---NPNNVYNPYLHCVSGGIAGGIAAAITNPLDCIKTALQTKGI 263



>gb:AY325139_1177808 Rattus norvegicus Ab1-114 mRNA, complete cds.
          Length = 338

 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 33/143 (23%), Positives = 59/143 (41%), Gaps = 1/143 (0%)
 Frame = +3

Query: 435 LCNXXXXXXXXXXXXTFVCPLDVIKTRFQ-VHGLPKLGNTNIRGSLIVGSLEQIFQREGL 611
           L N              +CP +++K R Q ++ +   G      + +   +++IF+++G 
Sbjct: 107 LQNAAAGSFASAFAALVLCPTELVKCRLQTMYEMETSGKIAASQNTVWSVVKEIFRKDGP 166

Query: 612 RGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXX 791
            G Y GLS T+L  +P +  +F  YE  +SF  S   + EL                   
Sbjct: 167 LGFYHGLSSTLLREVPGYFFFFGGYELSRSFFASGRSKDELGPIPLMLSGGFGGICLWLA 226

Query: 792 XNPLWVVKTRLQTQGMRAGVVGV 860
             P+  +K+R+Q   M     G+
Sbjct: 227 VYPVDCIKSRIQVLSMTGKQTGL 249



>gb:AK049392_1168778 Mus musculus 7 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:C430003I03
           product:weakly similar to PEROXISOMAL CA-DEPENDENT
           SOLUTE CARRIER [Oryctolagus cuniculus], full insert
           sequence.>gb:AK082756_1173655 Mus musculus ES cells
           cDNA, RIKEN full-length enriched library,
           clone:C330005N23 product:weakly similar to PEROXISOMAL
           CA-DEPENDENT SOLUTE CARRIER [Oryctolagus cuniculus],
           full insert sequence.
          Length = 502

 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 38/133 (28%), Positives = 56/133 (42%), Gaps = 2/133 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVH       +      IVG   Q+ +  G + ++RG    VL + P
Sbjct: 235 TCTAPLDRLKVLMQVHA------SRSNNMCIVGGFTQMIREGGAKSLWRGNGINVLKIAP 288

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTR--LQTQ 833
             A+ F  YEQ+K  + SD E   L I                   P+ V+KTR  L+  
Sbjct: 289 ESAIKFMAYEQMKRLVGSDQE--TLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKT 346

Query: 834 GMRAGVVGVHYRL 872
           G  +G++    R+
Sbjct: 347 GQYSGMLDCARRI 359



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 4/73 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    + G P++  +++         +QI + EG  G+YRGL+P  + ++P
Sbjct: 430 PLALVRTRMQAQASIEGAPEVTMSSL--------FKQILRTEGAFGLYRGLAPNFMKVIP 481

Query: 660 NWAVYFTIYEQLK 698
             ++ + +YE LK
Sbjct: 482 AVSISYVVYENLK 494



 Score = 37.4 bits (85), Expect = 0.59
 Identities = 30/126 (23%), Positives = 54/126 (42%), Gaps = 5/126 (3%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           + P++V+KTR     L K G      S ++    +I  +EG+   Y+G  P +L ++P  
Sbjct: 331 IYPMEVLKTRM---ALRKTGQY----SGMLDCARRILAKEGVAAFYKGYIPNMLGIIPYA 383

Query: 666 AVYFTIYEQLKSFLCSDDERHELS-----IXXXXXXXXXXXXXXXXXXNPLWVVKTRLQT 830
            +   +YE LK+      +R+ ++     +                   PL +V+TR+Q 
Sbjct: 384 GIDLAVYETLKNTWL---QRYAVNSADPGVFVLLACGTISSTCGQLASYPLALVRTRMQA 440

Query: 831 QGMRAG 848
           Q    G
Sbjct: 441 QASIEG 446



>gb:AE014297_1138928 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE014297_1138929 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE003689_1220921
           Drosophila melanogaster chromosome 3R, section 27 of 118
           of the complete sequence.>gb:AE003689_1220922 Drosophila
           melanogaster chromosome 3R, section 27 of 118 of the
           complete sequence.>gb:AY069712_1294442 Drosophila
           melanogaster LP01207 full length cDNA.
          Length = 332

 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 27/76 (35%), Positives = 44/76 (57%), Gaps = 3/76 (3%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNT---NIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLA 650
           T V P D+IK R Q+ G      T    ++   +   L    ++EG+RG+Y+G++PT+L 
Sbjct: 253 TIVYPFDLIKKRLQIQGFESNRQTFGQTLQCHGVWDCLRLTVRQEGVRGLYKGVAPTLLK 312

Query: 651 LLPNWAVYFTIYEQLK 698
                A+YF+IY++LK
Sbjct: 313 SSMTTALYFSIYDKLK 328



 Score = 46.2 bits (108), Expect(2) = 1e-04
 Identities = 34/121 (28%), Positives = 48/121 (39%), Gaps = 3/121 (2%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLDVI+TR       K      R      ++  I ++EG RGMYRGLS  +L + P    
Sbjct: 158 PLDVIRTRLIAQDTSKGYRNATR------AVSAIVRQEGPRGMYRGLSSALLQITPLMGT 211

Query: 672 YFTIYEQLKSFLCS---DDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMR 842
            F  Y     + C+     +R +L                     P  ++K RLQ QG  
Sbjct: 212 NFMAYRLFSDWACAFLEVSDRSQLPTWTLLGLGASSGMLSKTIVYPFDLIKKRLQIQGFE 271

Query: 843 A 845
           +
Sbjct: 272 S 272



 Score = 34.3 bits (77), Expect = 5.0
 Identities = 30/127 (23%), Positives = 47/127 (37%), Gaps = 8/127 (6%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRG--------SLIVGSLEQIFQREGLRGMYRGLSPTVL 647
           PLDV+K RFQ+   P   N    G        + I  +++ I++ EG+   ++G +P  +
Sbjct: 48  PLDVLKIRFQLQVEPLGKNAAKEGPGALTSKYTSIGQAVKTIYREEGMLAFWKGHNPAQV 107

Query: 648 ALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
             +      F  YEQL           +                      PL V++TRL 
Sbjct: 108 LSIMYGICQFWTYEQLSLMAKQTSYLADHQHLSNFLCGAAAGGAAVIISTPLDVIRTRLI 167

Query: 828 TQGMRAG 848
            Q    G
Sbjct: 168 AQDTSKG 174



 Score = 22.7 bits (47), Expect(2) = 1e-04
 Identities = 8/21 (38%), Positives = 12/21 (57%)
 Frame = +2

Query: 851 CRGTLSALRRIAREKGILGLF 913
           C G    LR   R++G+ GL+
Sbjct: 283 CHGVWDCLRLTVRQEGVRGLY 303



>sp|Q9WVD5|ORT1_MOUSE Mitochondrial ornithine transporter 1 (Solute
           carrier family 25, member 15).>gb:AK052758_1170184 Mus
           musculus 0 day neonate kidney cDNA, RIKEN full-length
           enriched library, clone:D630044L02 product:solute
           carrier family 25 (mitochondrial carrier; ornithine
           transporter), member 15, full insert
           sequence.>gb:AF133914_2055873 Mus musculus ornithine
           transporter mRNA, complete cds; nuclear gene for
           mitochondrial product.
          Length = 301

 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 33/143 (23%), Positives = 59/143 (41%), Gaps = 1/143 (0%)
 Frame = +3

Query: 435 LCNXXXXXXXXXXXXTFVCPLDVIKTRFQ-VHGLPKLGNTNIRGSLIVGSLEQIFQREGL 611
           L N              +CP +++K R Q ++ +   G      + +   +++IF+++G 
Sbjct: 107 LQNAAAGSFASAFAALVLCPTELVKCRLQTMYEMETSGKIAASQNTVWSVVKEIFRKDGP 166

Query: 612 RGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXX 791
            G Y GLS T+L  +P +  +F  YE  +SF  S   + EL                   
Sbjct: 167 LGFYHGLSSTLLREVPGYFFFFGGYELSRSFFASGRSKDELGPVPLMLSGGFGGICLWLA 226

Query: 792 XNPLWVVKTRLQTQGMRAGVVGV 860
             P+  +K+R+Q   M     G+
Sbjct: 227 VYPVDCIKSRIQVLSMTGKQTGL 249



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 25/79 (31%), Positives = 37/79 (46%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           V P+D IK+R QV     L  T  +  L+   L  I + EG+  +Y GL PT++   P  
Sbjct: 227 VYPVDCIKSRIQV-----LSMTGKQTGLVRTFLS-IVKNEGITALYSGLKPTMIRAFPAN 280

Query: 666 AVYFTIYEQLKSFLCSDDE 722
              F  YE  +  + +  E
Sbjct: 281 GALFLAYEYSRKLMMNQLE 299



>sp|Q99JD3|ODC_RAT Mitochondrial 2-oxodicarboxylate
           carrier.>gb:BC089099_2110707 Rattus norvegicus solute
           carrier family 25 (mitochondrial oxodicarboxylate
           carrier), member 21, mRNA (cDNA clone MGC:105329
           IMAGE:7306738), complete cds.>gb:RNO289714_2135784
           Rattus norvegicus mRNA for mitochondrial
           oxodicarboxylate carrier (odc gene).
          Length = 298

 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 32/72 (44%), Positives = 42/72 (58%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLDV+KTRFQV     + +     SL   S + IF+ EGL G Y+G+ P +LA  P  AV
Sbjct: 32  PLDVVKTRFQVQR--SVTDPQSYKSLR-DSFQVIFRTEGLFGFYKGIIPPILAETPKRAV 88

Query: 672 YFTIYEQLKSFL 707
            F+ +E  K FL
Sbjct: 89  KFSTFELYKKFL 100



 Score = 41.6 bits (96), Expect = 0.031
 Identities = 25/75 (33%), Positives = 38/75 (50%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           F  P DV K+R Q    P  G    RG     ++E +++ EG+  +Y+GL P V+ L P 
Sbjct: 223 FNIPFDVAKSRIQ-GPQPVPGEIKYRGCF--KTMETVYREEGILALYKGLLPKVMRLGPG 279

Query: 663 WAVYFTIYEQLKSFL 707
             V   +YE   ++L
Sbjct: 280 GGVMLLVYEYTYAWL 294



>gb:CR382125_1658281 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 368

 Score = 49.3 bits (116), Expect(2) = 6e-05
 Identities = 31/130 (23%), Positives = 55/130 (42%), Gaps = 17/130 (13%)
 Frame = +3

Query: 489 CPLDVIKTRFQVH---------GLPKLGNTNIR---GSLI-----VGSLEQIFQREGLRG 617
           CP DV+KTR Q            +   G++ +     SL+      G +  ++++EG R 
Sbjct: 69  CPFDVVKTRLQSDVFRTQYKSAAMQNNGSSTLHFVSRSLLHFKETFGIIGNVYRQEGFRS 128

Query: 618 MYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXN 797
           +++GL P ++ ++P  ++ F  Y   K          + +                   N
Sbjct: 129 LFKGLGPNLVGVIPARSINFLTYGTTKDIYSRTLNNGQEAPWIHLLAAATAGWATSTVTN 188

Query: 798 PLWVVKTRLQ 827
           P+W+VKTRLQ
Sbjct: 189 PIWLVKTRLQ 198



 Score = 37.0 bits (84), Expect = 0.77
 Identities = 23/76 (30%), Positives = 41/76 (53%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   P+ ++KTR Q   L K G    + SL    ++ + + EG+ G+Y+GLS + L  + 
Sbjct: 185 TVTNPIWLVKTRLQ---LDKAGTKTYKNSL--DCIKSVVKNEGVLGLYKGLSASYLGSVE 239

Query: 660 NWAVYFTIYEQLKSFL 707
              + + +YEQ+K  +
Sbjct: 240 G-ILQWILYEQMKRII 254



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 21/66 (31%), Positives = 35/66 (53%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P +V++TR +        N  ++ + +V S   I + EGL  MY GL+P +L  +PN  +
Sbjct: 299 PHEVVRTRLRQ---APTENGKLKYTGLVQSFRVIIKEEGLVSMYSGLTPHLLRTVPNSII 355

Query: 672 YFTIYE 689
            F  +E
Sbjct: 356 MFGTWE 361



 Score = 20.8 bits (42), Expect(2) = 6e-05
 Identities = 5/20 (25%), Positives = 14/20 (70%)
 Frame = +2

Query: 854 RGTLSALRRIAREKGILGLF 913
           + +L  ++ + + +G+LGL+
Sbjct: 208 KNSLDCIKSVVKNEGVLGLY 227



>gb:AY043169_2074445 Rattus norvegicus peroxisomal Ca-dependent
           solute carrier-like protein (Pcscl) mRNA, complete cds.
          Length = 469

 Score = 50.4 bits (119), Expect = 7e-05
 Identities = 37/133 (27%), Positives = 56/133 (42%), Gaps = 2/133 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVH       +      I+G   Q+ +  G + ++RG    VL + P
Sbjct: 202 TCTAPLDRLKVLMQVHA------SRSNNMCIIGGFTQMIREGGAKSLWRGNGINVLKIAP 255

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTR--LQTQ 833
             A+ F  YEQ+K  + SD E   L I                   P+ V+KTR  L+  
Sbjct: 256 ESAIKFMAYEQMKRLVGSDQE--TLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKT 313

Query: 834 GMRAGVVGVHYRL 872
           G  +G++    R+
Sbjct: 314 GQYSGMLDCAKRI 326



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 4/73 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    + G P++  +++         +QI + EG  G+YRGL+P  + ++P
Sbjct: 397 PLALVRTRMQAQASIEGAPEVTMSSL--------FKQILRTEGAFGLYRGLAPNFMKVIP 448

Query: 660 NWAVYFTIYEQLK 698
             ++ + +YE LK
Sbjct: 449 AVSISYVVYENLK 461



 Score = 37.7 bits (86), Expect = 0.45
 Identities = 30/126 (23%), Positives = 55/126 (43%), Gaps = 5/126 (3%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           + P++V+KTR     L K G      S ++   ++I  +EG+   Y+G  P +L ++P  
Sbjct: 298 IYPMEVLKTRM---ALRKTGQY----SGMLDCAKRILAKEGVAAFYKGYIPNMLGIIPYA 350

Query: 666 AVYFTIYEQLKSFLCSDDERHELS-----IXXXXXXXXXXXXXXXXXXNPLWVVKTRLQT 830
            +   +YE LK+      +R+ ++     +                   PL +V+TR+Q 
Sbjct: 351 GIDLAVYETLKNTWL---QRYAVNSADPGVFVLLACGTISSTCGQLASYPLALVRTRMQA 407

Query: 831 QGMRAG 848
           Q    G
Sbjct: 408 QASIEG 413



>gb:CR380958_1653321 Candida glabrata strain CBS138 chromosome L
           complete sequence.
          Length = 305

 Score = 50.4 bits (119), Expect = 7e-05
 Identities = 33/116 (28%), Positives = 51/116 (43%), Gaps = 2/116 (1%)
 Frame = +3

Query: 486 VCPLDVIKTRFQ-VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           + PLD +KTR Q +H +   G   I  +++   L  I  +EG   +++G+   +L   P 
Sbjct: 36  IFPLDALKTRLQAMHAISTTGGQPIPSTML-RQLSSISAQEGSMVLWKGVQSVLLGAGPA 94

Query: 663 WAVYFTIYEQLKSFLCSD-DERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
            AVYF  YE +KSFL  +     +                     NP  V+K R+Q
Sbjct: 95  HAVYFATYEMVKSFLIDEATSTSKYHFFKTAFSGATATIAADALMNPFDVIKQRIQ 150



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 27/73 (36%), Positives = 37/73 (50%), Gaps = 1/73 (1%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIR-GSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA 668
           PLD IKT  QV G  K+     +       +   I+Q  G RG + G+ P +LA +P  A
Sbjct: 230 PLDCIKTALQVRGSEKVSMEVFKQADTFKKATRAIYQVYGWRGFWSGVKPRILANMPATA 289

Query: 669 VYFTIYEQLKSFL 707
           + +T YE  K FL
Sbjct: 290 ISWTAYEFAKHFL 302



>gb:AE014298_1126466 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE014298_1126467 Drosophila melanogaster
           chromosome X, complete sequence.>gb:AE014298_1126468
           Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003512_1213475 Drosophila melanogaster
           chromosome X, section 64 of 74 of the complete
           sequence.>gb:AE003512_1213476 Drosophila melanogaster
           chromosome X, section 64 of 74 of the complete
           sequence.>gb:AE003512_1213477 Drosophila melanogaster
           chromosome X, section 64 of 74 of the complete
           sequence.>gb:AY070516_1294661 Drosophila melanogaster
           GH21048 full length cDNA.
          Length = 387

 Score = 50.4 bits (119), Expect = 7e-05
 Identities = 32/110 (29%), Positives = 54/110 (49%)
 Frame = +3

Query: 372 DSIAVDLAMTADAHGPSPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNT 551
           D+IA D+        P P   L              T V P+++I+T+ Q        + 
Sbjct: 169 DTIAHDI--------PHPIPFLVPLLAGVSGRILAVTCVSPVELIRTKMQ--------SQ 212

Query: 552 NIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKS 701
            +  + + G++ Q+ Q +G+ G++RGL PT+L  +P   +Y+T YE LKS
Sbjct: 213 RMTHAEMFGTIRQVVQSQGVLGLWRGLPPTILRDVPFSGIYWTCYEYLKS 262



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 30/100 (30%), Positives = 44/100 (44%), Gaps = 27/100 (27%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGLPKLGNTNI---------------------------RGSLIVGS 581
           F+ PLDVIKTR Q      L N                              R S  + +
Sbjct: 56  FMTPLDVIKTRLQAQQQALLSNKCFLYCNGLMDHICPCGPDTPNPAAAKPAPRFSGTIDA 115

Query: 582 LEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKS 701
             +I + EG+  ++ GLSPT+++ LP+  +YF  YEQ K+
Sbjct: 116 FIKISRTEGIGSLWSGLSPTLISALPSTIIYFVAYEQFKA 155



>pir|H86274|H86274 F7A19.22 protein - Arabidopsis
           thaliana>gb:AE005172_890404 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC007576_1535951 Arabidopsis thaliana
           chromosome I BAC F7A19 genomic sequence, complete
           sequence.>gb:AY084432_1569522 Arabidopsis thaliana clone
           108174 mRNA, complete sequence.
          Length = 305

 Score = 50.4 bits (119), Expect = 7e-05
 Identities = 31/117 (26%), Positives = 53/117 (45%), Gaps = 2/117 (1%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+D+ KTR Q+HG       +  G+   G + +I ++EG+ G+Y+GLSP ++  L    +
Sbjct: 32  PIDLTKTRMQLHGSGSASGAHRIGAF--GVVSEIARKEGVIGLYKGLSPAIIRHLFYTPI 89

Query: 672 YFTIYEQLKSFLCSDDERH--ELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
               YE LK  +   +  +   L +                  +P  +VK R+Q  G
Sbjct: 90  RIIGYENLKGLIVRSETNNSESLPLATKALVGGFSGVIAQVVASPADLVKVRMQADG 146



 Score = 34.7 bits (78), Expect = 3.8
 Identities = 23/70 (32%), Positives = 34/70 (48%)
 Frame = +3

Query: 489 CPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA 668
           CP DV+KTR    G     N   R S     L +  + EG+R +++G  PT   L P   
Sbjct: 234 CPADVVKTRMMNQG----ENAVYRNSY--DCLVKTVKFEGIRALWKGFFPTWARLGPWQF 287

Query: 669 VYFTIYEQLK 698
           V++  YE+ +
Sbjct: 288 VFWVSYEKFR 297



>gb:BC084177_2563568 Xenopus tropicalis hypothetical LOC496462, mRNA
           (cDNA clone MGC:79643 IMAGE:6980151), complete cds.
          Length = 513

 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 36/126 (28%), Positives = 53/126 (42%), Gaps = 6/126 (4%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVH       +      ++G   Q+ +  G+R ++RG    V+ + P
Sbjct: 246 TCTAPLDRLKVLMQVHA------SRSNNMSMLGGFTQMIREGGIRSLWRGNGINVIKIAP 299

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRL----- 824
             A+ F  YEQ+K  + SD E   L I                   P+ V+KTR+     
Sbjct: 300 ESAIKFMAYEQMKRIIGSDQE--TLGIHERLVAGSLAGVIAQSSIYPMEVLKTRMALRKT 357

Query: 825 -QTQGM 839
            Q QGM
Sbjct: 358 GQYQGM 363



 Score = 42.0 bits (97), Expect = 0.024
 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 4/73 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    V G P++  + +         + I + EG  G+YRGL+P  + ++P
Sbjct: 441 PLALVRTRMQAEASVEGAPQMTMSKL--------FKHIVKTEGAFGLYRGLAPNFMKVIP 492

Query: 660 NWAVYFTIYEQLK 698
             ++ + +YE LK
Sbjct: 493 AVSISYVVYENLK 505



 Score = 38.1 bits (87), Expect = 0.34
 Identities = 23/72 (31%), Positives = 39/72 (54%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           + P++V+KTR     L K G    +G L  G  ++I  +EG+   Y+G  P +L ++P  
Sbjct: 342 IYPMEVLKTRM---ALRKTGQ--YQGMLDCG--KKILLKEGVSAFYKGYVPNMLGIIPYA 394

Query: 666 AVYFTIYEQLKS 701
            +   +YE LK+
Sbjct: 395 GIDLAVYETLKN 406



>gb:BC022637_2093833 Mus musculus solute carrier family 25
           (mitochondrial carrier, phosphate carrier), member 24,
           mRNA (cDNA clone IMAGE:4208509), partial cds.
          Length = 232

 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 37/138 (26%), Positives = 62/138 (44%), Gaps = 7/138 (5%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           TF+ P++V+KTR  V    K G      S I G  ++I + EG    Y+G  P +L ++P
Sbjct: 59  TFIYPMEVLKTRLAV---AKTGQY----SGIYGCAKKILKHEGFGAFYKGYIPNLLGIIP 111

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELS--IXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
              +   +YE LKS+   +  +  ++  +                   PL +V+TR+Q Q
Sbjct: 112 YAGIDLAVYELLKSYWLDNFAKDSVNPGVMVLLSCGALSSTCGQLASYPLALVRTRMQAQ 171

Query: 834 GMRAG-----VVGVHYRL 872
               G     +VG+  R+
Sbjct: 172 ATVEGAPQLSMVGLFQRI 189



 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 25/76 (32%), Positives = 43/76 (56%), Gaps = 4/76 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    V G P+L         +VG  ++I  +EG+ G+YRG++P  + +LP
Sbjct: 160 PLALVRTRMQAQATVEGAPQLS--------MVGLFQRIVSKEGVSGLYRGITPNFMKVLP 211

Query: 660 NWAVYFTIYEQLKSFL 707
              + + +YE +K  L
Sbjct: 212 AVGISYVVYENMKQTL 227



 Score = 37.4 bits (85), Expect = 0.59
 Identities = 25/86 (29%), Positives = 36/86 (41%), Gaps = 2/86 (2%)
 Frame = +3

Query: 606 GLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXX 785
           G+R ++RG    V+ + P  AV F  YEQ K  L   +E  +L                 
Sbjct: 1   GIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLL--TEEGQKLGTFERFISGSMAGATAQ 58

Query: 786 XXXNPLWVVKTRLQT--QGMRAGVVG 857
               P+ V+KTRL     G  +G+ G
Sbjct: 59  TFIYPMEVLKTRLAVAKTGQYSGIYG 84



>gb:BC031671_1980220 Homo sapiens hypothetical protein MGC34725,
           mRNA (cDNA clone MGC:34725 IMAGE:5164630), complete cds.
          Length = 251

 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 24/72 (33%), Positives = 42/72 (58%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PL +++TR Q     +  N  +RG L     ++I  ++G  G+YRG++PT+L +LP   +
Sbjct: 183 PLTLVRTRMQAQDTVEGSNPTMRGVL-----QRILAQQGWLGLYRGMTPTLLKVLPAGGI 237

Query: 672 YFTIYEQLKSFL 707
            + +YE +K  L
Sbjct: 238 SYVVYEAMKKTL 249



 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 32/119 (26%), Positives = 52/119 (43%), Gaps = 1/119 (0%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T + P++V+KTR  +    +          ++    QI QREG R +YRG  P +L ++P
Sbjct: 83  TLINPMEVLKTRLTLRRTGQYKG-------LLDCARQILQREGTRALYRGYLPNMLGIIP 135

Query: 660 NWAVYFTIYEQLKSF-LCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
                  +YE L+ F + S  +  + S                    PL +V+TR+Q Q
Sbjct: 136 YACTDLAVYEMLQCFWVKSGRDMGDPSGLVSLSSVTLSTTCGQMASYPLTLVRTRMQAQ 194



 Score = 44.3 bits (103), Expect = 0.005
 Identities = 23/85 (27%), Positives = 40/85 (47%)
 Frame = +3

Query: 570 IVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXX 749
           ++G L+ + Q  G R ++RG    VL + P +A+ F+++EQ K++ C    +        
Sbjct: 13  LLGGLQSMVQEGGFRSLWRGNGINVLKIAPEYAIKFSVFEQCKNYFCG--IQGSPPFQER 70

Query: 750 XXXXXXXXXXXXXXXNPLWVVKTRL 824
                          NP+ V+KTRL
Sbjct: 71  LLAGSLAVAISQTLINPMEVLKTRL 95



>gb:AK097761_1914975 Homo sapiens cDNA FLJ40442 fis, clone
           TESTI2040102, moderately similar to Oryctolagus
           cuniculus peroxisomal Ca-dependent solute carrier mRNA.
          Length = 232

 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 24/72 (33%), Positives = 42/72 (58%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PL +++TR Q     +  N  +RG L     ++I  ++G  G+YRG++PT+L +LP   +
Sbjct: 164 PLTLVRTRMQAQDTVEGSNPTMRGVL-----QRILAQQGWLGLYRGMTPTLLKVLPAGGI 218

Query: 672 YFTIYEQLKSFL 707
            + +YE +K  L
Sbjct: 219 SYVVYEAMKKTL 230



 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 32/119 (26%), Positives = 52/119 (43%), Gaps = 1/119 (0%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T + P++V+KTR  +    +          ++    QI QREG R +YRG  P +L ++P
Sbjct: 64  TLINPMEVLKTRLTLRRTGQYKG-------LLDCTRQILQREGTRALYRGYLPNMLGIIP 116

Query: 660 NWAVYFTIYEQLKSF-LCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
                  +YE L+ F + S  +  + S                    PL +V+TR+Q Q
Sbjct: 117 YACTDLAVYEMLQCFWVKSGRDMGDPSGLVSLSSVTLSTTCGQMASYPLTLVRTRMQAQ 175



 Score = 38.5 bits (88), Expect = 0.26
 Identities = 21/76 (27%), Positives = 34/76 (44%)
 Frame = +3

Query: 597 QREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXX 776
           Q  G R ++RG    VL + P +A+ F+++EQ K++ C    +                 
Sbjct: 3   QEGGFRSLWRGNGINVLKIAPEYAIKFSVFEQCKNYFCG--IQGSPPFQERLLAGSLAVA 60

Query: 777 XXXXXXNPLWVVKTRL 824
                 NP+ V+KTRL
Sbjct: 61  ISQTLINPMEVLKTRL 76



>gb:AP001305_1821073 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone:MHC9.
          Length = 346

 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 33/75 (44%), Positives = 42/75 (56%), Gaps = 7/75 (9%)
 Frame = +3

Query: 486 VC-PLDVIKTRFQVHGL---PKLG---NTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTV 644
           VC PLDV+K RFQV GL   PK G     N   ++  G L QI + EG  G+Y+G+ P+ 
Sbjct: 262 VCHPLDVVKKRFQVEGLQRHPKYGARVELNAYKNMFDG-LGQILRSEGWHGLYKGIVPST 320

Query: 645 LALLPNWAVYFTIYE 689
           +   P  AV F  YE
Sbjct: 321 IKAAPAGAVTFVAYE 335



 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 37/124 (29%), Positives = 59/124 (47%), Gaps = 9/124 (7%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPK----LGNTNIRGSL--IVGSLEQIFQREGLRGMYRGLSPTVLAL 653
           PLDVIK RFQV   P     L ++ ++     +  + + IF+ EGL G +RG  P +L +
Sbjct: 46  PLDVIKIRFQVQLEPTATWALKDSQLKPKYNGLFRTTKDIFREEGLSGFWRGNVPALLMV 105

Query: 654 LPNWAVYFTIYEQLKSFLC--SDDERH-ELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRL 824
           +P  ++ F +  ++KSF    S  E H +LS                    P  +++T L
Sbjct: 106 VPYTSIQFAVLHKVKSFAAGSSKAENHAQLSPYLSYISGALAGCAATVGSYPFDLLRTVL 165

Query: 825 QTQG 836
            +QG
Sbjct: 166 ASQG 169



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 33/129 (25%), Positives = 57/129 (44%), Gaps = 12/129 (9%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P D+++T     G PK+   N+R + +      I Q  G++G+Y GLSPT++ ++P   +
Sbjct: 157 PFDLLRTVLASQGEPKV-YPNMRSAFL-----SIVQTRGIKGLYAGLSPTLIEIIPYAGL 210

Query: 672 YFTIYEQLKSFLCSDDERH------------ELSIXXXXXXXXXXXXXXXXXXNPLWVVK 815
            F  Y+  K +    ++R+             LS                   +PL VVK
Sbjct: 211 QFGTYDTFKRWSMVYNKRYRSSSSSSTNPSDSLSSFQLFLCGLASGTVSKLVCHPLDVVK 270

Query: 816 TRLQTQGMR 842
            R Q +G++
Sbjct: 271 KRFQVEGLQ 279



>gb:CR382132_1664944 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 292

 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 34/112 (30%), Positives = 55/112 (49%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P++VIK R Q+       + NI    I+   ++I+  EGLRG +RG    ++  LP+  V
Sbjct: 109 PMEVIKGRMQI------SSKNISTLQII---KRIYATEGLRGFFRGYVMGIVVFLPHSVV 159

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
           ++  YE+ K+++   ++R EL +                  N L VVKTR Q
Sbjct: 160 WWVTYEKTKAWM---EKRGELGLKEYAVSSAAATCTASVASNFLDVVKTRQQ 208



>gb:AY080592_1568336 Arabidopsis thaliana unknown protein
           (At3g21390) mRNA, complete cds.>gb:AY087894_1572920
           Arabidopsis thaliana clone 39353 mRNA, complete
           sequence.>gb:AY122945_1579823 Arabidopsis thaliana
           unknown protein (At3g21390) mRNA, complete cds.
          Length = 335

 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 33/75 (44%), Positives = 42/75 (56%), Gaps = 7/75 (9%)
 Frame = +3

Query: 486 VC-PLDVIKTRFQVHGL---PKLG---NTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTV 644
           VC PLDV+K RFQV GL   PK G     N   ++  G L QI + EG  G+Y+G+ P+ 
Sbjct: 251 VCHPLDVVKKRFQVEGLQRHPKYGARVELNAYKNMFDG-LGQILRSEGWHGLYKGIVPST 309

Query: 645 LALLPNWAVYFTIYE 689
           +   P  AV F  YE
Sbjct: 310 IKAAPAGAVTFVAYE 324



 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 37/124 (29%), Positives = 59/124 (47%), Gaps = 9/124 (7%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPK----LGNTNIRGSL--IVGSLEQIFQREGLRGMYRGLSPTVLAL 653
           PLDVIK RFQV   P     L ++ ++     +  + + IF+ EGL G +RG  P +L +
Sbjct: 35  PLDVIKIRFQVQLEPTATWALKDSQLKPKYNGLFRTTKDIFREEGLSGFWRGNVPALLMV 94

Query: 654 LPNWAVYFTIYEQLKSFLC--SDDERH-ELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRL 824
           +P  ++ F +  ++KSF    S  E H +LS                    P  +++T L
Sbjct: 95  VPYTSIQFAVLHKVKSFAAGSSKAENHAQLSPYLSYISGALAGCAATVGSYPFDLLRTVL 154

Query: 825 QTQG 836
            +QG
Sbjct: 155 ASQG 158



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 33/129 (25%), Positives = 57/129 (44%), Gaps = 12/129 (9%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P D+++T     G PK+   N+R + +      I Q  G++G+Y GLSPT++ ++P   +
Sbjct: 146 PFDLLRTVLASQGEPKV-YPNMRSAFL-----SIVQTRGIKGLYAGLSPTLIEIIPYAGL 199

Query: 672 YFTIYEQLKSFLCSDDERH------------ELSIXXXXXXXXXXXXXXXXXXNPLWVVK 815
            F  Y+  K +    ++R+             LS                   +PL VVK
Sbjct: 200 QFGTYDTFKRWSMVYNKRYRSSSSSSTNPSDSLSSFQLFLCGLASGTVSKLVCHPLDVVK 259

Query: 816 TRLQTQGMR 842
            R Q +G++
Sbjct: 260 KRFQVEGLQ 268



>gb:CR926117_1185621 Pongo pygmaeus mRNA; cDNA DKFZp459H2410 (from
           clone DKFZp459H2410).
          Length = 320

 Score = 50.1 bits (118), Expect = 9e-05
 Identities = 25/71 (35%), Positives = 43/71 (60%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           V P+DV++TRF   G PK+ NT      +  ++  +++ EG +  Y+GL+PT++A+ P  
Sbjct: 136 VHPVDVLRTRFAAQGEPKVYNT------LCHAVGTMYRSEGPQVFYKGLAPTLIAIFPYA 189

Query: 666 AVYFTIYEQLK 698
            + F+ Y  LK
Sbjct: 190 GLQFSCYSSLK 200



 Score = 38.1 bits (87), Expect = 0.34
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 4/82 (4%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQV----HGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVL 647
           T   PLD+ K R QV    H     G    R   ++   +Q+ Q+EG  G ++GLSP++L
Sbjct: 232 TLTYPLDLFKKRLQVGGFEHARAAFGQVR-RYKGLMDCAKQVLQKEGALGFFKGLSPSLL 290

Query: 648 ALLPNWAVYFTIYEQLKSFLCS 713
               +    F  YE    F C+
Sbjct: 291 KAALSTGFMFFWYE----FFCN 308



 Score = 37.4 bits (85), Expect = 0.59
 Identities = 29/118 (24%), Positives = 45/118 (38%), Gaps = 1/118 (0%)
 Frame = +3

Query: 486 VCPLDVIKTRFQV-HGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           + P DVIK RFQ+ H      + N +   I+ +  QI Q EG    ++G  P  +  +  
Sbjct: 33  ISPFDVIKIRFQLQHERLSRSDPNAKYHGILQASRQILQEEGPTAFWKGHIPAQILSIGY 92

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
            AV F  +E L   +                             +P+ V++TR   QG
Sbjct: 93  GAVQFLSFEMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQG 150



>gb:BC087392_2565235 Xenopus laevis hypothetical LOC496002, mRNA
           (cDNA clone MGC:99168 IMAGE:7206529), complete cds.
          Length = 327

 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 33/122 (27%), Positives = 50/122 (40%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD+++ R  V       N       I+    ++ + EGL+ +YRG +PTVL ++P   +
Sbjct: 154 PLDLVRARMAVTQKEMYSN-------IIHVFMRMSREEGLKSLYRGFTPTVLGVIPYAGI 206

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMRAGV 851
            F  YE LK        R +                      PL VV+ R+QT G+    
Sbjct: 207 SFFTYETLKKLHAEHSGRTQPYTFERLLFGACAGLFGQSSSYPLDVVRRRMQTAGVTGHT 266

Query: 852 VG 857
            G
Sbjct: 267 YG 268



 Score = 35.4 bits (80), Expect = 2.2
 Identities = 22/49 (44%), Positives = 34/49 (69%), Gaps = 1/49 (2%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREG-LRGMYRGLS 635
           PLDV++ R Q  G+   G+T   GS I+G++++I   EG +RG+Y+GLS
Sbjct: 249 PLDVVRRRMQTAGVT--GHTY--GS-IIGTMQEIVAEEGFIRGLYKGLS 292



 Score = 34.7 bits (78), Expect = 3.8
 Identities = 24/96 (25%), Positives = 39/96 (40%)
 Frame = +3

Query: 426 KGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQRE 605
           K +L +            T V PLD  K  FQV       +           + + +  +
Sbjct: 34  KSVLNSLTSGALAGAVAKTAVAPLDRTKIIFQV------SSNRFSAKEAYRLIYRTYMND 87

Query: 606 GLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCS 713
           G   ++RG S T++ ++P  A+ F  +EQ K  L S
Sbjct: 88  GFLSLWRGNSATMVRVIPYAAIQFCAHEQYKKLLGS 123



>gb:BC056787_2551973 Danio rerio zgc:63578, mRNA (cDNA clone
           MGC:63578 IMAGE:5409806), complete cds.
          Length = 359

 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 32/114 (28%), Positives = 53/114 (46%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           VCP++ +K +F +H    L     RG      + +I + +G+RG Y+GL+ T+L    N 
Sbjct: 188 VCPMETVKVKF-IHDQCSL-RPRYRG--FFHGVREIIRDQGVRGTYQGLTATLLKQGSNQ 243

Query: 666 AVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
           A+ F +   L+++   DD   ++                     PL VVKTR+Q
Sbjct: 244 AIRFYVMNLLRNWYKGDDPARDMHPLVTAMFGATAGAASVFGNTPLDVVKTRMQ 297



 Score = 34.7 bits (78), Expect = 3.8
 Identities = 23/70 (32%), Positives = 35/70 (50%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P + +KT+ Q+    +      RG  I   ++   Q  GLRG+YRGLS  +   +P  AV
Sbjct: 93  PTEYVKTQLQLD--ERANPPRYRG--IGDCVKLTVQYHGLRGLYRGLSSLLYGSIPKSAV 148

Query: 672 YFTIYEQLKS 701
            F  +E L +
Sbjct: 149 RFGTFEVLSN 158



>gb:AE017345_1756867 Cryptococcus neoformans var. neoformans JEC21
           chromosome 5, complete sequence.
          Length = 342

 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 26/72 (36%), Positives = 42/72 (58%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+D IKTR Q     + G T +     V S  ++F+ EG +  Y+G++P VL + P  A+
Sbjct: 260 PIDTIKTRIQKASKVE-GETALSRMAKVAS--EMFRNEGAKAFYKGITPRVLRVAPGQAI 316

Query: 672 YFTIYEQLKSFL 707
            FT+YE++K  +
Sbjct: 317 VFTVYERVKKMI 328



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 34/114 (29%), Positives = 45/114 (39%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD IK R Q+    K       G    G   QI  RE   G+Y+GL   V  ++P  A+
Sbjct: 54  PLDTIKVRMQLSKSRKAKGLKPLGFFATG--RQIAARETPLGLYKGLGAVVSGIVPKMAI 111

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
            F  +E  K +L + D     S                    P+ V+K RLQ Q
Sbjct: 112 RFASFEMYKGWLSNPDGSIS-SKATFLAGLGAGATEAVAVVTPMEVIKIRLQAQ 164



 Score = 38.9 bits (89), Expect = 0.20
 Identities = 28/92 (30%), Positives = 40/92 (43%), Gaps = 8/92 (8%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVH--------GLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPT 641
           V P++VIK R Q           +P+  N       IV       + EG+  +YRG+S T
Sbjct: 151 VTPMEVIKIRLQAQQHSLADPLDIPRYRNAAHAAFTIV-------REEGIATLYRGVSLT 203

Query: 642 VLALLPNWAVYFTIYEQLKSFLCSDDERHELS 737
            L    N  V FT Y+Q K +      +H+ S
Sbjct: 204 ALRQATNQGVNFTAYQQFKKWAMDFQPQHKES 235



>gb:RNI7580_1703883 Ribes nigrum mRNA for mitochondrial carrier
           protein.
          Length = 289

 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 33/120 (27%), Positives = 51/120 (42%), Gaps = 2/120 (1%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           + P+DV+K R Q+   P  G        +V  + ++   EG+   Y     TV+   P  
Sbjct: 109 ITPMDVVKQRLQLQSSPYKG--------VVDCVRRVLVEEGIGAFYASYRTTVVMNAPFT 160

Query: 666 AVYFTIYEQLKSFL--CSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGM 839
           AV+F  YE  K  L   S +  ++ ++                   PL VVKT+LQ QG+
Sbjct: 161 AVHFATYEATKKGLLEVSPETANDENLLVHATAGAAAGALAAVVTTPLDVVKTQLQCQGV 220



 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 35/114 (30%), Positives = 49/114 (42%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+D +KTR Q  G     +  +R +L  GS+ ++   EG  G+YRG+    L   P  AV
Sbjct: 17  PVDTLKTRIQAIGSCSAQSAGLRQAL--GSILKV---EGPAGLYRGIGAMGLGAGPAHAV 71

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
           YF++YE  K      D  +                       P+ VVK RLQ Q
Sbjct: 72  YFSVYEMCKETFSHGDPSNS---GAHAVSGVFATVASDAVITPMDVVKQRLQLQ 122



 Score = 40.8 bits (94), Expect = 0.053
 Identities = 26/93 (27%), Positives = 40/93 (43%)
 Frame = +3

Query: 426 KGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQRE 605
           + LL +                PLDV+KT+ Q  G+   G      S I   +  I ++ 
Sbjct: 185 ENLLVHATAGAAAGALAAVVTTPLDVVKTQLQCQGV--CGCDRFSSSSIQDVIGSIVKKN 242

Query: 606 GLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSF 704
           G  G+ RG  P +L   P  A+ ++ YE  K+F
Sbjct: 243 GYVGLMRGWIPRMLFHAPAAAICWSTYEASKTF 275



>gb:CR382135_1668366 Debaryomyces hansenii chromosome C of strain
           CBS767 of Debaryomyces hansenii.
          Length = 727

 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 32/119 (26%), Positives = 54/119 (45%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T V P+D++KTR Q      +   +          ++I + EGL+G+Y GL   ++ + P
Sbjct: 349 TVVYPIDLVKTRMQAQRHKAVYANSF------DCFKKIIKHEGLKGLYSGLGAQLVGVAP 402

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
             A+  T+ + ++     DD +  +S+                  NPL +VK RLQ QG
Sbjct: 403 EKAIKLTVNDLMRKIGTDDDGK--ISMNWEILAGMSAGGCQVIFTNPLEIVKIRLQMQG 459



 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 34/129 (26%), Positives = 56/129 (43%), Gaps = 12/129 (9%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLE-------QIFQREGLRGMYRGLSPT 641
           F  PL+++K R Q+ G        +  +L  G +        QI ++ G++G+Y+G +  
Sbjct: 444 FTNPLEIVKIRLQMQG-------GVSKALNPGEIPHKRLSAGQIIKQLGIKGLYKGATAC 496

Query: 642 VLALLPNWAVYFTIYEQLKSFLCSDD-----ERHELSIXXXXXXXXXXXXXXXXXXNPLW 806
           +L  +P  A+YF  Y  LK  L + D     ++H L                     P  
Sbjct: 497 LLRDVPFSAIYFPTYANLKRILFNFDPNDANKKHRLDSWQLLIAGALAGAPAAFFTTPAD 556

Query: 807 VVKTRLQTQ 833
           V+KTRLQ +
Sbjct: 557 VIKTRLQVE 565



>gb:CR382126_1658489 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 305

 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 31/114 (27%), Positives = 47/114 (41%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD IK R Q++           G +  G   +I++ EG    Y+GL   V+ + P  A+
Sbjct: 30  PLDTIKVRMQIYKNAVGSGVKAPGFIKTGG--EIYRNEGFLAFYKGLGAVVIGITPKMAI 87

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
            F+ YE  ++ L   +     +                   NP+ VVK RLQ Q
Sbjct: 88  RFSSYEFYRTLLADKETGKVSTGNTFIAGVGAGITEAVVVVNPMEVVKIRLQAQ 141



 Score = 46.6 bits (109), Expect = 0.001
 Identities = 36/120 (30%), Positives = 47/120 (39%), Gaps = 6/120 (5%)
 Frame = +3

Query: 486 VCPLDVIKTRFQ------VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVL 647
           V P++V+K R Q      V G PK  N        V +   I + EG   +YRG+S T  
Sbjct: 128 VNPMEVVKIRLQAQHLNPVEGAPKYKNA-------VQACYTIVKEEGFSALYRGVSLTAA 180

Query: 648 ALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
               N    FT+Y +LK FL     +  L                     PL  +KTRLQ
Sbjct: 181 RQATNQGANFTVYSKLKEFLQGYHNQEMLPSWETSLIGLISGAIGPFSNAPLDTIKTRLQ 240



>gb:AK007934_1154290 Mus musculus 10 day old male pancreas cDNA,
           RIKEN full-length enriched library, clone:1810062G21
           product:MITOCHONDRIAL CARRIER PROTEIN CGI-69 LONG FORM
           homolog [Homo sapiens], full insert
           sequence.>gb:AK078417_1172315 Mus musculus 12 days
           embryo male wolffian duct includes surrounding region
           cDNA, RIKEN full-length enriched library,
           clone:6720453G02 product:MITOCHONDRIAL CARRIER PROTEIN
           CGI-69 LONG FORM homolog [Homo sapiens], full insert
           sequence.
          Length = 359

 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 27/82 (32%), Positives = 42/82 (51%)
 Frame = +3

Query: 588 QIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXX 767
           +I + EG R ++ GL  T++  +P  A+YFT Y+QLK+FLC      +L           
Sbjct: 113 KIVRHEGTRTLWSGLPATLVMTVPATAIYFTAYDQLKAFLCGQSLTSDL--YAPMVAGAL 170

Query: 768 XXXXXXXXXNPLWVVKTRLQTQ 833
                    +PL +V+T+LQ Q
Sbjct: 171 ARMGTVTVVSPLELVRTKLQAQ 192



 Score = 42.4 bits (98), Expect = 0.018
 Identities = 33/145 (22%), Positives = 59/145 (40%)
 Frame = +3

Query: 393 AMTADAHGPSPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLI 572
           ++T+D + P   G L              T V PL++++T+ Q          ++    +
Sbjct: 156 SLTSDLYAPMVAGALARMGTV--------TVVSPLELVRTKLQAQ--------HVSYREL 199

Query: 573 VGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXX 752
             S++    + G R ++ G  PT L  +P  A+Y+  YE +KS+L     + + S+    
Sbjct: 200 ASSVQAAVTQGGWRSLWLGWGPTALRDVPFSALYWFNYELVKSWLSGLRPKDQTSVGISF 259

Query: 753 XXXXXXXXXXXXXXNPLWVVKTRLQ 827
                          P  VVKT+ Q
Sbjct: 260 VAGGISGMVAATLTLPFDVVKTQRQ 284



 Score = 35.4 bits (80), Expect = 2.2
 Identities = 22/78 (28%), Positives = 38/78 (48%), Gaps = 3/78 (3%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGS---LEQIFQREGLRGMYRGLSPTVLA 650
           T   P DV+KT+ Q+  L  +    ++   +  +   L +I    G RG++ G  P ++ 
Sbjct: 271 TLTLPFDVVKTQRQM-SLGAVEAVRVKPPRVDSTWLLLRRIRAESGTRGLFAGFLPRIIK 329

Query: 651 LLPNWAVYFTIYEQLKSF 704
             P+ A+  + YE  KSF
Sbjct: 330 AAPSCAIMISTYEFGKSF 347



>pir|T51158|T51158 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AF049236_1764026 Arabidopsis thaliana
           putative transmembrane protein G1p (AtG1), putative
           nuclear DNA-binding protein G2p (AtG2), Em1 protein
           (ATEM1), putative chlorophyll synthetase (AtG4),
           putative transmembrane protein G5p (AtG5), putative
           acyl-coA dehydrogenase (AtG6), and calcium dependent
           protein kinase genes, complete cds; and unknown genes.
          Length = 381

 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 33/119 (27%), Positives = 56/119 (47%), Gaps = 1/119 (0%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSL-IVGSLEQIFQREGLRGMYRGLSPTVLALL 656
           T   PLD IK   Q HG+ +LG  + + ++  + ++  I + EG++G ++G  P V+ +L
Sbjct: 103 TVTAPLDRIKLLMQTHGI-RLGQQSAKKAIGFIEAITLIAKEEGVKGYWKGNLPQVIRVL 161

Query: 657 PNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
           P  AV    YE  K+     D+  +LS+                   PL V++ RL  +
Sbjct: 162 PYSAVQLLAYESYKNLFKGKDD--QLSVIGRLAAGACAGMTSTLLTYPLDVLRLRLAVE 218



 Score = 45.1 bits (105), Expect = 0.003
 Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 1/83 (1%)
 Frame = +3

Query: 480 TFVC-PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALL 656
           T  C PLD ++ + Q+ G P           I  +   I  R+GL G+YRG  P  L  L
Sbjct: 292 TLTCYPLDTVRRQMQMRGTPYKS--------IPEAFAGIIDRDGLIGLYRGFLPNALKTL 343

Query: 657 PNWAVYFTIYEQLKSFLCSDDER 725
           PN ++  T ++ +K  + + +++
Sbjct: 344 PNSSIRLTTFDMVKRLIATSEKQ 366



>sp|P79110|TXTP_BOVIN Tricarboxylate transport protein,
           mitochondrial precursor (Citrate transport protein)
           (CTP) (Tricarboxylate carrier
           protein).>gb:BTMITRICP_1437240 B.taurus mRNA for
           mitochondrial tricarboxylate carrier protein.
          Length = 311

 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 40/146 (27%), Positives = 61/146 (41%), Gaps = 5/146 (3%)
 Frame = +3

Query: 405 DAHG--PSPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRF---QVHGLPKLGNTNIRGSL 569
           DA G   S +GLLC               VCP++ IK +F   Q    PK      RG  
Sbjct: 114 DAQGRLDSTRGLLCGLGAGVPEAV---VVVCPMETIKVKFIHDQTSASPKY-----RG-- 163

Query: 570 IVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXX 749
               + +I + +GL+G Y+GL+ TVL    N  + F +   L+++   D+    ++    
Sbjct: 164 FFHGVREIVREQGLKGTYQGLTATVLKQGSNQGIRFFVMTSLRNWYRGDNPNKPMNPLIT 223

Query: 750 XXXXXXXXXXXXXXXNPLWVVKTRLQ 827
                           PL V+KTR+Q
Sbjct: 224 GVFGAIAGAASVFGNTPLDVIKTRMQ 249



 Score = 38.9 bits (89), Expect = 0.20
 Identities = 26/72 (36%), Positives = 36/72 (50%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLDVIKTR Q     K  NT   G        QI + EGL+  Y+G  P +  +  + A+
Sbjct: 240 PLDVIKTRMQGLEAHKYRNTLDCGL-------QILRNEGLKAFYKGTVPRLGRVCLDVAI 292

Query: 672 YFTIYEQLKSFL 707
            F IY+++   L
Sbjct: 293 VFIIYDEVVKLL 304



>gb:BC064218_2553771 Xenopus tropicalis hypothetical protein
           MGC76123, mRNA (cDNA clone MGC:76123 IMAGE:5309058),
           complete cds.>gb:BC075453_2558556 Xenopus tropicalis
           hypothetical protein MGC76123, mRNA (cDNA clone
           MGC:89241 IMAGE:7018074), complete cds.
          Length = 341

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 37/142 (26%), Positives = 59/142 (41%), Gaps = 27/142 (19%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGLPKLGN----------------TNIRGSL----------IVGSL 584
           FV PLDV+K R Q    P +                  TN  G               + 
Sbjct: 33  FVTPLDVVKIRLQAQSKPFIKGKCFVYCNGLMDHLCLCTNGNGKAWYRAPGHFRGTTDAF 92

Query: 585 EQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLC-SDDERHELSIXXXXXXX 761
            QI + EG++ ++ GL PT++  +P   +YFT Y+QL+  L  S  ER E++        
Sbjct: 93  VQIIRNEGIKSLWSGLPPTLVMAVPATVIYFTCYDQLRDILIRSMPERAEIA---SLVAG 149

Query: 762 XXXXXXXXXXXNPLWVVKTRLQ 827
                      +PL +++T++Q
Sbjct: 150 ATARLWSATLISPLELIRTKMQ 171



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 29/118 (24%), Positives = 49/118 (41%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T + PL++I+T+ Q      L    +R  +     +    ++G   +++G  PTVL  +P
Sbjct: 158 TLISPLELIRTKMQYR---PLSYKELRQCI-----QSSVAKDGWLALWKGWGPTVLRDVP 209

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
             A+Y+  YE +K  LC      + +                    P  VVKTR Q +
Sbjct: 210 FSALYWHNYELVKQSLCQRYNTLQPTFAISFTAGAVSGSIAAIVTLPFDVVKTRRQVE 267



>gb:AY665293_1958598 Macaca fascicularis mitochondrial solute
           carrier family 25 member 19 mRNA, complete cds; nuclear
           gene for mitochondrial product.
          Length = 320

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 25/71 (35%), Positives = 43/71 (60%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           V P+DV++TRF   G PK+ NT      +  ++  +++ EG +  Y+GL+PT++A+ P  
Sbjct: 136 VHPVDVLRTRFAAQGEPKVYNT------LRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYA 189

Query: 666 AVYFTIYEQLK 698
            + F+ Y  LK
Sbjct: 190 GLQFSCYSSLK 200



 Score = 38.9 bits (89), Expect = 0.20
 Identities = 30/118 (25%), Positives = 45/118 (38%), Gaps = 1/118 (0%)
 Frame = +3

Query: 486 VCPLDVIKTRFQV-HGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           + P DVIK RFQ+ H      + N +   I  +  QI Q EGL   ++G  P  +  +  
Sbjct: 33  ISPFDVIKIRFQLQHERLSRRDPNAKYHGIFQASRQILQEEGLTAFWKGHIPAQILSIGY 92

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
            AV F  +E L   +                             +P+ V++TR   QG
Sbjct: 93  GAVQFLSFEMLTELVHRGSVYDAREFSVHFVCGGLAACTATLTVHPVDVLRTRFAAQG 150



 Score = 38.1 bits (87), Expect = 0.34
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 4/82 (4%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQV----HGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVL 647
           T   PLD+ K R QV    H     G    R   ++   +Q+ Q+EG  G ++GLSP++L
Sbjct: 232 TLTYPLDLFKKRLQVGGFEHARAAFGQVR-RYKGLMDCAKQVLQKEGALGFFKGLSPSLL 290

Query: 648 ALLPNWAVYFTIYEQLKSFLCS 713
               +    F  YE    F C+
Sbjct: 291 KAALSTGFMFFWYE----FFCN 308



>gb:AK054901_1911376 Homo sapiens cDNA FLJ30339 fis, clone
           BRACE2007401, moderately similar to Oryctolagus
           cuniculus peroxisomal Ca-dependent solute carrier mRNA.
          Length = 384

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 24/76 (31%), Positives = 44/76 (57%), Gaps = 4/76 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    + G P+L         ++G L  I  +EG+RG+YRG++P  + ++P
Sbjct: 312 PLALVRTRMQAQASIEGGPQLS--------MLGLLRHILSQEGMRGLYRGIAPNFMKVIP 363

Query: 660 NWAVYFTIYEQLKSFL 707
             ++ + +YE +K  L
Sbjct: 364 AVSISYVVYENMKQAL 379



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 31/125 (24%), Positives = 52/125 (41%), Gaps = 2/125 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T + P++V+KTR  +    +          ++    +I +REG R  YRG  P VL ++P
Sbjct: 211 TIIYPMEVLKTRLTLRRTGQYKG-------LLDCARRILEREGPRAFYRGYLPNVLGIIP 263

Query: 660 NWAVYFTIYEQLKSFLCS--DDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
              +   +YE LK++       +  +  I                   PL +V+TR+Q Q
Sbjct: 264 YAGIDLAVYETLKNWWLQQYSHDSADPGILVLLACGTISSTCGQIASYPLALVRTRMQAQ 323

Query: 834 GMRAG 848
               G
Sbjct: 324 ASIEG 328



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 34/115 (29%), Positives = 47/115 (40%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVH   K    NI     +G L  +    G+R ++RG    VL + P
Sbjct: 117 TGTAPLDRLKVFMQVHA-SKTNRLNI-----LGGLRSMVLEGGIRSLWRGNGINVLKIAP 170

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRL 824
             A+ F  YEQ+K  +    E   L +                   P+ V+KTRL
Sbjct: 171 ESAIKFMAYEQIKRAILGQQE--TLHVQERFVAGSLAGATAQTIIYPMEVLKTRL 223



>gb:AJ619962_1907003 Homo sapiens partial mRNA for mitochondrial
           ATP-Mg/Pi carrier isoform 2, (SLC25A23
           gene).>gb:AJ619988_1907006 Homo sapiens mRNA for small
           calcium-binding mitochondrial carrier 3 (SCAMC-3
           gene).>gb:AY750170_1961662 Homo sapiens mitochondrial
           Ca2+-dependent solute carrier protein 2 (SLC25A23) mRNA,
           complete cds; nuclear gene for mitochondrial product.
          Length = 468

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 24/76 (31%), Positives = 44/76 (57%), Gaps = 4/76 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    + G P+L         ++G L  I  +EG+RG+YRG++P  + ++P
Sbjct: 396 PLALVRTRMQAQASIEGGPQLS--------MLGLLRHILSQEGMRGLYRGIAPNFMKVIP 447

Query: 660 NWAVYFTIYEQLKSFL 707
             ++ + +YE +K  L
Sbjct: 448 AVSISYVVYENMKQAL 463



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 31/125 (24%), Positives = 52/125 (41%), Gaps = 2/125 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T + P++V+KTR  +    +          ++    +I +REG R  YRG  P VL ++P
Sbjct: 295 TIIYPMEVLKTRLTLRRTGQYKG-------LLDCARRILEREGPRAFYRGYLPNVLGIIP 347

Query: 660 NWAVYFTIYEQLKSFLCS--DDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
              +   +YE LK++       +  +  I                   PL +V+TR+Q Q
Sbjct: 348 YAGIDLAVYETLKNWWLQQYSHDSADPGILVLLACGTISSTCGQIASYPLALVRTRMQAQ 407

Query: 834 GMRAG 848
               G
Sbjct: 408 ASIEG 412



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 34/115 (29%), Positives = 47/115 (40%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVH   K    NI     +G L  +    G+R ++RG    VL + P
Sbjct: 201 TGTAPLDRLKVFMQVHA-SKTNRLNI-----LGGLRSMVLEGGIRSLWRGNGINVLKIAP 254

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRL 824
             A+ F  YEQ+K  +    E   L +                   P+ V+KTRL
Sbjct: 255 ESAIKFMAYEQIKRAILGQQE--TLHVQERFVAGSLAGATAQTIIYPMEVLKTRL 307



>gb:CR382132_1664986 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 338

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 26/78 (33%), Positives = 45/78 (57%), Gaps = 2/78 (2%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSL--IVGSLEQIFQREGLRGMYRGLSPTVLAL 653
           T   P DV++ RFQV  +P      ++G+   +  +++ I + EG++GMY+GLS  +L +
Sbjct: 258 TVTYPFDVLRRRFQVVAMPDPKLKEMQGNYTSVWSAIKSIIRAEGIKGMYKGLSANLLKV 317

Query: 654 LPNWAVYFTIYEQLKSFL 707
            P+ A  +  YE +K  L
Sbjct: 318 APSMASSWLSYELVKDAL 335



 Score = 40.8 bits (94), Expect = 0.053
 Identities = 20/69 (28%), Positives = 38/69 (55%), Gaps = 3/69 (4%)
 Frame = +3

Query: 492 PLDVIKTRFQVH--GLPKLGNTNIRGSLIVGSLEQIFQREG-LRGMYRGLSPTVLALLPN 662
           PLD+++TR  +    +    N N++   +   + +I++ EG  R +YRG+ PT + + P 
Sbjct: 158 PLDIVRTRLSIQTADIGTFANRNVKPPGMWQVMCEIYRNEGGFRALYRGIIPTTMGVAPY 217

Query: 663 WAVYFTIYE 689
             + F +YE
Sbjct: 218 VGLNFAVYE 226



>gb:CR382130_1663399 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 660

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 34/117 (29%), Positives = 49/117 (41%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           F  PL+++K R Q+ G         + S I      I +  GL G+Y+G S  +L  +P 
Sbjct: 428 FTNPLEIVKIRLQIQGEVAKHTDAPKRSAI-----WIVRNLGLVGLYKGASACLLRDVPF 482

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
            A+YF  Y  LK     +   H+L I                   P  V+KTRLQ +
Sbjct: 483 SAIYFPTYAHLKKDYFGEGPNHKLPIWQLLVAGAVAGMPAAYLTTPCDVIKTRLQVE 539



 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 32/119 (26%), Positives = 55/119 (46%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T V P+D++KTR Q       G   +  +      +++  REG RG+Y GL P ++ + P
Sbjct: 328 TVVYPIDMVKTRMQNQRASTPGQQLLYKNSW-DCFKKVIAREGPRGLYSGLGPQLVGVAP 386

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
             A+  T+ + ++    + D+   +++                  NPL +VK RLQ QG
Sbjct: 387 EKAIKLTVNDLVRG--KAADKNGNITLPWEIIAGGTAGACQVVFTNPLEIVKIRLQIQG 443



>gb:CR380952_1650553 Candida glabrata strain CBS138 chromosome F
           complete sequence.
          Length = 368

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 37/121 (30%), Positives = 57/121 (47%), Gaps = 7/121 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGL---PKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           P +V+KTR Q+ G    P   N+      +  ++  I++ EG+  ++ G   T+   LP 
Sbjct: 168 PSEVLKTRLQLQGCYNNPHF-NSGYNYKSLRNAIATIYRTEGVAALFFGYKATLARDLPF 226

Query: 663 WAVYFTIYEQLK--SFLCS--DDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQT 830
            A+ F  YE+ +  +FL    D  +H+LSI                   PL VVKTR+QT
Sbjct: 227 SALQFAFYEKFRQWAFLLEGKDIYKHDLSISNEIVTGACAGGLAGILTTPLDVVKTRVQT 286

Query: 831 Q 833
           Q
Sbjct: 287 Q 287



 Score = 37.4 bits (85), Expect = 0.59
 Identities = 33/115 (28%), Positives = 49/115 (42%), Gaps = 1/115 (0%)
 Frame = +3

Query: 495 LDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLR-GMYRGLSPTVLALLPNWAV 671
           LD +KTR Q  G P +     +   ++ +   +F  EG R G+Y G    +L   P+ A+
Sbjct: 74  LDTVKTRQQ--GAPNVH----KYKHMLQAYRTMFIEEGFRRGLYGGYCAAMLGSFPSAAI 127

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
           +F+ YE  K  + +D   H                       P  V+KTRLQ QG
Sbjct: 128 FFSTYEFTKRTMIND--YHLNDTFSHLTAGFLGDFFSSFVYVPSEVLKTRLQLQG 180



>gb:AY086597_1571644 Arabidopsis thaliana clone 260615 mRNA,
           complete sequence.
          Length = 330

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 25/75 (33%), Positives = 43/75 (57%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD+++   Q+ G+   G   +  + ++G+L++I Q EG RG+YRG+ P    ++P
Sbjct: 250 TATFPLDLVRRTKQLEGIG--GRAVVYKTGLLGTLKRIVQTEGARGLYRGILPEYYKVVP 307

Query: 660 NWAVYFTIYEQLKSF 704
              + F  YE LK +
Sbjct: 308 GVGICFMTYETLKLY 322



 Score = 45.1 bits (105), Expect = 0.003
 Identities = 32/116 (27%), Positives = 53/116 (45%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD+++TR             I  S I  +L  I   EG+ G+Y+GL  T++ + P+ A+
Sbjct: 159 PLDLVRTRLAAQ------TKVIYYSGIWHTLRSITTDEGILGLYKGLGTTLVGVGPSIAI 212

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGM 839
            F++YE L+S+  S    H+  I                   PL +V+   Q +G+
Sbjct: 213 SFSVYESLRSYWRS-TRPHDSPIMVSLACGSLSGIASSTATFPLDLVRRTKQLEGI 267



 Score = 40.0 bits (92), Expect(2) = 0.023
 Identities = 36/127 (28%), Positives = 52/127 (40%), Gaps = 9/127 (7%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTN---IRGSLIVGSLEQIFQREGLRGMYRGLSPTVLA 650
           T   PL  +   FQV G+    +TN   +R   I+    +I   EGL+  ++G   T+  
Sbjct: 48  TCTAPLSRLTILFQVQGM----HTNAAALRKPSILHEASRILNEEGLKAFWKGNLVTIAH 103

Query: 651 LLPNWAVYFTIYEQLKSF--LCSDDERHELSIXX----XXXXXXXXXXXXXXXXNPLWVV 812
            LP  +V F  YE  K F  + +  E H+ SI                       PL +V
Sbjct: 104 RLPYSSVNFYAYEHYKKFMYMVTGMENHKESISSNLFVHFVAGGLAGITAASATYPLDLV 163

Query: 813 KTRLQTQ 833
           +TRL  Q
Sbjct: 164 RTRLAAQ 170



 Score = 21.2 bits (43), Expect(2) = 0.023
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = +2

Query: 857 GTLSALRRIAREKGILGLF 913
           G    LR I  ++GILGL+
Sbjct: 178 GIWHTLRSITTDEGILGLY 196



>gb:AX817352_1475896 Sequence 100 from Patent WO02081517.
          Length = 468

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 24/76 (31%), Positives = 44/76 (57%), Gaps = 4/76 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    + G P+L         ++G L  I  +EG+RG+YRG++P  + ++P
Sbjct: 396 PLALVRTRMQAQASIEGGPQLS--------MLGLLRHILSQEGMRGLYRGIAPNFMKVIP 447

Query: 660 NWAVYFTIYEQLKSFL 707
             ++ + +YE +K  L
Sbjct: 448 AVSISYVVYENMKQAL 463



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 31/125 (24%), Positives = 52/125 (41%), Gaps = 2/125 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T + P++V+KTR  +    +          ++    +I +REG R  YRG  P VL ++P
Sbjct: 295 TIIYPMEVLKTRLTLRRTGQYKG-------LLDCARRILEREGPRAFYRGYLPNVLGIIP 347

Query: 660 NWAVYFTIYEQLKSFLCS--DDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
              +   +YE LK++       +  +  I                   PL +V+TR+Q Q
Sbjct: 348 YAGIDLAVYEVLKNWWLQQYSHDSADPGILVLLACGTISSTCGQIASYPLALVRTRMQAQ 407

Query: 834 GMRAG 848
               G
Sbjct: 408 ASIEG 412



 Score = 43.1 bits (100), Expect = 0.011
 Identities = 33/115 (28%), Positives = 47/115 (40%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVH   K    NI     +G L  +    G+R ++RG    VL + P
Sbjct: 201 TGTAPLDRLKVFIQVHA-SKTNRLNI-----LGGLRSMVLEGGIRCLWRGNGINVLKIAP 254

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRL 824
             A+ F  YEQ++  +    E   L +                   P+ V+KTRL
Sbjct: 255 ESAIKFMAYEQVRRAILGQQE--TLHVQERFVAGSLAGATAQTIIYPMEVLKTRL 307



>gb:CQ783884_1452675 Sequence 4024 from Patent
           EP1396543.>gb:AK075239_1912978 Homo sapiens cDNA
           FLJ90758 fis, clone SKNMC1000082, weakly similar to
           BRITTLE-1 PROTEIN PRECURSOR.
          Length = 320

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 25/71 (35%), Positives = 43/71 (60%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           V P+DV++TRF   G PK+ NT      +  ++  +++ EG +  Y+GL+PT++A+ P  
Sbjct: 136 VHPVDVLRTRFAAQGEPKVYNT------LRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYA 189

Query: 666 AVYFTIYEQLK 698
            + F+ Y  LK
Sbjct: 190 GLQFSCYSSLK 200



 Score = 38.5 bits (88), Expect = 0.26
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 4/82 (4%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQV----HGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVL 647
           T   PLD+ K R QV    H     G    R   ++   +Q+ Q+EG  G ++GLSP++L
Sbjct: 232 TLTYPLDLFKKRLQVGGFEHARAAFGQVR-RYKGLMDCAKQVLQKEGALGFFKGLSPSLL 290

Query: 648 ALLPNWAVYFTIYEQLKSFLCS 713
               +    F  YE    F C+
Sbjct: 291 KAALSTGFMFFSYE----FFCN 308



 Score = 37.7 bits (86), Expect = 0.45
 Identities = 29/118 (24%), Positives = 46/118 (38%), Gaps = 1/118 (0%)
 Frame = +3

Query: 486 VCPLDVIKTRFQV-HGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           + P DVIK RFQ+ H      + + +   I+ +  QI Q EG    ++G  P  +  +  
Sbjct: 33  ISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGY 92

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
            AV F  +E L   +        L                    +P+ V++TR   QG
Sbjct: 93  GAVQFLSFEMLTELVHRGSVYDALEFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQG 150



>gb:CQ782543_1452030 Sequence 2683 from Patent
           EP1396543.>gb:AK074579_1912557 Homo sapiens cDNA
           FLJ90098 fis, clone HEMBA1005945, weakly similar to
           Oryctolagus cuniculus peroxisomal Ca-dependent solute
           carrier mRNA.
          Length = 208

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 24/76 (31%), Positives = 44/76 (57%), Gaps = 4/76 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQ----VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +++TR Q    + G P+L         ++G L  I  +EG+RG+YRG++P  + ++P
Sbjct: 136 PLALVRTRMQAQASIEGGPQLS--------MLGLLRHILSQEGMRGLYRGIAPNFMKVIP 187

Query: 660 NWAVYFTIYEQLKSFL 707
             ++ + +YE +K  L
Sbjct: 188 AVSISYVVYENMKQAL 203



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 31/125 (24%), Positives = 52/125 (41%), Gaps = 2/125 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T + P++V+KTR  +    +          ++    +I +REG R  YRG  P VL ++P
Sbjct: 35  TIIYPMEVLKTRLTLRRTGQYKG-------LLDCARRILEREGPRAFYRGYLPNVLGIIP 87

Query: 660 NWAVYFTIYEQLKSFLCS--DDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
              +   +YE LK++       +  +  I                   PL +V+TR+Q Q
Sbjct: 88  YAGIDLAVYETLKNWWLQQYSHDSADPGILVLLACGTISSTCGQIASYPLALVRTRMQAQ 147

Query: 834 GMRAG 848
               G
Sbjct: 148 ASIEG 152



>gb:DMEY18197_1379514 Drosophila melanogaster mRNA for mitochondrial
           carrier protein ARALAR1.
          Length = 682

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 33/120 (27%), Positives = 54/120 (45%), Gaps = 1/120 (0%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPK-LGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALL 656
           T V P+D++KTR Q       +G    R S      +++ + EG  G+YRGL P ++ + 
Sbjct: 345 TVVYPIDLVKTRMQNQRAGSYIGEVAYRNSW--DCFKKVVRHEGFMGLYRGLLPQLMGVA 402

Query: 657 PNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
           P  A+  T+ + ++  L   D++  +                    NPL +VK RLQ  G
Sbjct: 403 PEKAIKLTVNDLVRDKL--TDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQVAG 460



 Score = 41.2 bits (95), Expect = 0.041
 Identities = 34/116 (29%), Positives = 49/116 (42%), Gaps = 1/116 (0%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           F  PL+++K R QV G    G+  IR   +V  L       GL G+Y+G    +L  +P 
Sbjct: 445 FTNPLEIVKIRLQVAGEIASGS-KIRAWSVVREL-------GLFGLYKGARACLLRDVPF 496

Query: 663 WAVYFTIYEQLKSFLC-SDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
            A+YF  Y   K+ +   D   H L++                   P   +KTRLQ
Sbjct: 497 SAIYFPTYAHTKAMMADKDGYNHPLTL---LAAGAIAGVPAASLVTPADAIKTRLQ 549



 Score = 37.0 bits (84), Expect = 0.77
 Identities = 34/117 (29%), Positives = 48/117 (41%), Gaps = 1/117 (0%)
 Frame = +3

Query: 369 FDSIAVDLAMTADAHGPS-PKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLG 545
           F + A   AM AD  G + P  LL              + V P D IKTR QV  + + G
Sbjct: 501 FPTYAHTKAMMADKDGYNHPLTLLA---AGAIAGVPAASLVTPADAIKTRLQV--VARSG 555

Query: 546 NTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD 716
            T   G  +  + ++I   EG R  ++G +  V    P + V    YE L+     D
Sbjct: 556 QTTYTG--VWDATKKIMAEEGPRAFWKGTAARVFRSSPQFGVTLVTYELLQRLFYVD 610



>gb:AK077159_1171700 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4933415J19
           product:ornithine transporter 2, full insert
           sequence.>gb:AF332006_2063430 Mus musculus mutant
           ornithine transporter 2 (Ornt2) mRNA, complete cds.
          Length = 265

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 32/119 (26%), Positives = 53/119 (44%), Gaps = 1/119 (0%)
 Frame = +3

Query: 486 VCPLDVIKTRFQ-VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           +CP +++K R Q ++ +   G      + I   ++ IF ++G  G YRGLS T+   +P 
Sbjct: 88  LCPTELVKCRLQTMYEMKMSGKIAQSYNTIWSMVKSIFMKDGPLGFYRGLSTTLAQEIPG 147

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGM 839
           +  YF  YE  +SF  S   + EL                     P+  +K+R+Q   M
Sbjct: 148 YFFYFGGYEISRSFFASGGSKDELGPVPLMLSGGFAGICLWLIIFPVDCIKSRIQVLSM 206



 Score = 37.4 bits (85), Expect = 0.59
 Identities = 21/81 (25%), Positives = 42/81 (51%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           + P+D IK+R QV  L   G    + + ++ +   + + EG+  +Y GL  T++  +P+ 
Sbjct: 191 IFPVDCIKSRIQV--LSMFG----KPAGLIETFISVVRNEGISALYSGLKATLIRAIPSN 244

Query: 666 AVYFTIYEQLKSFLCSDDERH 728
           A  F +YE  +  + +  E +
Sbjct: 245 AALFLVYEYSRKMMMNMVEEY 265



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 22/82 (26%), Positives = 36/82 (43%), Gaps = 3/82 (3%)
 Frame = +3

Query: 594 FQREGLRGMYRGLSPTVLALLPNWAVYFTIY---EQLKSFLCSDDERHELSIXXXXXXXX 764
           + + G+RG+YRG SP +LA +   +V F  +   +Q    +   ++  EL+         
Sbjct: 19  YNQVGIRGLYRGTSPALLAYVTQGSVLFMCFGFCQQFVRKVARVEQNAELNDLETATAGS 78

Query: 765 XXXXXXXXXXNPLWVVKTRLQT 830
                      P  +VK RLQT
Sbjct: 79  LASAFAALALCPTELVKCRLQT 100



>gb:AE014297_1142184 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE014297_1142185 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE003774_1224177
           Drosophila melanogaster chromosome 3R, section 112 of
           118 of the complete sequence.>gb:AE003774_1224178
           Drosophila melanogaster chromosome 3R, section 112 of
           118 of the complete sequence.>gb:AY058654_1291808
           Drosophila melanogaster LD35441 full length cDNA.
          Length = 682

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 33/120 (27%), Positives = 54/120 (45%), Gaps = 1/120 (0%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPK-LGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALL 656
           T V P+D++KTR Q       +G    R S      +++ + EG  G+YRGL P ++ + 
Sbjct: 345 TVVYPIDLVKTRMQNQRAGSYIGEVAYRNSW--DCFKKVVRHEGFMGLYRGLLPQLMGVA 402

Query: 657 PNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
           P  A+  T+ + ++  L   D++  +                    NPL +VK RLQ  G
Sbjct: 403 PEKAIKLTVNDLVRDKL--TDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQVAG 460



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 35/116 (30%), Positives = 50/116 (43%), Gaps = 1/116 (0%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           F  PL+++K R QV G    G+  IR   +V  L       GL G+Y+G    +L  +P 
Sbjct: 445 FTNPLEIVKIRLQVAGEIASGS-KIRAWSVVREL-------GLFGLYKGARACLLRDVPF 496

Query: 663 WAVYFTIYEQLKSFLC-SDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
            A+YF  Y   K+ +   D   H L++                   P  V+KTRLQ
Sbjct: 497 SAIYFPTYAHTKAMMADKDGYNHPLTL---LAAGAIAGVPAASLVTPADVIKTRLQ 549



 Score = 38.5 bits (88), Expect = 0.26
 Identities = 35/117 (29%), Positives = 49/117 (41%), Gaps = 1/117 (0%)
 Frame = +3

Query: 369 FDSIAVDLAMTADAHGPS-PKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLG 545
           F + A   AM AD  G + P  LL              + V P DVIKTR QV  + + G
Sbjct: 501 FPTYAHTKAMMADKDGYNHPLTLLA---AGAIAGVPAASLVTPADVIKTRLQV--VARSG 555

Query: 546 NTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD 716
            T   G  +  + ++I   EG R  ++G +  V    P + V    YE L+     D
Sbjct: 556 QTTYTG--VWDATKKIMAEEGPRAFWKGTAARVFRSSPQFGVTLVTYELLQRLFYVD 610



>gb:AE014297_1142183 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003774_1224176 Drosophila melanogaster
           chromosome 3R, section 112 of 118 of the complete
           sequence.
          Length = 679

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 33/120 (27%), Positives = 54/120 (45%), Gaps = 1/120 (0%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPK-LGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALL 656
           T V P+D++KTR Q       +G    R S      +++ + EG  G+YRGL P ++ + 
Sbjct: 342 TVVYPIDLVKTRMQNQRAGSYIGEVAYRNSW--DCFKKVVRHEGFMGLYRGLLPQLMGVA 399

Query: 657 PNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
           P  A+  T+ + ++  L   D++  +                    NPL +VK RLQ  G
Sbjct: 400 PEKAIKLTVNDLVRDKL--TDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQVAG 457



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 35/116 (30%), Positives = 50/116 (43%), Gaps = 1/116 (0%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           F  PL+++K R QV G    G+  IR   +V  L       GL G+Y+G    +L  +P 
Sbjct: 442 FTNPLEIVKIRLQVAGEIASGS-KIRAWSVVREL-------GLFGLYKGARACLLRDVPF 493

Query: 663 WAVYFTIYEQLKSFLC-SDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
            A+YF  Y   K+ +   D   H L++                   P  V+KTRLQ
Sbjct: 494 SAIYFPTYAHTKAMMADKDGYNHPLTL---LAAGAIAGVPAASLVTPADVIKTRLQ 546



 Score = 38.5 bits (88), Expect = 0.26
 Identities = 35/117 (29%), Positives = 49/117 (41%), Gaps = 1/117 (0%)
 Frame = +3

Query: 369 FDSIAVDLAMTADAHGPS-PKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLG 545
           F + A   AM AD  G + P  LL              + V P DVIKTR QV  + + G
Sbjct: 498 FPTYAHTKAMMADKDGYNHPLTLLA---AGAIAGVPAASLVTPADVIKTRLQV--VARSG 552

Query: 546 NTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD 716
            T   G  +  + ++I   EG R  ++G +  V    P + V    YE L+     D
Sbjct: 553 QTTYTG--VWDATKKIMAEEGPRAFWKGTAARVFRSSPQFGVTLVTYELLQRLFYVD 607



>sp|Q9HC21|DNC_HUMAN Mitochondrial deoxynucleotide carrier
           (Mitochondrial uncoupling protein
           1).>gb:HSM804700_1187253 Homo sapiens mRNA; cDNA
           DKFZp667O1614 (from clone
           DKFZp667O1614).>gb:AF182404_1888487 Homo sapiens
           mitochondrial uncoupling protein 1 mRNA, complete
           cds.>gb:BC001075_1967268 Homo sapiens solute carrier
           family 25 (mitochondrial deoxynucleotide carrier),
           member 19, mRNA (cDNA clone MGC:2707 IMAGE:2821142),
           complete cds.>gb:BC005120_1969613 Homo sapiens solute
           carrier family 25 (mitochondrial deoxynucleotide
           carrier), member 19, mRNA (cDNA clone MGC:4334
           IMAGE:2821142), complete cds.>gb:HSA251857_2001674 Homo
           sapiens mRNA for deoxynucleotide carrier (DNC
           gene).>gb:HSA301616_2003400 Homo sapiens DNC gene for
           deoxynucleotide carrier, exons 1-9.
          Length = 320

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 25/71 (35%), Positives = 43/71 (60%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           V P+DV++TRF   G PK+ NT      +  ++  +++ EG +  Y+GL+PT++A+ P  
Sbjct: 136 VHPVDVLRTRFAAQGEPKVYNT------LRHAVGTMYRSEGPQVFYKGLAPTLIAIFPYA 189

Query: 666 AVYFTIYEQLK 698
            + F+ Y  LK
Sbjct: 190 GLQFSCYSSLK 200



 Score = 38.5 bits (88), Expect = 0.26
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 4/82 (4%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQV----HGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVL 647
           T   PLD+ K R QV    H     G    R   ++   +Q+ Q+EG  G ++GLSP++L
Sbjct: 232 TLTYPLDLFKKRLQVGGFEHARAAFGQVR-RYKGLMDCAKQVLQKEGALGFFKGLSPSLL 290

Query: 648 ALLPNWAVYFTIYEQLKSFLCS 713
               +    F  YE    F C+
Sbjct: 291 KAALSTGFMFFSYE----FFCN 308



 Score = 35.4 bits (80), Expect = 2.2
 Identities = 28/118 (23%), Positives = 45/118 (38%), Gaps = 1/118 (0%)
 Frame = +3

Query: 486 VCPLDVIKTRFQV-HGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           + P DVIK RFQ+ H      + + +   I+ +  QI Q EG    ++G  P  +  +  
Sbjct: 33  ISPFDVIKIRFQLQHERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGY 92

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
            AV F  +E L   +                             +P+ V++TR   QG
Sbjct: 93  GAVQFLSFEMLTELVHRGSVYDAREFSVHFVCGGLAACMATLTVHPVDVLRTRFAAQG 150



>sp|Q9VA73|CMC1_DROME Calcium-binding mitochondrial carrier
           Aralar1.>gb:AE014297_1142182 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE003774_1224175
           Drosophila melanogaster chromosome 3R, section 112 of
           118 of the complete sequence.
          Length = 695

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 33/120 (27%), Positives = 54/120 (45%), Gaps = 1/120 (0%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPK-LGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALL 656
           T V P+D++KTR Q       +G    R S      +++ + EG  G+YRGL P ++ + 
Sbjct: 358 TVVYPIDLVKTRMQNQRAGSYIGEVAYRNSW--DCFKKVVRHEGFMGLYRGLLPQLMGVA 415

Query: 657 PNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
           P  A+  T+ + ++  L   D++  +                    NPL +VK RLQ  G
Sbjct: 416 PEKAIKLTVNDLVRDKL--TDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQVAG 473



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 35/116 (30%), Positives = 50/116 (43%), Gaps = 1/116 (0%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           F  PL+++K R QV G    G+  IR   +V  L       GL G+Y+G    +L  +P 
Sbjct: 458 FTNPLEIVKIRLQVAGEIASGS-KIRAWSVVREL-------GLFGLYKGARACLLRDVPF 509

Query: 663 WAVYFTIYEQLKSFLC-SDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
            A+YF  Y   K+ +   D   H L++                   P  V+KTRLQ
Sbjct: 510 SAIYFPTYAHTKAMMADKDGYNHPLTL---LAAGAIAGVPAASLVTPADVIKTRLQ 562



 Score = 38.5 bits (88), Expect = 0.26
 Identities = 35/117 (29%), Positives = 49/117 (41%), Gaps = 1/117 (0%)
 Frame = +3

Query: 369 FDSIAVDLAMTADAHGPS-PKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLG 545
           F + A   AM AD  G + P  LL              + V P DVIKTR QV  + + G
Sbjct: 514 FPTYAHTKAMMADKDGYNHPLTLLA---AGAIAGVPAASLVTPADVIKTRLQV--VARSG 568

Query: 546 NTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD 716
            T   G  +  + ++I   EG R  ++G +  V    P + V    YE L+     D
Sbjct: 569 QTTYTG--VWDATKKIMAEEGPRAFWKGTAARVFRSSPQFGVTLVTYELLQRLFYVD 623



>sp|Q21153|CMC1_CAEEL Probable calcium-binding mitochondrial carrier
           K02F3.2.>pir|T16533|T16533 hypothetical protein K02F3.2
           - Caenorhabditis elegans>gb:U00052_1401546
           Caenorhabditis elegans cosmid K02F3, complete sequence.
          Length = 702

 Score = 49.3 bits (116), Expect = 1e-04
 Identities = 34/121 (28%), Positives = 56/121 (46%), Gaps = 2/121 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPK--LGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLAL 653
           T V P+D++KTR Q        +G    + SL     +++ + EGL G+YRGL P ++ +
Sbjct: 380 TAVYPIDLVKTRMQNQRTSGSFVGEVMYKNSL--DCFKKVVKFEGLLGLYRGLLPQIVGV 437

Query: 654 LPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
            P  A+  T+ + ++     D    ++ +                  NPL +VK RLQT 
Sbjct: 438 APEKAIKLTMNDYMRDKFTKDG---KIPLYGEIIAGGTGGMCQVVFTNPLEIVKIRLQTA 494

Query: 834 G 836
           G
Sbjct: 495 G 495



 Score = 38.1 bits (87), Expect = 0.34
 Identities = 35/122 (28%), Positives = 46/122 (37%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           F  PL+++K R Q  G  +     I    ++  L       G  G+Y+G     L  +P 
Sbjct: 480 FTNPLEIVKIRLQTAGEVQQAGKKIGVFTVLKEL-------GFLGLYKGSRACFLRDIPF 532

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMR 842
            A+YF  Y   K  L S DE    S                    P  V+KTRLQ    R
Sbjct: 533 SAIYFPAYAHAK--LASADEDGMNSPGTLFASAFIAGVPAAGLVTPADVIKTRLQV-AAR 589

Query: 843 AG 848
           AG
Sbjct: 590 AG 591



>gb:CR382139_1673004 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 368

 Score = 46.2 bits (108), Expect(2) = 2e-04
 Identities = 31/121 (25%), Positives = 54/121 (44%), Gaps = 5/121 (4%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGLPKLGNT-----NIRGSLIVGSLEQIFQREGLRGMYRGLSPTVL 647
           F  P +V+KTR Q+ G     +T     N +G  +  ++  I+++EG   +  G   T+ 
Sbjct: 161 FYVPSEVLKTRLQLQGRHNNPHTKGCGYNYKG--LTDAISSIWKKEGPSTLVFGYKETLF 218

Query: 648 ALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
             LP  A+ F  YE+++       + ++L +                   PL V+KTR+Q
Sbjct: 219 RDLPFSALQFAFYEKIRQLAIYYHKSNDLPVSIELFTGASAGGLAGILTTPLDVIKTRIQ 278

Query: 828 T 830
           T
Sbjct: 279 T 279



 Score = 41.2 bits (95), Expect = 0.041
 Identities = 29/83 (34%), Positives = 37/83 (44%), Gaps = 1/83 (1%)
 Frame = +3

Query: 591 IFQREGL-RGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXX 767
           IF+ EG  RG+Y G +P +L  LP+ A +F  YE  K  L   +E H             
Sbjct: 96  IFKEEGFFRGLYGGYTPAILGSLPSTAAFFGTYEYSKRKLI--NEFHFNETISYFISGVL 153

Query: 768 XXXXXXXXXNPLWVVKTRLQTQG 836
                     P  V+KTRLQ QG
Sbjct: 154 GDLASSIFYVPSEVLKTRLQLQG 176



 Score = 22.3 bits (46), Expect(2) = 2e-04
 Identities = 9/18 (50%), Positives = 13/18 (72%)
 Frame = +2

Query: 860 TLSALRRIAREKGILGLF 913
           T+ ALR I + +G+ GLF
Sbjct: 312 TIKALRSIYKIEGVFGLF 329



>gb:AC116920_1206416 Dictyostelium discoideum chromosome 2 map
           4415041-4520361 strain AX4, complete sequence.
          Length = 329

 Score = 45.4 bits (106), Expect(2) = 2e-04
 Identities = 34/118 (28%), Positives = 51/118 (43%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+ V+ TR Q++              IVG  + I + EG  G+Y+GL P  L L+ N +V
Sbjct: 147 PIWVVNTRLQINS----------DKGIVGQFKYIIKNEGFGGLYKGLIP-ALILVSNPSV 195

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMRA 845
            F  YE+L++       R +L                     P  +VK+RLQ+Q   A
Sbjct: 196 QFVSYEKLRALWRRQSGRTKLGGLEVFILGAIAKLIAGIVTYPYLLVKSRLQSQSGNA 253



 Score = 42.0 bits (97), Expect = 0.024
 Identities = 31/127 (24%), Positives = 49/127 (38%), Gaps = 5/127 (3%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGN-----TNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALL 656
           P   + TR QV    +        T +     + + ++I + E  R +Y GL   ++ + 
Sbjct: 40  PFSTVSTRLQVQQKKQQQGQQSEITTVPYKNSIDAFKRIIKEENWRTLYSGLKSALIGIG 99

Query: 657 PNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
            +  VY+  Y  LKS       + EL                     P+WVV TRLQ   
Sbjct: 100 ASSFVYYYWYTLLKSISLKLKNKQELGTIENLAIAALAGCANVLTTLPIWVVNTRLQINS 159

Query: 837 MRAGVVG 857
            + G+VG
Sbjct: 160 DK-GIVG 165



 Score = 23.1 bits (48), Expect(2) = 2e-04
 Identities = 9/20 (45%), Positives = 13/20 (65%)
 Frame = +2

Query: 854 RGTLSALRRIAREKGILGLF 913
           +GTL A+ +I +  G LG F
Sbjct: 264 KGTLDAIGKIFKSDGFLGFF 283



>gb:BC072926_2556850 Xenopus laevis MGC80420 protein, mRNA (cDNA
           clone MGC:80420 IMAGE:5155229), complete cds.
          Length = 291

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 34/126 (26%), Positives = 59/126 (46%), Gaps = 5/126 (3%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGN-TNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA 668
           P+D+ KTR QV G P       IR   ++ ++ +I++ EG++ +Y G++P +L       
Sbjct: 25  PIDLTKTRLQVQGQPNDAKYKEIRYRGMMHAIVRIWREEGVKALYSGIAPAMLRQASYGT 84

Query: 669 VYFTIYEQLKSFL--CSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG-- 836
           +    Y+ LK     C +DE    ++                  NP  V+K R+Q QG  
Sbjct: 85  IKIGTYQSLKRLFVDCPEDE----TLVLNAFCGVLSGVVSSCIANPTDVLKIRMQAQGNV 140

Query: 837 MRAGVV 854
           M+ G++
Sbjct: 141 MQGGMI 146



 Score = 40.0 bits (92), Expect = 0.090
 Identities = 24/70 (34%), Positives = 38/70 (54%), Gaps = 1/70 (1%)
 Frame = +3

Query: 492 PLDVIKTRFQ-VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA 668
           P+DV++TR      +    N++ +G+L    L Q ++ EG   +Y+G  P  L L P   
Sbjct: 220 PVDVVRTRMMNQRSIRDASNSSYKGTL--DCLLQTWKNEGFFALYKGFWPNWLRLGPWNI 277

Query: 669 VYFTIYEQLK 698
           ++F  YEQLK
Sbjct: 278 IFFITYEQLK 287



 Score = 40.0 bits (92), Expect = 0.090
 Identities = 33/139 (23%), Positives = 54/139 (38%)
 Frame = +3

Query: 417 PSPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIF 596
           P  + L+ N                P DV+K R Q  G        ++G +IV  +  I+
Sbjct: 101 PEDETLVLNAFCGVLSGVVSSCIANPTDVLKIRMQAQG------NVMQGGMIVNFIN-IY 153

Query: 597 QREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXX 776
           Q+EG RG+++G+S T         V   +Y+  K  L       + ++            
Sbjct: 154 QQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGD-TVYTHFLSSFTCGL 212

Query: 777 XXXXXXNPLWVVKTRLQTQ 833
                 NP+ VV+TR+  Q
Sbjct: 213 AGALASNPVDVVRTRMMNQ 231



>gb:BC066404_2554294 Danio rerio zgc:77454, mRNA (cDNA clone
           MGC:77454 IMAGE:6971504), complete cds.
          Length = 469

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 33/115 (28%), Positives = 49/115 (42%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVHG         +   ++  L Q+ +  G+R ++RG    V+ + P
Sbjct: 202 TCTAPLDRLKVLMQVHGCQG------KSMCLMSGLTQMIKEGGVRSLWRGNGINVIKIAP 255

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRL 824
             A+ F  YEQ+K  + S  E   L I                   P+ V+KTRL
Sbjct: 256 ETALKFMAYEQIKRVMGSSQE--TLGISERFVAGSLAGVIAQSTIYPMEVLKTRL 308



 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 25/72 (34%), Positives = 43/72 (59%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PL +I+TR Q     + G++ +    + G  +QI + EG  G+YRGL+P  L ++P  ++
Sbjct: 397 PLALIRTRMQAQASVE-GSSQVS---MTGLFKQIMKTEGPTGLYRGLTPNFLKVIPAVSI 452

Query: 672 YFTIYEQLKSFL 707
            + +YE +KS L
Sbjct: 453 SYVVYEHIKSTL 464



 Score = 38.9 bits (89), Expect = 0.20
 Identities = 30/123 (24%), Positives = 51/123 (41%), Gaps = 2/123 (1%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           + P++V+KTR     L K G    +G  I    + I + EG+   Y+G  P +L ++P  
Sbjct: 298 IYPMEVLKTRL---ALRKTGQ--YKG--ISDCAKHILKTEGMSAFYKGYVPNMLGIIPYA 350

Query: 666 AVYFTIYEQLKSFLCS--DDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGM 839
            +   +YE LK+        E  +  +                   PL +++TR+Q Q  
Sbjct: 351 GIDLAVYETLKNTWLQRYGTENADPGVFVLLACGTVSSTCGQLASYPLALIRTRMQAQAS 410

Query: 840 RAG 848
             G
Sbjct: 411 VEG 413



>gb:BC055226_2551305 Danio rerio zgc:63736, mRNA (cDNA clone
           MGC:63736 IMAGE:2639857), complete cds.
          Length = 359

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 29/99 (29%), Positives = 51/99 (51%)
 Frame = +3

Query: 546 NTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDER 725
           +T+  G+L   +  +I   EGLR ++ GL PT++  +P   +YFT Y+QL+ FLC     
Sbjct: 99  STHFSGTL--DAFVKITHNEGLRSLWSGLPPTLVMAVPATVIYFTCYDQLRDFLCYSMGY 156

Query: 726 HELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMR 842
           H   I                  +PL +V+T++Q++ ++
Sbjct: 157 HGDHI--PLIAGGLARLGAVSVISPLELVRTKMQSRRLQ 193



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 29/116 (25%), Positives = 51/116 (43%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           + PL++++T+ Q        +  ++ S ++  +     ++G   ++RG  PTVL  +P  
Sbjct: 177 ISPLELVRTKMQ--------SRRLQYSELMVCIRSSVAQDGWLSLWRGWGPTVLRDVPFS 228

Query: 666 AVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
           A+Y+  YE +K+ LC      + S                    P  VVKTR Q Q
Sbjct: 229 ALYWFNYELVKAQLCEHYRTPQASFTISFTAGAVSGAIAAVLTLPFDVVKTRRQIQ 284



>gb:AF123303_1884886 Homo sapiens calcium-binding transporter mRNA,
           partial cds.
          Length = 411

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 35/115 (30%), Positives = 48/115 (41%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVHG  K    NI      G   Q+ +  G+R ++RG    V+ + P
Sbjct: 203 TSTAPLDRLKIMMQVHG-SKSDKMNI-----FGGFRQMVKEGGIRSLWRGNGTNVIKIAP 256

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRL 824
             AV F  YEQ K  L   +E  ++                     P+ V+KTRL
Sbjct: 257 ETAVKFWAYEQYKKLL--TEEGQKIGTFERFISGSMAGATAQTFIYPMEVMKTRL 309



 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 33/120 (27%), Positives = 56/120 (46%), Gaps = 2/120 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           TF+ P++V+KTR  V      G T  + S I    ++I + EGL   Y+G  P +L ++P
Sbjct: 297 TFIYPMEVMKTRLAV------GKTG-QYSGIYDCAKKILKHEGLGAFYKGYVPNLLGIIP 349

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELS--IXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
              +   +YE LKS+   +  +  ++  +                   PL +V+TR+Q Q
Sbjct: 350 YAGIDLAVYELLKSYWLDNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQ 409



>gb:AP004869_1846306 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0419A09.
          Length = 476

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 36/127 (28%), Positives = 56/127 (44%), Gaps = 9/127 (7%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHG-----LPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTV 644
           T + P+D++KTR Q        +P LG  +            I+ +EG R  YRGL P++
Sbjct: 304 TAIYPIDLVKTRLQTFACGSGKIPSLGALS----------RDIWMQEGPRAFYRGLVPSL 353

Query: 645 LALLPNWAVYFTIYEQL----KSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVV 812
           L ++P   +  T+YE L    K+++  D +   L                     PL V+
Sbjct: 354 LGMVPYAGIDLTVYETLKEMSKTYVLKDSDPGPL---VQLGCGTVSGALGATCVYPLQVI 410

Query: 813 KTRLQTQ 833
           +TRLQ Q
Sbjct: 411 RTRLQAQ 417



 Score = 43.1 bits (100), Expect = 0.011
 Identities = 25/79 (31%), Positives = 40/79 (50%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T V PL VI+TR Q     +  N+      +     +  Q EG+ G Y+GL P +L ++P
Sbjct: 402 TCVYPLQVIRTRLQA----QRANSEAAYRGMSDVFWKTLQHEGISGFYKGLVPNLLKVVP 457

Query: 660 NWAVYFTIYEQLKSFLCSD 716
             ++ + +YE +K  L  D
Sbjct: 458 AASITYLVYETMKKSLSLD 476



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 32/127 (25%), Positives = 54/127 (42%), Gaps = 2/127 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QV        TN     ++ +++ I++   LRG +RG    V+ + P
Sbjct: 209 TATAPLDRLKVIMQVQ-------TN--RITVLQAVKDIWREGSLRGFFRGNGLNVVKVAP 259

Query: 660 NWAVYFTIYEQLKSFLCSD--DERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
             A+ F  YE LK ++     + + ++                     P+ +VKTRLQT 
Sbjct: 260 ESAIRFYAYEMLKEYIMKSKGENKSDIGTSGRLMAGGLAGAVAQTAIYPIDLVKTRLQTF 319

Query: 834 GMRAGVV 854
              +G +
Sbjct: 320 ACGSGKI 326



>gb:NCB13O20_1689219 Neurospora crassa DNA linkage group V BAC clone
           B13O20.
          Length = 351

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 28/76 (36%), Positives = 42/76 (55%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PL V++ R Q H   +L      G  I G + ++++ EG RG YRG+ P V+ +LP
Sbjct: 274 TATYPLQVMRARLQHHQADELF-----GRGIGGVVAKLWREEGFRGFYRGMMPGVVRVLP 328

Query: 660 NWAVYFTIYEQLKSFL 707
              V F +YE +K +L
Sbjct: 329 ATWVTFLVYENVKYYL 344



 Score = 39.7 bits (91), Expect = 0.12
 Identities = 35/146 (23%), Positives = 57/146 (39%), Gaps = 33/146 (22%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREG--LRGMYRGLSPTVLALLP 659
           V PLD++KTR QVH   +   TN   +L   S+ +   +    L  +YRGL+P ++    
Sbjct: 30  VHPLDIVKTRMQVH---RSSPTNPSAALTTVSVFRSLAQTDRPLAALYRGLTPNLIGNAT 86

Query: 660 NWAVYF---TIYEQLKSFLCSDDE----------------------------RHELSIXX 746
           +WA +F   + +E+L + L +                               +  LS   
Sbjct: 87  SWASFFFFKSRFERLIAHLKAPSSPPAPSHLGGEPTTLPQNVTPDRETQAQIKSHLSPTD 146

Query: 747 XXXXXXXXXXXXXXXXNPLWVVKTRL 824
                           NP+WV+KTR+
Sbjct: 147 FFAASLLAGAATQIITNPIWVLKTRM 172



 Score = 33.5 bits (75), Expect = 8.5
 Identities = 27/105 (25%), Positives = 45/105 (42%), Gaps = 17/105 (16%)
 Frame = +3

Query: 564 SLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSF------------- 704
           S+  G++ ++F+ EG+ G YRGL   +LA + + AV F +Y+  +               
Sbjct: 185 SMFTGAV-RLFRSEGILGFYRGLGVGMLA-ISHGAVQFAVYDPARRMYIASRDAKRRLAG 242

Query: 705 --LCSDDER--HELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
             + S+DER    +S                    PL V++ RLQ
Sbjct: 243 QEIASEDERESQRISNEATIVLSTAAKLVAGTATYPLQVMRARLQ 287



>gb:CR382131_1664907 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 319

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 25/72 (34%), Positives = 39/72 (54%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+D IKTR Q  G     N +   S       Q+  +EG R +Y+G++P ++ + P  AV
Sbjct: 233 PIDTIKTRMQREGGAATRNESGL-SRFTRITRQLIHQEGFRALYKGITPRIMRVAPGQAV 291

Query: 672 YFTIYEQLKSFL 707
            FT+YE ++  L
Sbjct: 292 TFTVYEYMRGVL 303



 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 36/121 (29%), Positives = 51/121 (42%), Gaps = 5/121 (4%)
 Frame = +3

Query: 486 VC-PLDVIKTRFQV----HGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLA 650
           VC PLD IK R Q+    HG+ ++G         V +   I ++EG   +Y+GL   V  
Sbjct: 28  VCHPLDTIKVRMQLTNRQHGVKEVG--------FVQTGVNIAKKEGPLALYKGLGAVVTG 79

Query: 651 LLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQT 830
           ++P  A+ FT YE  +  L   D     +                   NP  V+K RLQ 
Sbjct: 80  IVPKMAIRFTSYEYYRGLLTKPDGTIS-AFHTFIAGVGAGTTEAVLVVNPTEVIKIRLQA 138

Query: 831 Q 833
           Q
Sbjct: 139 Q 139



>gb:CEF17E5_1362631 Caenorhabditis elegans cosmid F17E5, complete
           sequence.
          Length = 531

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 21/72 (29%), Positives = 42/72 (58%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PL +++TR Q   +    +T  +   +VG  + I Q EG  G+YRG++P  + ++P  ++
Sbjct: 457 PLALVRTRLQARAISPKNST--QPDTMVGQFKHILQTEGFTGLYRGITPNFMKVIPAVSI 514

Query: 672 YFTIYEQLKSFL 707
            + +YE+++  L
Sbjct: 515 SYVVYEKVRKQL 526



 Score = 45.1 bits (105), Expect = 0.003
 Identities = 29/121 (23%), Positives = 53/121 (43%), Gaps = 1/121 (0%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T + P++V+KTR  +    +L       +       +++ +EG++  Y+G  P +L ++P
Sbjct: 356 TAIYPMEVMKTRLALRRTGQLDKGMFHFA------HKMYTKEGIKCFYKGYLPNLLGIIP 409

Query: 660 NWAVYFTIYEQLKSFLCSDDERH-ELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
              +  T+YE LKS        H E  +                   PL +V+TRLQ + 
Sbjct: 410 YAGIDLTVYESLKSMYTKYYTEHTEPGVLALLACGTCSSTCGQLASYPLALVRTRLQARA 469

Query: 837 M 839
           +
Sbjct: 470 I 470



 Score = 39.3 bits (90), Expect = 0.15
 Identities = 30/115 (26%), Positives = 46/115 (40%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   P D IK   QV+       TN  G  +V  +  +    G++  +RG    V+ + P
Sbjct: 260 TCTAPFDRIKVYLQVNST----KTNKLG--VVSCVHLLHAEGGIKSFWRGNGINVIKIAP 313

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRL 824
             A+ F  Y+Q+K ++       ELS                    P+ V+KTRL
Sbjct: 314 ESAMKFMCYDQIKRWMQEYKGGAELSTIERLLAGSSAGAISQTAIYPMEVMKTRL 368



>sp|Q19529|CMC3_CAEEL Probable calcium-binding mitochondrial carrier
           F17E5.2.
          Length = 565

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 21/72 (29%), Positives = 42/72 (58%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PL +++TR Q   +    +T  +   +VG  + I Q EG  G+YRG++P  + ++P  ++
Sbjct: 491 PLALVRTRLQARAISPKNST--QPDTMVGQFKHILQTEGFTGLYRGITPNFMKVIPAVSI 548

Query: 672 YFTIYEQLKSFL 707
            + +YE+++  L
Sbjct: 549 SYVVYEKVRKQL 560



 Score = 45.1 bits (105), Expect = 0.003
 Identities = 29/121 (23%), Positives = 53/121 (43%), Gaps = 1/121 (0%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T + P++V+KTR  +    +L       +       +++ +EG++  Y+G  P +L ++P
Sbjct: 390 TAIYPMEVMKTRLALRRTGQLDKGMFHFA------HKMYTKEGIKCFYKGYLPNLLGIIP 443

Query: 660 NWAVYFTIYEQLKSFLCSDDERH-ELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
              +  T+YE LKS        H E  +                   PL +V+TRLQ + 
Sbjct: 444 YAGIDLTVYESLKSMYTKYYTEHTEPGVLALLACGTCSSTCGQLASYPLALVRTRLQARA 503

Query: 837 M 839
           +
Sbjct: 504 I 504



 Score = 35.4 bits (80), Expect = 2.2
 Identities = 30/126 (23%), Positives = 46/126 (36%), Gaps = 11/126 (8%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKL-----------GNTNIRGSLIVGSLEQIFQREGLRGMYR 626
           T   P D IK   QV  L  L            +T      +V  +  +    G++  +R
Sbjct: 277 TCTAPFDRIKVYLQVMYLHLLFHIMFLKALQVNSTKTNKLGVVSCVHLLHAEGGIKSFWR 336

Query: 627 GLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLW 806
           G    V+ + P  A+ F  Y+Q+K ++       ELS                    P+ 
Sbjct: 337 GNGINVIKIAPESAMKFMCYDQIKRWMQEYKGGAELSTIERLLAGSSAGAISQTAIYPME 396

Query: 807 VVKTRL 824
           V+KTRL
Sbjct: 397 VMKTRL 402



>gb:BC045395_2549235 Danio rerio zgc:55596, mRNA (cDNA clone
           MGC:55596 IMAGE:2643533), complete cds.
          Length = 286

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 34/115 (29%), Positives = 48/115 (41%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+D+ KTR QV G         RG  +  +L +I + EG+R +Y G+SP +L       +
Sbjct: 25  PIDLTKTRLQVQGQTHCMEVRYRG--MFHALLRIGREEGVRALYSGISPALLRQASYGTI 82

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
               Y  LK    S  E   + I                  NP  V+K R+Q QG
Sbjct: 83  KIGTYNTLKKLFVSHPEEETMVI--NVFCGVVSGVLSSSLANPTDVLKIRMQAQG 135



 Score = 43.9 bits (102), Expect = 0.006
 Identities = 34/144 (23%), Positives = 58/144 (40%)
 Frame = +3

Query: 417 PSPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIF 596
           P  + ++ N            +   P DV+K R Q  G      + ++GS++  +   I+
Sbjct: 98  PEEETMVINVFCGVVSGVLSSSLANPTDVLKIRMQAQG------SLLQGSMM-SNFMNIY 150

Query: 597 QREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXX 776
           Q EG RG++RG+ PT         V   +Y+  K  L       + ++            
Sbjct: 151 QTEGTRGLWRGVIPTAQRAAIVVGVELPVYDITKKHLIRSGLMGD-TVLTHFISSFTCGL 209

Query: 777 XXXXXXNPLWVVKTRLQTQGMRAG 848
                 NP+ VV+TR+  Q + AG
Sbjct: 210 AGALASNPVDVVRTRMMNQRVLAG 233



 Score = 38.1 bits (87), Expect = 0.34
 Identities = 24/69 (34%), Positives = 37/69 (53%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+DV++TR     +   GN   +G+L    L Q ++ EG   +Y+G  P  L L P   +
Sbjct: 217 PVDVVRTRMMNQRV-LAGNPLYKGTL--DGLMQTWRNEGFFALYKGFWPNWLRLGPWNII 273

Query: 672 YFTIYEQLK 698
           +F  +EQLK
Sbjct: 274 FFMTFEQLK 282



>gb:AL360268_1926108 Human DNA sequence from clone RP11-379C10 on
           chromosome 9 Contains the gene for a novel protein, the
           5' end of the PCSCL gene for likely ortholog of rat
           peroxisomal Ca-dependent solute carrier-like protein
           (KIAA1896), two novel genes and a CpG island, complete
           sequence.>gb:AL590708_1929840 Human DNA sequence from
           clone RP11-395P17 on chromosome 9 Contains the PCSCL
           gene for likely ortholog of rat peroxisomal Ca-dependent
           solute carrier-like protein (KIAA1896), the PTGES2 gene
           for prostaglandin E synthase 2 (GBF1, GBF-1, C9orf15,
           FLJ14038), the LCN2 gene for lipocalin 2 (oncogene 24p3)
           (NGAL), the C9orf16 gene for chromosome 9 open reading
           frame 16 (MGC4639, EST00098, FLJ12823), the CIZ1 gene
           for Cip1-interacting zinc finger protein (LSFR1), the
           DNM1 gene for dynamin 1 (DNM), the GOLGA2 gene for golgi
           autoantigen, golgin subfamily a, 2 (GM130, MGC20672),
           the gene for a novel protein and seven CpG islands,
           complete sequence.
          Length = 313

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 30/81 (37%), Positives = 40/81 (49%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVH       +N  G  IVG   Q+ +  G R ++RG    VL + P
Sbjct: 236 TCTAPLDRLKVLMQVHA----SRSNNMG--IVGGFTQMIREGGARSLWRGNGINVLKIAP 289

Query: 660 NWAVYFTIYEQLKSFLCSDDE 722
             A+ F  YEQ+K  + SD E
Sbjct: 290 ESAIKFMAYEQIKRLVGSDQE 310



>gb:AF155811_1886677 Homo sapiens mitochondrial uncoupling protein 5
           short form mRNA, complete cds; nuclear gene for
           mitochondrial product.>gb:HS20I3_1997478 Human DNA
           sequence from clone RP1-20I3 on chromosome Xq25-26
           Contains a SNRPN upstream reading frame (SNURF)
           pseudogene, the SLC25A14 gene for solute carrier family
           25 (mitochondrial carrier, brain),member 14 (UCP5,
           BMCP1), the gene for G-protein coupled receptor 2
           (GPCR2), the gene for CGI-79 protein and a CpG island,
           complete sequence.
          Length = 322

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 40/144 (27%), Positives = 58/144 (40%)
 Frame = +3

Query: 432 LLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGL 611
           LL N            T   P DV+K R Q  G      +  +GS+I GS   I+Q+EG 
Sbjct: 138 LLINMICGVVSGVISSTIANPTDVLKIRMQAQG------SLFQGSMI-GSFIDIYQQEGT 190

Query: 612 RGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXX 791
           RG++RG+ PT         V   +Y+  K  L       + +I                 
Sbjct: 191 RGLWRGVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGD-TILTHFVSSFTCGLAGALA 249

Query: 792 XNPLWVVKTRLQTQGMRAGVVGVH 863
            NP+ VV+TR+  Q    G V ++
Sbjct: 250 SNPVDVVRTRMMNQRAIVGHVDLY 273



 Score = 40.4 bits (93), Expect = 0.069
 Identities = 33/118 (27%), Positives = 49/118 (41%), Gaps = 3/118 (2%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLP---KLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           P+D+ KTR QV G     +      RG  +  +L +I + EG+  +Y G++P +L     
Sbjct: 57  PVDLTKTRLQVQGQSIDARFKEIKYRG--MFHALFRICKEEGVLALYSGIAPALLRQASY 114

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
             +   IY+ LK       E   L I                  NP  V+K R+Q QG
Sbjct: 115 GTIKIGIYQSLKRLFVERLEDETLLI--NMICGVVSGVISSTIANPTDVLKIRMQAQG 170



 Score = 37.0 bits (84), Expect = 0.77
 Identities = 22/69 (31%), Positives = 40/69 (57%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+DV++TR  ++    +G+ ++    + G L+ +++ EG   +Y+G  P  L L P   +
Sbjct: 252 PVDVVRTRM-MNQRAIVGHVDLYKGTVDGILK-MWKHEGFFALYKGFWPNWLRLGPWNII 309

Query: 672 YFTIYEQLK 698
           +F  YEQLK
Sbjct: 310 FFITYEQLK 318



>gb:AP003334_1828137 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1114B07.
          Length = 340

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 36/122 (29%), Positives = 58/122 (47%), Gaps = 8/122 (6%)
 Frame = +3

Query: 492 PLDVIKTR--FQVHGLPKLGNT--NIRGSLIVGSLEQIFQ----REGLRGMYRGLSPTVL 647
           PLD+ +T+  +QV  + + GN   N       G ++ +F+      G R +YRG+ PT++
Sbjct: 146 PLDLARTKLAYQVSNVGQPGNALGNAGRQPAYGGIKDVFKTVYKEGGARALYRGVGPTLI 205

Query: 648 ALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
            +LP   + F IYE LKS +  D +R   S+                   PL VV+ ++Q
Sbjct: 206 GILPYAGLKFYIYEDLKSRVPEDYKR---SVVLKLSCGALAGLFGQTLTYPLDVVRRQMQ 262

Query: 828 TQ 833
            Q
Sbjct: 263 VQ 264



 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 27/81 (33%), Positives = 46/81 (56%), Gaps = 2/81 (2%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQV--HGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLAL 653
           T V PL+ +K   Q   HG   LG        I+ SL +++Q EG+RG Y+G   +VL +
Sbjct: 45  TAVAPLERVKILLQTRTHGFQSLG--------ILQSLRKLWQYEGIRGFYKGNGASVLRI 96

Query: 654 LPNWAVYFTIYEQLKSFLCSD 716
           +P  A+++  YEQ + ++ ++
Sbjct: 97  VPYAALHYMTYEQYRCWILNN 117



>gb:AP003334_1828136 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1114B07.
          Length = 330

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 36/122 (29%), Positives = 58/122 (47%), Gaps = 8/122 (6%)
 Frame = +3

Query: 492 PLDVIKTR--FQVHGLPKLGNT--NIRGSLIVGSLEQIFQ----REGLRGMYRGLSPTVL 647
           PLD+ +T+  +QV  + + GN   N       G ++ +F+      G R +YRG+ PT++
Sbjct: 136 PLDLARTKLAYQVSNVGQPGNALGNAGRQPAYGGIKDVFKTVYKEGGARALYRGVGPTLI 195

Query: 648 ALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
            +LP   + F IYE LKS +  D +R   S+                   PL VV+ ++Q
Sbjct: 196 GILPYAGLKFYIYEDLKSRVPEDYKR---SVVLKLSCGALAGLFGQTLTYPLDVVRRQMQ 252

Query: 828 TQ 833
            Q
Sbjct: 253 VQ 254



 Score = 45.4 bits (106), Expect = 0.002
 Identities = 25/77 (32%), Positives = 44/77 (57%), Gaps = 2/77 (2%)
 Frame = +3

Query: 492 PLDVIKTRFQV--HGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           PL+ +K   Q   HG   LG        I+ SL +++Q EG+RG Y+G   +VL ++P  
Sbjct: 39  PLERVKILLQTRTHGFQSLG--------ILQSLRKLWQYEGIRGFYKGNGASVLRIVPYA 90

Query: 666 AVYFTIYEQLKSFLCSD 716
           A+++  YEQ + ++ ++
Sbjct: 91  ALHYMTYEQYRCWILNN 107



>gb:CR380953_1651003 Candida glabrata strain CBS138 chromosome G
           complete sequence.
          Length = 289

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 33/122 (27%), Positives = 51/122 (41%), Gaps = 6/122 (4%)
 Frame = +3

Query: 486 VCPLDVIKTRFQ--VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           V PLD+ K R Q  +    K G  N+   ++   L         R +YRGL+  ++    
Sbjct: 26  VHPLDLFKVRLQLLITSTTKKGYRNLWSEIVGSDLSLT------RELYRGLTVNLVGNTI 79

Query: 660 NWAVYFTIYEQLKSFLCSDDER----HELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
            W +YF  Y   K +L + + R     +LS                   NPLWV+KTR+ 
Sbjct: 80  AWGLYFASYRVAKDYLINYNHRIRNDKDLSSWMYLSASASSGMLTTVLTNPLWVIKTRMM 139

Query: 828 TQ 833
           ++
Sbjct: 140 SK 141



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 19/41 (46%), Positives = 26/41 (63%)
 Frame = +3

Query: 585 EQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFL 707
           + I+ R GL G Y+GLS  +L  +P+  + F IYE  KSFL
Sbjct: 249 KMIYSRSGLLGFYKGLSANLLRSVPSTCITFCIYENFKSFL 289



>gb:AX338084_1465833 Sequence 1 from Patent WO0174854.
          Length = 460

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 31/120 (25%), Positives = 53/120 (44%), Gaps = 1/120 (0%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T + P++V+KTR  +    +          ++    +I +REG R +YRG  P +L ++P
Sbjct: 295 TIIYPMEVLKTRLTLRRTGQYKG-------LLDCARRILEREGTRALYRGYLPNMLGIIP 347

Query: 660 NWAVYFTIYEQLKSF-LCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
                  +YE L+ F + S  +  + S                    PL +V+TR+Q QG
Sbjct: 348 YACTDLAVYEMLQCFWVKSGRDMGDPSGLVSLSSVTLSTTCGQMASYPLTLVRTRMQAQG 407



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 40/146 (27%), Positives = 58/146 (39%), Gaps = 2/146 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVH   K    NI      G L  +    G+R ++RG    VL + P
Sbjct: 201 TGTAPLDRLKVFMQVHA-SKTNRLNI-----FGGLRSMVLEGGIRSLWRGNGINVLKIAP 254

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTR--LQTQ 833
             A+ F  YEQ+K  +    E   L +                   P+ V+KTR  L+  
Sbjct: 255 ESAIKFMAYEQIKRAILGQQE--TLHVQERFLAGSLAGATAQTIIYPMEVLKTRLTLRRT 312

Query: 834 GMRAGVVGVHYRL*EE*LVKRAF*GY 911
           G   G++    R+ E    +  + GY
Sbjct: 313 GQYKGLLDCARRILEREGTRALYRGY 338



>sp|O95258|UCP5_HUMAN Brain mitochondrial carrier protein-1 (BMCP-1)
           (Mitochondrial uncoupling protein 5) (UCP 5) (Solute
           carrier family 25, member 14)
           (UNQ791/PRO1682).>gb:AF078544_1881264 Homo sapiens brain
           mitochondrial carrier protein-1 (BMCP1) mRNA, nuclear
           gene encoding mitochondrial protein, complete
           cds.>gb:AF155809_1886675 Homo sapiens mitochondrial
           uncoupling protein 5 long form mRNA, complete cds;
           nuclear gene for mitochondrial
           product.>gb:AY358099_1946978 Homo sapiens clone DNA80562
           UCP5 (UNQ791) mRNA, complete cds.>gb:HS20I3_1997476
           Human DNA sequence from clone RP1-20I3 on chromosome
           Xq25-26 Contains a SNRPN upstream reading frame (SNURF)
           pseudogene, the SLC25A14 gene for solute carrier family
           25 (mitochondrial carrier, brain),member 14 (UCP5,
           BMCP1), the gene for G-protein coupled receptor 2
           (GPCR2), the gene for CGI-79 protein and a CpG island,
           complete sequence.
          Length = 325

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 40/144 (27%), Positives = 58/144 (40%)
 Frame = +3

Query: 432 LLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGL 611
           LL N            T   P DV+K R Q  G      +  +GS+I GS   I+Q+EG 
Sbjct: 141 LLINMICGVVSGVISSTIANPTDVLKIRMQAQG------SLFQGSMI-GSFIDIYQQEGT 193

Query: 612 RGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXX 791
           RG++RG+ PT         V   +Y+  K  L       + +I                 
Sbjct: 194 RGLWRGVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGD-TILTHFVSSFTCGLAGALA 252

Query: 792 XNPLWVVKTRLQTQGMRAGVVGVH 863
            NP+ VV+TR+  Q    G V ++
Sbjct: 253 SNPVDVVRTRMMNQRAIVGHVDLY 276



 Score = 40.4 bits (93), Expect = 0.069
 Identities = 33/118 (27%), Positives = 49/118 (41%), Gaps = 3/118 (2%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLP---KLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           P+D+ KTR QV G     +      RG  +  +L +I + EG+  +Y G++P +L     
Sbjct: 60  PVDLTKTRLQVQGQSIDARFKEIKYRG--MFHALFRICKEEGVLALYSGIAPALLRQASY 117

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
             +   IY+ LK       E   L I                  NP  V+K R+Q QG
Sbjct: 118 GTIKIGIYQSLKRLFVERLEDETLLI--NMICGVVSGVISSTIANPTDVLKIRMQAQG 173



 Score = 37.0 bits (84), Expect = 0.77
 Identities = 22/69 (31%), Positives = 40/69 (57%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+DV++TR  ++    +G+ ++    + G L+ +++ EG   +Y+G  P  L L P   +
Sbjct: 255 PVDVVRTRM-MNQRAIVGHVDLYKGTVDGILK-MWKHEGFFALYKGFWPNWLRLGPWNII 312

Query: 672 YFTIYEQLK 698
           +F  YEQLK
Sbjct: 313 FFITYEQLK 321



>gb:BX649502_2567819 Zebrafish DNA sequence from clone DKEY-204F11
           in linkage group 3 Contains part of the IgH locus
           (annotation by J. Bussmann, Steiner lab), five novel
           genes, a novel gene similar to mouse CARM1
           (coactivator-associated arginine methyltransferase 1), a
           novel gene similar to human and mouse CLPP (ClpP
           caseinolytic protease, ATP-dependent, proteolytic
           subunit homolog (E. coli)), the aldh3d1 gene for
           aldehyde dehydrogenase 3 family, member D1 and a CpG
           island, complete sequence.
          Length = 481

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 33/115 (28%), Positives = 47/115 (40%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVHG          G  +   L+ + +  GLR ++RG    VL + P
Sbjct: 215 TGTAPLDRLKVFLQVHGTS--------GVTLFSGLQGMVREGGLRSLWRGNGINVLKIAP 266

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRL 824
             A+ F  YEQ+K  +    E   L +                   P+ V+KTRL
Sbjct: 267 ESAIKFMAYEQIKWLIRGRREGGTLRVQERFIAGSLAGATAQTIIYPMEVLKTRL 321



 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 25/76 (32%), Positives = 41/76 (53%), Gaps = 4/76 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQVH----GLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PL +I+TR Q      G P+L         +VG  + I   EG+ G+YRG++P  L ++P
Sbjct: 410 PLALIRTRMQAQASAEGAPQLS--------MVGQFKHIVSHEGVPGLYRGIAPNFLKVIP 461

Query: 660 NWAVYFTIYEQLKSFL 707
             ++ + +YE +K  L
Sbjct: 462 AVSISYVVYEHMKKAL 477



 Score = 43.1 bits (100), Expect = 0.011
 Identities = 32/127 (25%), Positives = 53/127 (41%), Gaps = 4/127 (3%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T + P++V+KTR     L K G      S +    +QI ++EG+R  Y+G  P  L ++P
Sbjct: 309 TIIYPMEVLKTRLT---LRKTGQY----SGMADCAKQILRKEGVRAFYKGYVPNTLGIIP 361

Query: 660 NWAVYFTIYEQLKSF----LCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
              +   +YE LK+      C      +  +                   PL +++TR+Q
Sbjct: 362 YAGIDLAVYETLKNAWLQRYCMGSA--DPGVLVLLACGTVSSTCGQLASYPLALIRTRMQ 419

Query: 828 TQGMRAG 848
            Q    G
Sbjct: 420 AQASAEG 426



>gb:AF535151_2067731 Mus musculus brain mitochondrial carrier
           protein long-inserted form (Tm4sf10) mRNA, complete cds;
           nuclear gene for mitochondrial product.
          Length = 356

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 40/144 (27%), Positives = 58/144 (40%)
 Frame = +3

Query: 432 LLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGL 611
           LL N            T   P DV+K R Q  G      +  +GS+I GS   I+Q+EG 
Sbjct: 172 LLINMICGVVSGVISSTIANPTDVLKIRMQAQG------SLFQGSMI-GSFIDIYQQEGT 224

Query: 612 RGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXX 791
           RG++RG+ PT         V   +Y+  K  L       + +I                 
Sbjct: 225 RGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSGMLGD-TILTHFVSSFTCGLAGALA 283

Query: 792 XNPLWVVKTRLQTQGMRAGVVGVH 863
            NP+ VV+TR+  Q    G V ++
Sbjct: 284 SNPVDVVRTRMMNQRAIVGHVDLY 307



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 33/118 (27%), Positives = 50/118 (42%), Gaps = 3/118 (2%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLP---KLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           P+D+ KTR QV G     +      RG  +  +L +I++ EG+  +Y G++P +L     
Sbjct: 91  PVDLTKTRLQVQGQSIDVRFKEIKYRG--MFHALFRIYKEEGILALYSGIAPALLRQASY 148

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
             +   IY+ LK       E   L I                  NP  V+K R+Q QG
Sbjct: 149 GTIKIGIYQSLKRLFVERLEDETLLI--NMICGVVSGVISSTIANPTDVLKIRMQAQG 204



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 22/69 (31%), Positives = 40/69 (57%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+DV++TR  ++    +G+ ++    + G L+ +++ EG   +Y+G  P  L L P   +
Sbjct: 286 PVDVVRTRM-MNQRAIVGHVDLYKGTLDGILK-MWKHEGFFALYKGFWPNWLRLGPWNII 343

Query: 672 YFTIYEQLK 698
           +F  YEQLK
Sbjct: 344 FFITYEQLK 352



>gb:AF535150_2067730 Mus musculus brain mitochondrial carrier
           protein short-inserted form (Tm4sf10) mRNA, complete
           cds; nuclear gene for mitochondrial product.
          Length = 353

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 40/144 (27%), Positives = 58/144 (40%)
 Frame = +3

Query: 432 LLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGL 611
           LL N            T   P DV+K R Q  G      +  +GS+I GS   I+Q+EG 
Sbjct: 169 LLINMICGVVSGVISSTIANPTDVLKIRMQAQG------SLFQGSMI-GSFIDIYQQEGT 221

Query: 612 RGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXX 791
           RG++RG+ PT         V   +Y+  K  L       + +I                 
Sbjct: 222 RGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSGMLGD-TILTHFVSSFTCGLAGALA 280

Query: 792 XNPLWVVKTRLQTQGMRAGVVGVH 863
            NP+ VV+TR+  Q    G V ++
Sbjct: 281 SNPVDVVRTRMMNQRAIVGHVDLY 304



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 33/118 (27%), Positives = 50/118 (42%), Gaps = 3/118 (2%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLP---KLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           P+D+ KTR QV G     +      RG  +  +L +I++ EG+  +Y G++P +L     
Sbjct: 88  PVDLTKTRLQVQGQSIDVRFKEIKYRG--MFHALFRIYKEEGILALYSGIAPALLRQASY 145

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
             +   IY+ LK       E   L I                  NP  V+K R+Q QG
Sbjct: 146 GTIKIGIYQSLKRLFVERLEDETLLI--NMICGVVSGVISSTIANPTDVLKIRMQAQG 201



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 22/69 (31%), Positives = 40/69 (57%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+DV++TR  ++    +G+ ++    + G L+ +++ EG   +Y+G  P  L L P   +
Sbjct: 283 PVDVVRTRM-MNQRAIVGHVDLYKGTLDGILK-MWKHEGFFALYKGFWPNWLRLGPWNII 340

Query: 672 YFTIYEQLK 698
           +F  YEQLK
Sbjct: 341 FFITYEQLK 349



>gb:AF076981_2053591 Mus musculus brain mitochondrial carrier
           protein BMCP1 (Bmcp1) mRNA, complete
           cds.>gb:AF155813_2056935 Mus musculus mitochondrial
           uncoupling protein 5 short form mRNA, complete cds;
           nuclear gene for mitochondrial product.
          Length = 322

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 40/144 (27%), Positives = 58/144 (40%)
 Frame = +3

Query: 432 LLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGL 611
           LL N            T   P DV+K R Q  G      +  +GS+I GS   I+Q+EG 
Sbjct: 138 LLINMICGVVSGVISSTIANPTDVLKIRMQAQG------SLFQGSMI-GSFIDIYQQEGT 190

Query: 612 RGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXX 791
           RG++RG+ PT         V   +Y+  K  L       + +I                 
Sbjct: 191 RGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSGMLGD-TILTHFVSSFTCGLAGALA 249

Query: 792 XNPLWVVKTRLQTQGMRAGVVGVH 863
            NP+ VV+TR+  Q    G V ++
Sbjct: 250 SNPVDVVRTRMMNQRAIVGHVDLY 273



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 33/118 (27%), Positives = 50/118 (42%), Gaps = 3/118 (2%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLP---KLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           P+D+ KTR QV G     +      RG  +  +L +I++ EG+  +Y G++P +L     
Sbjct: 57  PVDLTKTRLQVQGQSIDVRFKEIKYRG--MFHALFRIYKEEGILALYSGIAPALLRQASY 114

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
             +   IY+ LK       E   L I                  NP  V+K R+Q QG
Sbjct: 115 GTIKIGIYQSLKRLFVERLEDETLLI--NMICGVVSGVISSTIANPTDVLKIRMQAQG 170



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 22/69 (31%), Positives = 40/69 (57%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+DV++TR  ++    +G+ ++    + G L+ +++ EG   +Y+G  P  L L P   +
Sbjct: 252 PVDVVRTRM-MNQRAIVGHVDLYKGTLDGILK-MWKHEGFFALYKGFWPNWLRLGPWNII 309

Query: 672 YFTIYEQLK 698
           +F  YEQLK
Sbjct: 310 FFITYEQLK 318



>gb:AB028879_2044525 Rattus norvegicus BMCP1 mRNA for brain
           mitochondrial carrier protein-1, complete cds.
          Length = 322

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 40/144 (27%), Positives = 58/144 (40%)
 Frame = +3

Query: 432 LLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGL 611
           LL N            T   P DV+K R Q  G      +  +GS+I GS   I+Q+EG 
Sbjct: 138 LLINMICGVVSGVISSTIANPTDVLKIRMQAQG------SLFQGSMI-GSFIDIYQQEGT 190

Query: 612 RGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXX 791
           RG++RG+ PT         V   +Y+  K  L       + +I                 
Sbjct: 191 RGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSGMLGD-TILTHFVSSFTCGLAGALA 249

Query: 792 XNPLWVVKTRLQTQGMRAGVVGVH 863
            NP+ VV+TR+  Q    G V ++
Sbjct: 250 SNPVDVVRTRMMNQRAIVGHVDLY 273



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 33/118 (27%), Positives = 50/118 (42%), Gaps = 3/118 (2%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLP---KLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           P+D+ KTR QV G     +      RG  +  +L +I++ EG+  +Y G++P +L     
Sbjct: 57  PVDLTKTRLQVQGQSIDVRFKEIKYRG--MFHALFRIYREEGILALYSGIAPALLRQASY 114

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
             +   IY+ LK       E   L I                  NP  V+K R+Q QG
Sbjct: 115 GTIKIGIYQSLKRLFVERLEDETLLI--NMICGVVSGVISSTIANPTDVLKIRMQAQG 170



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 22/69 (31%), Positives = 40/69 (57%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+DV++TR  ++    +G+ ++    + G L+ +++ EG   +Y+G  P  L L P   +
Sbjct: 252 PVDVVRTRM-MNQRAIVGHVDLYKGTLDGILK-MWKHEGFFALYKGFWPNWLRLGPWNII 309

Query: 672 YFTIYEQLK 698
           +F  YEQLK
Sbjct: 310 FFITYEQLK 318



>gb:AE016816_1746950 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome III, complete sequence.
          Length = 311

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 31/112 (27%), Positives = 43/112 (38%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+D IKTR Q              S ++  + +I   EG   +++G+   VL   P  AV
Sbjct: 37  PIDAIKTRMQAVSTTGSSAATRLPSNMLAQIAKISTTEGSLALWKGVQSVVLGAGPAHAV 96

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
           YF  YE  KS L   ++R                       NP   +K RLQ
Sbjct: 97  YFATYEMCKSRLIDPEDRQTHQPLKTALSGTLATVAADALMNPFDTIKQRLQ 148



>gb:CR382130_1662581 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 316

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 27/69 (39%), Positives = 41/69 (59%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P D IK+R Q   +   G+++ +G   VG  ++I+Q+ G+R +YRG   TV    P+ A+
Sbjct: 247 PADTIKSRMQTESVTN-GSSSGKGFFEVG--KEIYQKGGIRALYRGCGITVSRAAPSSAI 303

Query: 672 YFTIYEQLK 698
            F  YEQLK
Sbjct: 304 IFFTYEQLK 312



 Score = 34.7 bits (78), Expect = 3.8
 Identities = 27/123 (21%), Positives = 45/123 (36%), Gaps = 2/123 (1%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           F  P D +K R Q        N   +G L     +Q F+ EG  G YRG+S  ++     
Sbjct: 26  FEYPFDTVKVRLQSQSDV---NPQFKGPL--DCFKQTFRNEGFLGFYRGISSPIVGAAAE 80

Query: 663 WAVYFTIYEQLKSFL--CSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
            A  F  Y   +  +   +     +L +                   P+ ++K ++Q Q 
Sbjct: 81  TASLFVFYGACQRLVKNMTGTPEDKLPMSTLLGCGAVAGALTSFILTPIELIKCQMQVQA 140

Query: 837 MRA 845
           + A
Sbjct: 141 LYA 143



>gb:AE014298_1123762 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003418_1208944 Drosophila melanogaster
           chromosome X, section 2 of 74 of the complete
           sequence.>gb:DMBR19J1_1378178 Drosophila melanogaster
           BAC clone BACR19J1.
          Length = 306

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 24/74 (32%), Positives = 40/74 (54%), Gaps = 5/74 (6%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPK-----LGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALL 656
           PLDV+KTR Q+   P      LG  +  G  +     ++++ EG+   ++G+ P +LA  
Sbjct: 34  PLDVVKTRIQIQATPAPNAAALGEVHYNG--VFDCFAKMYRHEGISSYWKGIMPPILAET 91

Query: 657 PNWAVYFTIYEQLK 698
           P  A+ F ++EQ K
Sbjct: 92  PKRAIKFLVFEQTK 105



>pir|T50393|T50393 probable mitochondrial carrier protein [imported]
           - fission yeast (Schizosaccharomyces
           pombe)>gb:SPBP23A10_1720596 S.pombe chromosome II p1
           p23A10.
          Length = 335

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 32/85 (37%), Positives = 44/85 (51%), Gaps = 15/85 (17%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTN-IRGSLIVGS--------------LEQIFQREGLRGM 620
           V PLDV+KTR Q   + +  +T  I  + I+G               L QI + EG+R +
Sbjct: 42  VTPLDVVKTRLQSESISQYSSTQPISSAKILGKGRPAPKPLGGPVSGLYQIARHEGVRSL 101

Query: 621 YRGLSPTVLALLPNWAVYFTIYEQL 695
           +RGL P++  LLP   V F  YEQL
Sbjct: 102 WRGLVPSLTMLLPANTVQFLGYEQL 126



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 25/104 (24%), Positives = 44/104 (42%)
 Frame = +3

Query: 393 AMTADAHGPSPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLI 572
           ++ A +   S K L  N                P DV KT  QVH     G+T  RG  +
Sbjct: 233 SLQAFSSSQSTKDLYINFVSGGISGTLATLLTQPFDVSKTAKQVH-----GHTLTRGQFM 287

Query: 573 VGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSF 704
           +     +++R G + +++G  P  + + P+ A+  + Y   K +
Sbjct: 288 L----TLWKRGGPKALWKGTLPRCVKVAPSCAIMISSYHLTKKY 327



>pir|JC7553|JC7553 brain mitochondrial carrier protein-1 -
           rat>gb:AF300424_2062033 Rattus norvegicus brain
           mitochondrial carrier protein-1 (BMCP1) mRNA, complete
           cds; nuclear gene for mitochondrial
           product.>gb:RNO300165_2135847 Rattus norvegicus mRNA for
           brain mitochondrial carrier protein BMCP1 (Bmcp1 gene).
          Length = 325

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 40/144 (27%), Positives = 58/144 (40%)
 Frame = +3

Query: 432 LLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGL 611
           LL N            T   P DV+K R Q  G      +  +GS+I GS   I+Q+EG 
Sbjct: 141 LLINMICGVVSGVISSTIANPTDVLKIRMQAQG------SLFQGSMI-GSFIDIYQQEGT 193

Query: 612 RGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXX 791
           RG++RG+ PT         V   +Y+  K  L       + +I                 
Sbjct: 194 RGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSGMLGD-TILTHFVSSFTCGLAGALA 252

Query: 792 XNPLWVVKTRLQTQGMRAGVVGVH 863
            NP+ VV+TR+  Q    G V ++
Sbjct: 253 SNPVDVVRTRMMNQRAIVGHVDLY 276



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 33/118 (27%), Positives = 50/118 (42%), Gaps = 3/118 (2%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLP---KLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           P+D+ KTR QV G     +      RG  +  +L +I++ EG+  +Y G++P +L     
Sbjct: 60  PVDLTKTRLQVQGQSIDVRFKEIKYRG--MFHALFRIYREEGILALYSGIAPALLRQASY 117

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
             +   IY+ LK       E   L I                  NP  V+K R+Q QG
Sbjct: 118 GTIKIGIYQSLKRLFVERLEDETLLI--NMICGVVSGVISSTIANPTDVLKIRMQAQG 173



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 22/69 (31%), Positives = 40/69 (57%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+DV++TR  ++    +G+ ++    + G L+ +++ EG   +Y+G  P  L L P   +
Sbjct: 255 PVDVVRTRM-MNQRAIVGHVDLYKGTLDGILK-MWKHEGFFALYKGFWPNWLRLGPWNII 312

Query: 672 YFTIYEQLK 698
           +F  YEQLK
Sbjct: 313 FFITYEQLK 321



>pir|T23170|T23170 hypothetical protein K01C8.7 - Caenorhabditis
           elegans>gb:CEK01C8_1365154 Caenorhabditis elegans cosmid
           K01C8, complete sequence.
          Length = 296

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 31/119 (26%), Positives = 55/119 (46%), Gaps = 1/119 (0%)
 Frame = +3

Query: 480 TFVC-PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALL 656
           T VC P D++K RF  +    L     + S    ++ +I + EG+RG+Y+G +P+++   
Sbjct: 23  TVVCHPFDLLKIRFSANEGSSL---RPQYSSYADAVRKIVRVEGVRGLYQGWTPSLIGAS 79

Query: 657 PNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
            +W +YF  Y  L++ +  +       +                  NP+W+ KTRL  Q
Sbjct: 80  LSWGLYFQWYNSLRTKIYENFSTGS-KLANNLISGCISGSAIMCITNPIWLTKTRLCLQ 137



>sp|Q9Z2B2|UCP5_MOUSE Brain mitochondrial carrier protein-1 (BMCP-1)
           (Mitochondrial uncoupling protein 5) (UCP 5) (Solute
           carrier family 25, member 14).>gb:AF155812_2056934 Mus
           musculus mitochondrial uncoupling protein 5 long form
           mRNA, complete cds; nuclear gene for mitochondrial
           product.>gb:BC048692_2099778 Mus musculus solute carrier
           family 25 (mitochondrial carrier, brain), member 14,
           mRNA (cDNA clone MGC:59323 IMAGE:6333237), complete cds.
          Length = 325

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 40/144 (27%), Positives = 58/144 (40%)
 Frame = +3

Query: 432 LLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGL 611
           LL N            T   P DV+K R Q  G      +  +GS+I GS   I+Q+EG 
Sbjct: 141 LLINMICGVVSGVISSTIANPTDVLKIRMQAQG------SLFQGSMI-GSFIDIYQQEGT 193

Query: 612 RGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXX 791
           RG++RG+ PT         V   +Y+  K  L       + +I                 
Sbjct: 194 RGLWRGVVPTAQRAAIVVGVELPVYDITKKHLIVSGMLGD-TILTHFVSSFTCGLAGALA 252

Query: 792 XNPLWVVKTRLQTQGMRAGVVGVH 863
            NP+ VV+TR+  Q    G V ++
Sbjct: 253 SNPVDVVRTRMMNQRAIVGHVDLY 276



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 33/118 (27%), Positives = 50/118 (42%), Gaps = 3/118 (2%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLP---KLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           P+D+ KTR QV G     +      RG  +  +L +I++ EG+  +Y G++P +L     
Sbjct: 60  PVDLTKTRLQVQGQSIDVRFKEIKYRG--MFHALFRIYKEEGILALYSGIAPALLRQASY 117

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
             +   IY+ LK       E   L I                  NP  V+K R+Q QG
Sbjct: 118 GTIKIGIYQSLKRLFVERLEDETLLI--NMICGVVSGVISSTIANPTDVLKIRMQAQG 173



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 22/69 (31%), Positives = 40/69 (57%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+DV++TR  ++    +G+ ++    + G L+ +++ EG   +Y+G  P  L L P   +
Sbjct: 255 PVDVVRTRM-MNQRAIVGHVDLYKGTLDGILK-MWKHEGFFALYKGFWPNWLRLGPWNII 312

Query: 672 YFTIYEQLK 698
           +F  YEQLK
Sbjct: 313 FFITYEQLK 321



>gb:BC001656_1967747 Homo sapiens solute carrier family 25
           (mitochondrial carrier; phosphate carrier), member 23,
           mRNA (cDNA clone MGC:2615 IMAGE:3356718), complete cds.
          Length = 482

 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 31/121 (25%), Positives = 52/121 (42%), Gaps = 2/121 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T + P++V+KTR  +    +          ++    +I +REG R  YRG  P VL ++P
Sbjct: 342 TIIYPMEVLKTRLTLRRTGQYKG-------LLDCARRILEREGPRAFYRGYLPNVLGIIP 394

Query: 660 NWAVYFTIYEQLKSFLCS--DDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
              +   +YE LK++       +  +  I                   PL +V+TR+Q Q
Sbjct: 395 YAGIDLAVYETLKNWWLQQYSHDSADPGILVLLACGTISSTCGQIASYPLALVRTRMQAQ 454

Query: 834 G 836
           G
Sbjct: 455 G 455



 Score = 45.8 bits (107), Expect = 0.002
 Identities = 34/115 (29%), Positives = 47/115 (40%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QVH   K    NI     +G L  +    G+R ++RG    VL + P
Sbjct: 248 TGTAPLDRLKVFMQVHA-SKTNRLNI-----LGGLRSMVLEGGIRSLWRGNGINVLKIAP 301

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRL 824
             A+ F  YEQ+K  +    E   L +                   P+ V+KTRL
Sbjct: 302 ESAIKFMAYEQIKRAILGQQE--TLHVQERFVAGSLAGATAQTIIYPMEVLKTRL 354



>gb:AP002900_1823705 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0443E07.>gb:AP002902_1823767 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0492F05.
          Length = 211

 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 35/118 (29%), Positives = 50/118 (42%), Gaps = 3/118 (2%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P++++K R Q+    +           V     I ++EG+RG+YRGL+ T L   P   V
Sbjct: 27  PVELVKIRLQLEAAGQKHRRPGDHHGPVDMARDILRKEGVRGIYRGLAVTALRDAPAHGV 86

Query: 672 YFTIYEQLKSFL---CSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
           YF  YE  +  L   C      + S+                   PL VVK+RLQ QG
Sbjct: 87  YFWTYEYARERLHPGCRGHGGEQESLATMLVSGGLAGVASWVCCYPLDVVKSRLQAQG 144



 Score = 37.4 bits (85), Expect = 0.59
 Identities = 31/88 (35%), Positives = 42/88 (47%), Gaps = 3/88 (3%)
 Frame = +3

Query: 480 TFVC--PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVL-A 650
           ++VC  PLDV+K+R Q  G P       RG  I     +  + EGL  ++RGL   V  A
Sbjct: 126 SWVCCYPLDVVKSRLQAQGYP----PRYRG--IADCFRRSVREEGLPVLWRGLGTAVARA 179

Query: 651 LLPNWAVYFTIYEQLKSFLCSDDERHEL 734
            + N A+ F+ YE    FL S      L
Sbjct: 180 FVVNGAI-FSAYELALRFLASSSNDQRL 206



>gb:SPAPB17E12_1718633 S.pombe chromosome I BAC pB17E12.
          Length = 317

 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 24/78 (30%), Positives = 44/78 (56%), Gaps = 2/78 (2%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNT--NIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLAL 653
           T   P DV++ RFQV+ +P +G+   NI+ ++       I++ EG+ G +RG S  +L +
Sbjct: 242 TLTFPADVLRRRFQVNRIPGIGHNYKNIKSAIF-----HIYKTEGINGFFRGYSSNMLKI 296

Query: 654 LPNWAVYFTIYEQLKSFL 707
           +P  ++ +  YE +   L
Sbjct: 297 IPVMSITWYTYETVSKML 314



 Score = 41.6 bits (96), Expect = 0.031
 Identities = 33/130 (25%), Positives = 51/130 (39%), Gaps = 2/130 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T V PL+ +K  FQV         N   + +  +L +I+ REGL G +RG     L   P
Sbjct: 36  TAVSPLERMKIIFQVQN-------NKEYTSLTSTLVKIWNREGLIGFFRGNGTNCLRAFP 88

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRL--QTQ 833
             AV F  +  LK     +     L                     PL + +TRL  +T 
Sbjct: 89  YGAVQFATFNMLKQRALKNRSHQNLENHERLLFGAIAGAASCATTYPLDIARTRLSIETA 148

Query: 834 GMRAGVVGVH 863
           G+ +  + ++
Sbjct: 149 GLTSRSLAIN 158



>gb:CR380959_1653875 Candida glabrata strain CBS138 chromosome M
           complete sequence.
          Length = 381

 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 28/134 (20%), Positives = 54/134 (40%), Gaps = 21/134 (15%)
 Frame = +3

Query: 489 CPLDVIKTRFQVH-----------------GLPKLGNTNIRGSL----IVGSLEQIFQRE 605
           CP D++KTR Q                     P++ N  ++ +      V  +  ++++E
Sbjct: 75  CPFDLVKTRLQSDIYQNMYKSQAEALMMNTTRPRIVNLTLQAATHFKETVSIIGNVYRQE 134

Query: 606 GLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXX 785
           G R +++GL P ++ ++P  ++ F  Y   K          + +                
Sbjct: 135 GFRSLFKGLGPNLVGVIPARSINFFTYGTTKDIYSKAFNNGQEAPWIHLMAAATAGWATA 194

Query: 786 XXXNPLWVVKTRLQ 827
              NP+W+VKTR+Q
Sbjct: 195 TATNPIWMVKTRVQ 208



 Score = 38.5 bits (88), Expect = 0.26
 Identities = 21/66 (31%), Positives = 36/66 (54%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P +V++TR +   L    N  ++ + +V S   I + EGL  MY GL+P ++  +PN  +
Sbjct: 310 PHEVVRTRLRQSPLE---NGKVKYTGLVQSFRVIIKEEGLASMYSGLTPHLMRTVPNSII 366

Query: 672 YFTIYE 689
            F  +E
Sbjct: 367 MFGTWE 372



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 25/72 (34%), Positives = 39/72 (54%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+ ++KTR Q   L K G T    +     L+ I + EG+ G+YRGLS + L  +    +
Sbjct: 199 PIWMVKTRVQ---LDKAGKTRTYKNSY-DCLKSILRNEGIYGLYRGLSASYLGSVEG-IL 253

Query: 672 YFTIYEQLKSFL 707
            + +YEQLK  +
Sbjct: 254 QWLLYEQLKHLI 265



>gb:AY027563_1559048 Aspergillus nidulans mitochondrial carrier AMCA
           (amcA) mRNA, complete cds; nuclear gene for
           mitochondrial product.
          Length = 326

 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 24/71 (33%), Positives = 39/71 (54%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P D IK+R Q   +    NT+ +     G+   ++ ++GLRG+YRG   T     P+ A 
Sbjct: 257 PADTIKSRLQTEDI---NNTSSKRQTFGGAARALWHQQGLRGLYRGCGITCARSAPSSAF 313

Query: 672 YFTIYEQLKSF 704
            FT++E L+S+
Sbjct: 314 IFTVFEGLRSY 324



 Score = 37.4 bits (85), Expect = 0.59
 Identities = 30/116 (25%), Positives = 51/116 (43%), Gaps = 4/116 (3%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLS-PTVLALLPNWA 668
           P D +K R Q     +  +  +R +  +    Q FQ EGLRG+YRG+S P   A + N  
Sbjct: 49  PFDTVKVRLQ----SQPDHLPLRYNGPLDCFRQSFQAEGLRGLYRGISAPMAGAAVENSC 104

Query: 669 VYFT---IYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
           ++F+   + E L++   S  E   L +                   P+ ++K ++Q
Sbjct: 105 LFFSYRVVQELLQASYYSSTE--PLPLTALVFSGAASGSITSLALTPIELIKCKMQ 158



>gb:AX705226_1473542 Sequence 17 from Patent
           WO03014353.>gb:AE016818_1748510 Ashbya gossypii (=
           Eremothecium gossypii) ATCC 10895 chromosome V, complete
           sequence.
          Length = 293

 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 25/73 (34%), Positives = 39/73 (53%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T V P  ++K++ Q  G P         S I   ++ ++ REG+RG YRGLS  +L  +P
Sbjct: 227 TSVYPFQLLKSKLQDFGAP---------SGITQLVQTVYSREGIRGFYRGLSANLLRAVP 277

Query: 660 NWAVYFTIYEQLK 698
              + F +YE +K
Sbjct: 278 ATCITFFVYENIK 290



 Score = 43.1 bits (100), Expect = 0.011
 Identities = 35/128 (27%), Positives = 48/128 (37%), Gaps = 9/128 (7%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGL-RGMYRGLSPTVLALLPNWA 668
           PLD++K R Q      L   N   +   G +  IF+R+   R +YRGL   +L     WA
Sbjct: 28  PLDLLKLRLQ------LSAGNRANTTYTGLIRDIFERQQWGRELYRGLGVNLLGNSVAWA 81

Query: 669 VYFTIYEQLKSFL--------CSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRL 824
           +YF  Y   K            +      L                    NP+WV+KTR+
Sbjct: 82  LYFGCYRCAKDIALRHLGNESATGIMDRRLPAHAYMLAAGSSGIATAVLTNPIWVIKTRI 141

Query: 825 QTQGMRAG 848
                RAG
Sbjct: 142 MATS-RAG 148



 Score = 38.9 bits (89), Expect = 0.20
 Identities = 31/123 (25%), Positives = 56/123 (45%), Gaps = 3/123 (2%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+ VIKTR           +   G      + +++Q EG+   +RG+ P++L  +   A+
Sbjct: 133 PIWVIKTRIMATSRAGPYKSTFDG------VYKLYQTEGVLAFWRGVVPSLLG-VSQGAI 185

Query: 672 YFTIYEQLK-SFLCSDDERHE--LSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMR 842
           YF +Y+ LK  +L S  ++ E  LS+                   P  ++K++LQ  G  
Sbjct: 186 YFALYDTLKFHYLHSSTDKAERRLSVSEIIGITCISKMISVTSVYPFQLLKSKLQDFGAP 245

Query: 843 AGV 851
           +G+
Sbjct: 246 SGI 248



>pir|S57544|S57544 probable membrane protein YPR011c - yeast
           (Saccharomyces cerevisiae)>gb:SC9531X_1705980
           S.cerevisiae chromosome XVI cosmid
           9531.>gb:SCCHRXVI_1707085 S.cerevisiae chromosome XVI
           165536 bp sequence, cen rightwards.>gb:SCU31900_1710140
           Saccharomyces cerevisiae chromosome XVI cosmid
           9723/71015.
          Length = 326

 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 28/78 (35%), Positives = 41/78 (52%), Gaps = 7/78 (8%)
 Frame = +3

Query: 492 PLDVIKTRFQVH--GLPKLGNTNIRGSLIVGSLEQIFQRE-----GLRGMYRGLSPTVLA 650
           PLD+IKTR  +    L  L  +  +       + Q+         GLRG+YRG+ PT L 
Sbjct: 142 PLDLIKTRLSIQTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTSLG 201

Query: 651 LLPNWAVYFTIYEQLKSF 704
           ++P  A+ F +YEQL+ F
Sbjct: 202 VVPYVALNFAVYEQLREF 219



 Score = 42.7 bits (99), Expect = 0.014
 Identities = 33/121 (27%), Positives = 51/121 (42%), Gaps = 3/121 (2%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T V P + +K   QV       N   RG  I  S+ Q++  EG +G++RG     + + P
Sbjct: 38  TVVSPFERVKILLQVQSSTTSYN---RG--IFSSIRQVYHEEGTKGLFRGNGLNCIRIFP 92

Query: 660 NWAVYFTIYEQLKSFLC---SDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQT 830
             AV F +YE  K  L     ++ + +L+                    PL ++KTRL  
Sbjct: 93  YSAVQFVVYEACKKKLFHVNGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLSI 152

Query: 831 Q 833
           Q
Sbjct: 153 Q 153



 Score = 40.8 bits (94), Expect = 0.053
 Identities = 28/92 (30%), Positives = 44/92 (47%), Gaps = 1/92 (1%)
 Frame = +3

Query: 417 PSPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNT-NIRGSLIVGSLEQI 593
           PS K  L              T   P D+++ RFQV  L   GN    R + +  +L  I
Sbjct: 228 PSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQV--LAMGGNELGFRYTSVWDALVTI 285

Query: 594 FQREGLRGMYRGLSPTVLALLPNWAVYFTIYE 689
            + EG+ G Y+GL+  +  ++P+ AV + +YE
Sbjct: 286 GRAEGVSGYYKGLAANLFKVVPSTAVSWLVYE 317



>gb:BC072270_2556522 Xenopus laevis hypothetical protein LOC443574,
           mRNA (cDNA clone IMAGE:4408521), partial cds.
          Length = 676

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 31/119 (26%), Positives = 52/119 (43%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T V P+D++KTR Q      +G    + S      +++ + EG  G+YRGL P ++ + P
Sbjct: 347 TAVYPIDLVKTRMQNQRSSFVGELMYKNSF--DCFKKVLRYEGFFGLYRGLLPQLVGVAP 404

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
             A+  T+ + ++      D    + +                  NPL +VK RLQ  G
Sbjct: 405 EKAIKLTVNDFVRDKFTQKD--GSIPLFAEIMAGGCAGGSQVIFTNPLEIVKIRLQVAG 461



 Score = 42.0 bits (97), Expect = 0.024
 Identities = 31/107 (28%), Positives = 43/107 (40%)
 Frame = +3

Query: 396 MTADAHGPSPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIV 575
           M AD HG    G L              + V P DVIKTR QV    + G T   G  ++
Sbjct: 511 MFADEHGHI--GALQLLTAGAVAGVPAASLVTPADVIKTRLQV--AARAGQTTYTG--VI 564

Query: 576 GSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD 716
               +I + EG +  ++G    V    P + V    YE L+ +   D
Sbjct: 565 DCFRKILKEEGAKAFWKGAGARVFRSSPQFGVTLLTYEMLQQWFYVD 611



 Score = 41.2 bits (95), Expect = 0.041
 Identities = 33/122 (27%), Positives = 47/122 (38%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           F  PL+++K R QV G    G   +R   ++  L       G  G+Y+G     L  +P 
Sbjct: 446 FTNPLEIVKIRLQVAGEITTG-PKVRALTVLRDL-------GFFGLYKGAKACFLRDIPF 497

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMR 842
             +YF +Y   K+     DE   +                     P  V+KTRLQ    R
Sbjct: 498 SGIYFPVYAHCKTMFA--DEHGHIGALQLLTAGAVAGVPAASLVTPADVIKTRLQV-AAR 554

Query: 843 AG 848
           AG
Sbjct: 555 AG 556



>gb:AF332005_1897051 Homo sapiens ornithine transporter 2 (ORNT2)
           mRNA, complete cds.>gb:AY208943_1939231 Homo sapiens
           ornithine transporter 2 (ORNT2) mRNA, ORNT2-Val181
           allele, complete cds; nuclear gene for mitochondrial
           product.>gb:BC069458_1988064 Homo sapiens solute carrier
           family 25 (mitochondrial carrier; ornithine transporter)
           member 2, mRNA (cDNA clone MGC:97066 IMAGE:7262278),
           complete cds.
          Length = 301

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 33/128 (25%), Positives = 58/128 (45%), Gaps = 4/128 (3%)
 Frame = +3

Query: 486 VCPLDVIKTRFQ-VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           +CP +++K R Q ++ +   G      + I   ++ I +++G  G Y GLS T+L  +P 
Sbjct: 124 LCPTELVKCRLQTMYEMEMSGKIAKSHNTIWSVVKGILKKDGPLGFYHGLSSTLLQEVPG 183

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQT---Q 833
           +  +F  YE  +SF  S   + EL                     P+  +K+R+Q     
Sbjct: 184 YFFFFGGYELSRSFFASGRSKDELGPVHLMLSGGVAGICLWLVVFPVDCIKSRIQVLSMY 243

Query: 834 GMRAGVVG 857
           G +AG +G
Sbjct: 244 GKQAGFIG 251



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 23/81 (28%), Positives = 39/81 (48%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           V P+D IK+R QV  L   G    + +  +G+L  + + EG+  +Y GL  T++  +P  
Sbjct: 227 VFPVDCIKSRIQV--LSMYG----KQAGFIGTLLSVVRNEGIVALYSGLKATMIRAIPAN 280

Query: 666 AVYFTIYEQLKSFLCSDDERH 728
              F  YE  +  +    E +
Sbjct: 281 GALFVAYEYSRKMMMKQLEAY 301



 Score = 35.4 bits (80), Expect = 2.2
 Identities = 30/116 (25%), Positives = 47/116 (40%), Gaps = 3/116 (2%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P D IK + Q    P L     +G  +     + + + GLRG Y+G  P ++A +   +V
Sbjct: 29  PFDTIKVKMQT--FPDL----YKG--LTDCFLKTYAQVGLRGFYKGTGPALMAYVAENSV 80

Query: 672 YFTIY---EQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQT 830
            F  Y   +Q    +   D++ +LS                    P  +VK RLQT
Sbjct: 81  LFMCYGFCQQFVRKVAGMDKQAKLSDLQTAAAGSFASAFAALALCPTELVKCRLQT 136



>gb:AP003629_1831729 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0481H08.
          Length = 515

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 36/127 (28%), Positives = 56/127 (44%), Gaps = 9/127 (7%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHG-----LPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTV 644
           T + P+D++KTR Q +      +P LG  +            I   EG R  YRGL P++
Sbjct: 343 TAIYPVDLVKTRLQTYSCVDGKVPSLGALS----------RDILMHEGPRAFYRGLVPSL 392

Query: 645 LALLP----NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVV 812
           L ++P    + AVY T+ +  K+++  D +   L                     PL V+
Sbjct: 393 LGIVPYAGIDLAVYETLKDVSKTYILKDSDPGPL---VQLGCGTVSGALGATCVYPLQVI 449

Query: 813 KTRLQTQ 833
           +TRLQ Q
Sbjct: 450 RTRLQAQ 456



 Score = 41.2 bits (95), Expect = 0.041
 Identities = 26/79 (32%), Positives = 40/79 (50%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T V PL VI+TR Q         +  RG   V    +  Q EG+ G Y+G+ P +L ++P
Sbjct: 441 TCVYPLQVIRTRLQAQRANS--ESAYRGMSDV--FWRTLQHEGVSGFYKGILPNLLKVVP 496

Query: 660 NWAVYFTIYEQLKSFLCSD 716
             ++ + +YE +K  L  D
Sbjct: 497 AASITYLVYEAMKKNLSLD 515



 Score = 40.4 bits (93), Expect = 0.069
 Identities = 31/127 (24%), Positives = 51/127 (40%), Gaps = 2/127 (1%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   PLD +K   QV             + ++ S++ I+ + G+   +RG    V+ + P
Sbjct: 248 TATAPLDRLKVIMQVQ---------TTRTTVMHSIKDIWSQGGMLAFFRGNGLNVVKVAP 298

Query: 660 NWAVYFTIYEQLKSFLCSD--DERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
             A+ F  YE LK ++     + + E+                     P+ +VKTRLQT 
Sbjct: 299 ESAIRFYAYEMLKEYIMKSKGENKSEVGPSERLVAGGLAGAVAQTAIYPVDLVKTRLQTY 358

Query: 834 GMRAGVV 854
               G V
Sbjct: 359 SCVDGKV 365



>gb:AK117673_1815695 Arabidopsis thaliana At1g14140 mRNA for
           putative mitochondrial uncoupling protein, complete cds,
           clone: RAFL17-33-N10.
          Length = 132

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 25/83 (30%), Positives = 44/83 (53%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+D+ KTR Q+HG       +  G+   G + +I ++EG+ G+Y+GLSP ++  L    +
Sbjct: 32  PIDLTKTRMQLHGSGSASGAHRIGAF--GVVSEIARKEGVIGLYKGLSPAIIRHLFYTPI 89

Query: 672 YFTIYEQLKSFLCSDDERHELSI 740
               YE LK  +   +  +  S+
Sbjct: 90  RIIGYENLKGLIVRSETNNSESL 112



>gb:AE017343_1755898 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 378

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 27/76 (35%), Positives = 46/76 (60%), Gaps = 1/76 (1%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGL-RGMYRGLSPTVLALLP 659
           F  P DV++ + QV GL  L   +  G+  + ++ QI + EG  +GMYRGL+P ++ + P
Sbjct: 303 FTHPFDVLRRKLQVAGLSTL-TPHYDGA--IDAMRQIIRNEGFWKGMYRGLTPNLIKVTP 359

Query: 660 NWAVYFTIYEQLKSFL 707
           + AV F ++E ++  L
Sbjct: 360 SIAVSFYVFELVRDSL 375



 Score = 41.6 bits (96), Expect = 0.031
 Identities = 29/90 (32%), Positives = 45/90 (50%), Gaps = 8/90 (8%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGL------PKLGNTNIRGSL-IVGSLEQIFQREG-LRGMYRGLSPTVL 647
           PLD+++ R  +         P    TN    L IVG  +++++ EG LRG+YRG   T L
Sbjct: 192 PLDLVRARLSIATANMAVRQPGAAFTNEDARLGIVGMTKKVYKAEGGLRGLYRGCWATAL 251

Query: 648 ALLPNWAVYFTIYEQLKSFLCSDDERHELS 737
            + P  ++ F  YE +K+ +  D     LS
Sbjct: 252 GVAPYVSLNFFFYESVKTHVLPDPPSPPLS 281



>gb:CR380959_1654039 Candida glabrata strain CBS138 chromosome M
           complete sequence.
          Length = 348

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 28/76 (36%), Positives = 42/76 (55%), Gaps = 4/76 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSL----IVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           PLD IKTR Q     K  +T+ +G      I     Q+ + EG R +Y+G++P V+ + P
Sbjct: 261 PLDTIKTRLQ-----KDKSTSFKGESGWKRIAHIGTQLLKEEGFRALYKGITPRVMRVAP 315

Query: 660 NWAVYFTIYEQLKSFL 707
             AV FT+YE ++  L
Sbjct: 316 GQAVTFTVYEFVRRHL 331



 Score = 42.4 bits (98), Expect = 0.018
 Identities = 35/120 (29%), Positives = 47/120 (39%), Gaps = 6/120 (5%)
 Frame = +3

Query: 486 VCPLDVIKTRFQV------HGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVL 647
           V P++V+K R Q       H L K   TN      V +   I + EG+  +YRG+S T  
Sbjct: 156 VNPMEVVKIRLQAQHLNPNHDLAKPKYTNA-----VQAGYTIIKEEGISALYRGVSLTAA 210

Query: 648 ALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
               N    FT+Y +L+ FL        L                     PL  +KTRLQ
Sbjct: 211 RQATNQGANFTVYSKLREFLQEYHGTETLPSWETSCIGLISGAIGPFSNAPLDTIKTRLQ 270



 Score = 41.2 bits (95), Expect = 0.041
 Identities = 22/81 (27%), Positives = 35/81 (43%)
 Frame = +3

Query: 591 IFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXX 770
           I+ +EG   +Y+GL   V+ ++P  A+ F+ YE  ++ L         +           
Sbjct: 89  IYAQEGFLALYKGLGAVVIGIIPKMAIRFSSYEFYRTLLADKQTGVVSTSNTFIAGVGAG 148

Query: 771 XXXXXXXXNPLWVVKTRLQTQ 833
                   NP+ VVK RLQ Q
Sbjct: 149 VTEAVLVVNPMEVVKIRLQAQ 169



>gb:BX897673_1644312 Neurospora crassa DNA linkage group III BAC
           clone B13M15.
          Length = 324

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 25/72 (34%), Positives = 42/72 (58%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P+D IKTR Q   + + G T  +    + +  ++F++EG    Y+G++P ++ + P  AV
Sbjct: 241 PIDTIKTRLQ-KSVAQPGETAFQRITKISA--EMFKQEGFHAFYKGITPRIMRVAPGQAV 297

Query: 672 YFTIYEQLKSFL 707
            FT+YE LK  L
Sbjct: 298 TFTVYEFLKQKL 309



 Score = 46.2 bits (108), Expect = 0.001
 Identities = 32/117 (27%), Positives = 48/117 (41%), Gaps = 1/117 (0%)
 Frame = +3

Query: 486 VC-PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           VC PLD IK R Q+    ++     RG +  G   +I ++E   G+Y+GL   +  ++P 
Sbjct: 32  VCHPLDTIKVRMQLSKRGRVPGQAKRGFIRTGV--EIVKKETALGLYKGLGAVLTGIVPK 89

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
            A+ FT +E  K  L                              P+ V+K RLQ Q
Sbjct: 90  MAIRFTSFEWYKQLLADKQTGVVSGQATFFAGLAAGVTEAVAVVTPMEVIKIRLQAQ 146



>gb:AB019236_1514251 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MXK3.>gb:BT008613_1639827 Arabidopsis thaliana
           clone RAFL15-32-C04 (R20929) putative mitochondrial
           carrier protein (At5g64970) mRNA, complete
           cds.>gb:BT015788_1642406 Arabidopsis thaliana At5g64970
           mRNA, complete cds.
          Length = 428

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 24/70 (34%), Positives = 40/70 (57%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD I+T     G   LG        +VG+   + Q EG   +Y+GL P+++++ P+ AV
Sbjct: 244 PLDTIRTVMVAPGGEALGG-------VVGAFRHMIQTEGFFSLYKGLVPSLVSMAPSGAV 296

Query: 672 YFTIYEQLKS 701
           ++ +Y+ LKS
Sbjct: 297 FYGVYDILKS 306



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 20/72 (27%), Positives = 39/72 (54%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P +V++ R Q+    K  +        V +  +I ++ G+  +Y GL P++L +LP+ A+
Sbjct: 358 PFEVVRRRLQMQSHAKRLSA-------VATCVKIIEQGGVPALYAGLIPSLLQVLPSAAI 410

Query: 672 YFTIYEQLKSFL 707
            + +YE +K  L
Sbjct: 411 SYFVYEFMKVVL 422



>gb:AK045863_1167560 Mus musculus adult male corpora quadrigemina
           cDNA, RIKEN full-length enriched library,
           clone:B230315F11 product:similar to MITOCHONDRIAL
           CARRIER FAMILY PROTEIN [Homo sapiens], full insert
           sequence.>gb:AK084797_1174332 Mus musculus 13 days
           embryo heart cDNA, RIKEN full-length enriched library,
           clone:D330044F17 product:similar to MITOCHONDRIAL
           CARRIER FAMILY PROTEIN [Homo sapiens], full insert
           sequence.>gb:AK088444_1175407 Mus musculus 2 days
           neonate thymus thymic cells cDNA, RIKEN full-length
           enriched library, clone:E430016M04 product:similar to
           MITOCHONDRIAL CARRIER FAMILY PROTEIN [Homo sapiens],
           full insert sequence.>gb:BC083103_2108513 Mus musculus
           RIKEN cDNA B230315F11 gene, mRNA (cDNA clone MGC:103255
           IMAGE:30726859), complete cds.
          Length = 337

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 27/94 (28%), Positives = 50/94 (53%)
 Frame = +3

Query: 552 NIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHE 731
           N RG+L   +  +I + EG++ ++ GL PT++  +P   +YFT YEQL +FL +    +E
Sbjct: 84  NFRGTL--DAFLKILRNEGIKSLWSGLPPTLVMAIPATVIYFTCYEQLSAFLKTKLGENE 141

Query: 732 LSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
             I                  +PL +++T++Q++
Sbjct: 142 TRI--PIVAGVVARFGAVTVISPLELIRTKVQSK 173



 Score = 43.1 bits (100), Expect = 0.011
 Identities = 29/118 (24%), Positives = 50/118 (42%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T + PL++I+T+ Q        +       +   +      +G   +++G +PT+L  +P
Sbjct: 158 TVISPLELIRTKVQ--------SKKFSYKELYQFVSMRVSEDGWISLWKGWAPTILRDVP 209

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
             A+Y+  YE LK +LC     +E +                    P  VVKT+ QTQ
Sbjct: 210 FSAMYWYNYENLKRWLCEKSGLYEPTFMINFTSGALSGSFAAVATLPFDVVKTQKQTQ 267



>gb:AK044260_1166888 Mus musculus adult retina cDNA, RIKEN
           full-length enriched library, clone:A930004C23
           product:similar to MITOCHONDRIAL CARRIER FAMILY PROTEIN
           [Homo sapiens], full insert sequence.
          Length = 337

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 27/94 (28%), Positives = 50/94 (53%)
 Frame = +3

Query: 552 NIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHE 731
           N RG+L   +  +I + EG++ ++ GL PT++  +P   +YFT YEQL +FL +    +E
Sbjct: 84  NFRGTL--DAFLKILRNEGIKSLWSGLPPTLVMAIPATVIYFTCYEQLSAFLKTKLGENE 141

Query: 732 LSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
             I                  +PL +++T++Q++
Sbjct: 142 TRI--PIVAGVVARFGAVTVISPLELIRTKVQSK 173



 Score = 43.1 bits (100), Expect = 0.011
 Identities = 29/118 (24%), Positives = 50/118 (42%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T + PL++I+T+ Q        +       +   +      +G   +++G +PT+L  +P
Sbjct: 158 TVISPLELIRTKVQ--------SKKFSYKELYQFVSMRVSEDGWISLWKGWAPTILRDVP 209

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
             A+Y+  YE LK +LC     +E +                    P  VVKT+ QTQ
Sbjct: 210 FSAMYWYNYENLKRWLCEKSGLYEPTFMINFTSGALSGSFAAVATLPFDVVKTQKQTQ 267



>gb:AE014134_1127950 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003616_1218057 Drosophila melanogaster
           chromosome 2L, section 25 of 83 of the complete
           sequence.>gb:AY069591_1294321 Drosophila melanogaster
           LD34154 full length cDNA.
          Length = 299

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 27/76 (35%), Positives = 38/76 (50%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           PLD IK R Q    P  G    R   ++    + F+ EG RG YRG+S  ++ + P +AV
Sbjct: 34  PLDTIKVRLQTMPTPPPGQPP-RYKGVIDCAARTFRYEGFRGFYRGISAPLVGVTPIYAV 92

Query: 672 YFTIYEQLKSFLCSDD 719
            F +Y   K    +DD
Sbjct: 93  DFAVYAAGKRLFQTDD 108



>sp|P38127|RIM2_YEAST Mitochondrial carrier protein
           RIM2.>pir|S36081|S36081 probable carrier protein RIM2,
           mitochondrial - yeast  (Saccharomyces
           cerevisiae)>gb:AY557871_1614098 Saccharomyces cerevisiae
           clone FLH000960.01X YBR192W gene, complete
           cds.>gb:SCCHRIIFG_1706752 S.cerevisiae RIM, MSI1, PGI,
           and ribosomal protein L21 genes.>gb:SCYBR192W_1711432
           S.cerevisiae chromosome II reading frame ORF YBR192w.
          Length = 377

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 29/134 (21%), Positives = 53/134 (39%), Gaps = 21/134 (15%)
 Frame = +3

Query: 489 CPLDVIKTRFQVHGL-----------------PKLGNTNIRGSL----IVGSLEQIFQRE 605
           CP D++KTR Q                     PK  N  I+        +G +  ++++E
Sbjct: 71  CPFDLVKTRLQSDIFLKAYKSQAVNISKGSTRPKSINYVIQAGTHFKETLGIIGNVYKQE 130

Query: 606 GLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXX 785
           G R +++GL P ++ ++P  ++ F  Y   K          + +                
Sbjct: 131 GFRSLFKGLGPNLVGVIPARSINFFTYGTTKDMYAKAFNNGQETPMIHLMAAATAGWATA 190

Query: 786 XXXNPLWVVKTRLQ 827
              NP+W++KTR+Q
Sbjct: 191 TATNPIWLIKTRVQ 204



 Score = 36.6 bits (83), Expect = 1.0
 Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 1/73 (1%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRG-SLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA 668
           P+ +IKTR Q   L K G T++R        L+ + + EG  G+Y+GLS + L  +    
Sbjct: 195 PIWLIKTRVQ---LDKAGKTSVRQYKNSWDCLKSVIRNEGFTGLYKGLSASYLGSVEG-I 250

Query: 669 VYFTIYEQLKSFL 707
           + + +YEQ+K  +
Sbjct: 251 LQWLLYEQMKRLI 263



 Score = 35.0 bits (79), Expect = 2.9
 Identities = 22/66 (33%), Positives = 37/66 (56%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P +V++TR +    PK  N   + + +V S + I + EGL  MY GL+P ++  +PN  +
Sbjct: 308 PHEVVRTRLRQ--TPK-ENGKRKYTGLVQSFKVIIKEEGLFSMYSGLTPHLMRTVPNSII 364

Query: 672 YFTIYE 689
            F  +E
Sbjct: 365 MFGTWE 370



>sp|P38702|LEU5_YEAST Mitochondrial carrier protein
           LEU5.>pir|S46795|S46795 hypothetical protein YHR002w -
           yeast (Saccharomyces cerevisiae)>gb:YSCH9780_1729245
           Saccharomyces cerevisiae chromosome VIII cosmid 9780.
          Length = 357

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 32/83 (38%), Positives = 45/83 (54%), Gaps = 2/83 (2%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLI--VGSLEQIFQREGLRGMYRGLSPTVLAL 653
           T + PLD IK  FQ    P    T   GSLI  V + + I+  +G+RG ++G S T+L +
Sbjct: 49  TLIAPLDRIKILFQTSN-PHY--TKYTGSLIGLVEAAKHIWINDGVRGFFQGHSATLLRI 105

Query: 654 LPNWAVYFTIYEQLKSFLCSDDE 722
            P  AV F  YEQ+++ L    E
Sbjct: 106 FPYAAVKFVAYEQIRNTLIPSKE 128



 Score = 36.2 bits (82), Expect = 1.3
 Identities = 22/73 (30%), Positives = 35/73 (47%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T   P ++I+ R QV  L      + +   I      IF+  G+RG + GLS   + + P
Sbjct: 280 TAAYPFEIIRRRLQVSALSPKTMYDHKFQSISEIAHIIFKERGVRGFFVGLSIGYIKVTP 339

Query: 660 NWAVYFTIYEQLK 698
             A  F +YE++K
Sbjct: 340 MVACSFFVYERMK 352



>sp|Q9DAM5|DNC_MOUSE Mitochondrial deoxynucleotide
           carrier.>gb:AK005710_1153186 Mus musculus adult male
           testis cDNA, RIKEN full-length enriched library,
           clone:1700007G02 product:solute carrier family 25
           (mitochondrial deoxynucleotide carrier), member 19, full
           insert sequence.>gb:BC018167_2092563 Mus musculus solute
           carrier family 25 (mitochondrial deoxynucleotide
           carrier), member 19, mRNA (cDNA clone MGC:25742
           IMAGE:3989263), complete cds.
          Length = 318

 Score = 47.4 bits (111), Expect = 6e-04
 Identities = 26/71 (36%), Positives = 42/71 (59%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           V P+DV++TR    G PK+ N N+R ++       +++ EG    Y+GL+PTV+A+ P  
Sbjct: 136 VHPVDVLRTRLAAQGEPKIYN-NLREAI-----RTMYKTEGPFVFYKGLTPTVIAIFPYA 189

Query: 666 AVYFTIYEQLK 698
            + F+ Y  LK
Sbjct: 190 GLQFSCYRSLK 200



 Score = 44.7 bits (104), Expect = 0.004
 Identities = 33/119 (27%), Positives = 52/119 (43%), Gaps = 2/119 (1%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKL--GNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           + PLDVIK RFQ+  + +L   + N +   I  + +QI Q EG R  ++G  P  +  + 
Sbjct: 33  ISPLDVIKIRFQLQ-IERLCPSDPNAKYHGIFQAAKQILQEEGPRAFWKGHVPAQILSIG 91

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
             AV F  +E+L   L   +                         +P+ V++TRL  QG
Sbjct: 92  YGAVQFLAFEELTELLYQANLYQTHQFSAHFVCGGLSAGTATLTVHPVDVLRTRLAAQG 150



 Score = 43.1 bits (100), Expect = 0.011
 Identities = 27/75 (36%), Positives = 39/75 (52%), Gaps = 5/75 (6%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNT-----NIRGSLIVGSLEQIFQREGLRGMYRGLSPTV 644
           TF  PLD+IK R QV G     +      + RG L +   +Q+ Q EG RG ++GLSP++
Sbjct: 232 TFTYPLDLIKKRLQVGGFEHARSAFGQVRSYRGLLDL--TQQVLQEEGTRGFFKGLSPSL 289

Query: 645 LALLPNWAVYFTIYE 689
           +    +    F  YE
Sbjct: 290 MKAALSTGFMFFWYE 304



>gb:BC088076_2565587 Xenopus tropicalis hypothetical LOC496786, mRNA
           (cDNA clone IMAGE:7024914), partial cds.
          Length = 362

 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 27/94 (28%), Positives = 47/94 (50%)
 Frame = +3

Query: 588 QIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXX 767
           +I + EGL  ++ GL PT++  +P   +YFT Y+QL+ FLC     H   I         
Sbjct: 117 KITRHEGLTSLWSGLPPTLVMAVPATIIYFTCYDQLRDFLCYGLGYHGSHI--PLIAGAL 174

Query: 768 XXXXXXXXXNPLWVVKTRLQTQGMRAGVVGVHYR 869
                    +PL +++T++Q++ +    +GV  R
Sbjct: 175 ARLGAVTVISPLELIRTKMQSRQLSYMELGVCLR 208



 Score = 42.4 bits (98), Expect = 0.018
 Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 1/72 (1%)
 Frame = +3

Query: 492 PLDVIKTRFQVH-GLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA 668
           P DV+KT+ Q+  G  +LG +  + S   G++ +I    G RG++ G  P V+ + P  A
Sbjct: 279 PFDVVKTQRQIELGNLELGPSRKQRSSTWGAMRRIRAESGTRGLFAGFLPRVIKVAPACA 338

Query: 669 VYFTIYEQLKSF 704
           +  + YE  K+F
Sbjct: 339 IMISSYEFGKNF 350



 Score = 34.3 bits (77), Expect(2) = 0.63
 Identities = 27/118 (22%), Positives = 47/118 (39%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           T + PL++I+T+ Q   L  +         +   L     ++G   +++G  PTVL  +P
Sbjct: 181 TVISPLELIRTKMQSRQLSYME--------LGVCLRSAVSQDGWLSLWKGWGPTVLRDVP 232

Query: 660 NWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQ 833
             A+Y+  YE +K  + +     E                      P  VVKT+ Q +
Sbjct: 233 FSALYWFNYELVKKKMSNTKAAVESPFLVSFSAGAVSGAVAAVLTLPFDVVKTQRQIE 290



 Score = 21.9 bits (45), Expect(2) = 0.63
 Identities = 10/18 (55%), Positives = 11/18 (61%)
 Frame = +2

Query: 860 TLSALRRIAREKGILGLF 913
           T  A+RRI  E G  GLF
Sbjct: 306 TWGAMRRIRAESGTRGLF 323



>gb:BC084458_2563832 Xenopus tropicalis cDNA clone MGC:89262
           IMAGE:6976608, complete cds.
          Length = 291

 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 35/129 (27%), Positives = 60/129 (46%), Gaps = 7/129 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLP---KLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           P+D+ KTR QV G     K      RG L   ++ +I++ EG++ +Y G++P +L     
Sbjct: 25  PIDLTKTRLQVQGQANDAKYKEIRYRGML--HAIVRIWKEEGVKALYSGIAPAMLRQASY 82

Query: 663 WAVYFTIYEQLKSFL--CSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
             +    Y+ LK     C +DE   +++                  NP  V+K R+Q QG
Sbjct: 83  GTIKIGTYQSLKRLFVDCPEDETLVINV----FCGVLSGVVSSCIANPTDVLKIRMQAQG 138

Query: 837 --MRAGVVG 857
             ++ G++G
Sbjct: 139 SLIQGGMIG 147



 Score = 41.6 bits (96), Expect = 0.031
 Identities = 36/151 (23%), Positives = 58/151 (38%)
 Frame = +3

Query: 417 PSPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIF 596
           P  + L+ N                P DV+K R Q  G      + I+G +I G+   I+
Sbjct: 101 PEDETLVINVFCGVLSGVVSSCIANPTDVLKIRMQAQG------SLIQGGMI-GNFINIY 153

Query: 597 QREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXX 776
           Q+EG RG+++G+S T         V   +Y+  K  L       + ++            
Sbjct: 154 QQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGD-TVYTHFLASFTCGL 212

Query: 777 XXXXXXNPLWVVKTRLQTQGMRAGVVGVHYR 869
                 NP+ VV+TR+  Q     V    Y+
Sbjct: 213 AGALASNPVDVVRTRMMNQRSIRNVSNSSYK 243



 Score = 41.2 bits (95), Expect = 0.041
 Identities = 24/70 (34%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = +3

Query: 492 PLDVIKTRFQ-VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA 668
           P+DV++TR      +  + N++ +G+L    L Q ++ EG   +Y+G  P  L L P   
Sbjct: 220 PVDVVRTRMMNQRSIRNVSNSSYKGTL--DCLLQTWKNEGFFALYKGFWPNWLRLGPWNI 277

Query: 669 VYFTIYEQLK 698
           ++F  YEQLK
Sbjct: 278 IFFITYEQLK 287



>gb:BC063207_2553479 Xenopus tropicalis hypothetical protein
           LOC394840, mRNA (cDNA clone IMAGE:5308614), partial cds.
          Length = 315

 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 35/129 (27%), Positives = 60/129 (46%), Gaps = 7/129 (5%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLP---KLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           P+D+ KTR QV G     K      RG L   ++ +I++ EG++ +Y G++P +L     
Sbjct: 49  PIDLTKTRLQVQGQANDAKYKEIRYRGML--HAIVRIWKEEGVKALYSGIAPAMLRQASY 106

Query: 663 WAVYFTIYEQLKSFL--CSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQG 836
             +    Y+ LK     C +DE   +++                  NP  V+K R+Q QG
Sbjct: 107 GTIKIGTYQSLKRLFVDCPEDETLVINV----FCGVLSGVVSSCIANPTDVLKIRMQAQG 162

Query: 837 --MRAGVVG 857
             ++ G++G
Sbjct: 163 SLIQGGMIG 171



 Score = 41.6 bits (96), Expect = 0.031
 Identities = 36/151 (23%), Positives = 58/151 (38%)
 Frame = +3

Query: 417 PSPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIF 596
           P  + L+ N                P DV+K R Q  G      + I+G +I G+   I+
Sbjct: 125 PEDETLVINVFCGVLSGVVSSCIANPTDVLKIRMQAQG------SLIQGGMI-GNFINIY 177

Query: 597 QREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXX 776
           Q+EG RG+++G+S T         V   +Y+  K  L       + ++            
Sbjct: 178 QQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGD-TVYTHFLASFTCGL 236

Query: 777 XXXXXXNPLWVVKTRLQTQGMRAGVVGVHYR 869
                 NP+ VV+TR+  Q     V    Y+
Sbjct: 237 AGALASNPVDVVRTRMMNQRSIRNVSNSSYK 267



 Score = 41.2 bits (95), Expect = 0.041
 Identities = 24/70 (34%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = +3

Query: 492 PLDVIKTRFQ-VHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWA 668
           P+DV++TR      +  + N++ +G+L    L Q ++ EG   +Y+G  P  L L P   
Sbjct: 244 PVDVVRTRMMNQRSIRNVSNSSYKGTL--DCLLQTWKNEGFFALYKGFWPNWLRLGPWNI 301

Query: 669 VYFTIYEQLK 698
           ++F  YEQLK
Sbjct: 302 IFFITYEQLK 311



>gb:AJ720830_2503017 Gallus gallus mRNA for hypothetical protein,
           clone 27c17.
          Length = 675

 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 37/128 (28%), Positives = 55/128 (42%), Gaps = 9/128 (7%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSL---------EQIFQREGLRGMYRGL 632
           T V P+D++KTR Q        N    GS  VG L         +++ + EG  G+YRGL
Sbjct: 343 TAVYPIDLVKTRMQ--------NQRSTGSF-VGELMYKNSFDCFKKVLRYEGFFGLYRGL 393

Query: 633 SPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVV 812
            P +L + P  A+  T+ + ++    S D    + +                  NPL +V
Sbjct: 394 LPQLLGVAPEKAIKLTVNDFVRDKFMSKD--GSVPLAAEILAGGCAGGSQVIFTNPLEIV 451

Query: 813 KTRLQTQG 836
           K RLQ  G
Sbjct: 452 KIRLQVAG 459



 Score = 41.2 bits (95), Expect = 0.041
 Identities = 36/122 (29%), Positives = 51/122 (41%)
 Frame = +3

Query: 483 FVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           F  PL+++K R QV G    G         V +L  + +  G  G+Y+G     L  +P 
Sbjct: 444 FTNPLEIVKIRLQVAGEITTGPR-------VSALT-VLRDLGFFGLYKGAKACFLRDIPF 495

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMR 842
            A+YF  Y  LK+   ++D R  +S                    P  V+KTRLQ    R
Sbjct: 496 SAIYFPCYAHLKASFANEDGR--VSPGNLLLAGSIAGMPAASLVTPADVIKTRLQV-AAR 552

Query: 843 AG 848
           AG
Sbjct: 553 AG 554



 Score = 38.9 bits (89), Expect = 0.20
 Identities = 25/79 (31%), Positives = 37/79 (46%)
 Frame = +3

Query: 480 TFVCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLP 659
           + V P DVIKTR QV    + G T   G  +V    +I + EG + +++G    V    P
Sbjct: 535 SLVTPADVIKTRLQV--AARAGQTTYSG--VVDCFVKILREEGPKALWKGAGARVFRSSP 590

Query: 660 NWAVYFTIYEQLKSFLCSD 716
            + V    YE L+ +   D
Sbjct: 591 QFGVTLVTYELLQRWFYVD 609



>gb:AF177333_1888076 Homo sapiens clone SP1855 unknown
           mRNA.>gb:BC002702_1968337 Homo sapiens solute carrier
           family 25 (mitochondrial carrier; ornithine transporter)
           member 15, mRNA (cDNA clone MGC:3378 IMAGE:3614008),
           complete cds.
          Length = 301

 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 33/144 (22%), Positives = 59/144 (40%), Gaps = 4/144 (2%)
 Frame = +3

Query: 435 LCNXXXXXXXXXXXXTFVCPLDVIKTRFQ-VHGLPKLGNTNIRGSLIVGSLEQIFQREGL 611
           L N              +CP +++K R Q ++ +   G      + +   ++ I +++G 
Sbjct: 107 LQNAAAGSFASAFAALVLCPTELVKCRLQTMYEMETSGKIAKSQNTVWSVIKSILRKDGP 166

Query: 612 RGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXX 791
            G Y GLS T+L  +P +  +F  YE  +SF  S   + EL                   
Sbjct: 167 LGFYHGLSSTLLREVPGYFFFFGGYELSRSFFASGRSKDELGPVPLMLSGGVGGICLWLA 226

Query: 792 XNPLWVVKTRLQT---QGMRAGVV 854
             P+  +K+R+Q     G +AG +
Sbjct: 227 VYPVDCIKSRIQVLSMSGKQAGFI 250



 Score = 35.8 bits (81), Expect = 1.7
 Identities = 23/81 (28%), Positives = 36/81 (44%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNW 665
           V P+D IK+R QV  +       IR  L       + + EG+  +Y GL PT++   P  
Sbjct: 227 VYPVDCIKSRIQVLSMSGKQAGFIRTFL------NVVKNEGITALYSGLKPTMIRAFPAN 280

Query: 666 AVYFTIYEQLKSFLCSDDERH 728
              F  YE  +  + +  E +
Sbjct: 281 GALFLAYEYSRKLMMNQLEAY 301



>gb:AF151827_1886313 Homo sapiens CGI-69 protein mRNA, complete
           cds.>gb:AK026060_1910497 Homo sapiens cDNA: FLJ22407
           fis, clone HRC08407.>gb:BC001398_1967556 Homo sapiens
           CGI-69 protein, mRNA (cDNA clone MGC:1163
           IMAGE:3051436), complete cds.
          Length = 351

 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 26/82 (31%), Positives = 42/82 (51%)
 Frame = +3

Query: 588 QIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXX 767
           +I + EG R ++ GL  T++  +P  A+YFT Y+QLK+FLC      +L           
Sbjct: 105 KIVRHEGTRTLWSGLPATLVMTVPATAIYFTAYDQLKAFLCGRALTSDL--YAPMVAGAL 162

Query: 768 XXXXXXXXXNPLWVVKTRLQTQ 833
                    +PL +++T+LQ Q
Sbjct: 163 ARLGTVTVISPLELMRTKLQAQ 184



 Score = 38.5 bits (88), Expect = 0.26
 Identities = 36/147 (24%), Positives = 61/147 (41%), Gaps = 2/147 (1%)
 Frame = +3

Query: 393 AMTADAHGPSPKGLLCNXXXXXXXXXXXXTFVCPLDVIKTRFQVHGLP--KLGNTNIRGS 566
           A+T+D + P   G L              T + PL++++T+ Q   +   +LG   +R +
Sbjct: 148 ALTSDLYAPMVAGALARLGTV--------TVISPLELMRTKLQAQHVSYRELGAC-VRTA 198

Query: 567 LIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSDDERHELSIXX 746
           +  G         G R ++ G  PT L  +P  A+Y+  YE +KS+L     + + S+  
Sbjct: 199 VAQG---------GWRSLWLGWGPTALRDVPFSALYWFNYELVKSWLNGFRPKDQTSVGM 249

Query: 747 XXXXXXXXXXXXXXXXNPLWVVKTRLQ 827
                            P  VVKT+ Q
Sbjct: 250 SFVAGGISGTVAAVLTLPFDVVKTQRQ 276



>gb:AE017347_1757792 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 295

 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 36/120 (30%), Positives = 52/120 (43%), Gaps = 1/120 (0%)
 Frame = +3

Query: 486 VCPLDVIKTRFQVHGLPKLGNTNIRGSL-IVGSLEQIFQREGLRGMYRGLSPTVLALLPN 662
           V P + IKTR       + G     GS+ IVGS+    + E +  +YRGL PT++    N
Sbjct: 128 VTPSEAIKTRLIES--QRAGVVTQGGSIAIVGSM---IRTESITSLYRGLVPTMMKQSAN 182

Query: 663 WAVYFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMR 842
            AV FT Y+ +K +    +  H+                      P  VVKTR+Q   +R
Sbjct: 183 SAVRFTSYQAMKDYAMRKNGGHQPGNATIMAIGAVAGVITVYATMPFDVVKTRMQQSSVR 242



 Score = 35.0 bits (79), Expect = 2.9
 Identities = 21/68 (30%), Positives = 34/68 (50%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P DV+KTR Q         +++R    +  L +  + +G+   +RG SP V  L+ +  V
Sbjct: 228 PFDVVKTRMQ--------QSSVRYKSTLDCLVRSLKDDGVLVFWRGASPRVARLVVSGTV 279

Query: 672 YFTIYEQL 695
            F IYE +
Sbjct: 280 TFVIYENV 287



 Score = 33.5 bits (75), Expect = 8.5
 Identities = 29/121 (23%), Positives = 44/121 (36%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P + +KT  Q+          I  S+++   +    R G+ G YRG SP +         
Sbjct: 32  PTEYVKTMSQLGNHGHNTTAQISPSVVI---KDTLARRGITGFYRGCSPVIAGNALKAGT 88

Query: 672 YFTIYEQLKSFLCSDDERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQTQGMRAGV 851
            F  YE ++  L   D +   +                    P   +KTRL  +  RAGV
Sbjct: 89  RFFTYESIRDLLRGPDGKLS-TASNVLAGVGAGCVESIVAVTPSEAIKTRL-IESQRAGV 146

Query: 852 V 854
           V
Sbjct: 147 V 147



>gb:AE017344_1756366 Cryptococcus neoformans var. neoformans JEC21
           chromosome 4, complete sequence.
          Length = 410

 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 41/153 (26%), Positives = 62/153 (40%), Gaps = 32/153 (20%)
 Frame = +3

Query: 492 PLDVIKTRFQ--------------VHGLPKLGNTN--IRGSL-----IVGSLEQIFQREG 608
           P DV+KTR Q                 + K G ++  +RG +      V  +++I   EG
Sbjct: 60  PFDVVKTRLQSDMFRHSSDEGVRHAAEVAKKGGSSGGVRGVMWQFVDTVYLIKRIAVEEG 119

Query: 609 LRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCSD---------DERHELSIXXXXXXX 761
            R +Y+GL P+++ ++P  A+ F  Y   K +L             +  E S        
Sbjct: 120 WRALYKGLGPSLVGIIPARAINFYFYPTSKVYLAKQFPNAPTEKPGQTAEDSPVIHLGAA 179

Query: 762 XXXXXXXXXXXNPLWVVKTRLQTQGMR--AGVV 854
                      NP+WVVKTRLQ    +   GVV
Sbjct: 180 VVAGIMTSTGTNPIWVVKTRLQLSARKKETGVV 212



 Score = 39.3 bits (90), Expect = 0.15
 Identities = 22/66 (33%), Positives = 38/66 (57%)
 Frame = +3

Query: 492 PLDVIKTRFQVHGLPKLGNTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAV 671
           P +VI+TR +   LP  G    +G  ++ +L+ ++  EG+  +Y GL+  +  ++PN A 
Sbjct: 340 PHEVIRTRLRQPALPD-GTVKYKG--LLQTLKLVWMEEGVGALYGGLTAHLFRVVPNAAC 396

Query: 672 YFTIYE 689
            F IYE
Sbjct: 397 MFLIYE 402



>gb:CR382132_1665820 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 319

 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 30/97 (30%), Positives = 48/97 (49%), Gaps = 2/97 (2%)
 Frame = +3

Query: 546 NTNIRGSLIVGSLEQIFQREGLRGMYRGLSPTVLALLPNWAVYFTIYEQLKSFLCS--DD 719
           +T++ G  ++G+++++++  G+R   +G  PTV     N AV FT Y  LK +L +  D 
Sbjct: 156 DTSVSG--LLGNIKEMYKDRGIRAFVQGFFPTVTRQAANSAVRFTTYSALKHWLTNPEDS 213

Query: 720 ERHELSIXXXXXXXXXXXXXXXXXXNPLWVVKTRLQT 830
           E   LS                    P+ VVKTRLQ+
Sbjct: 214 EYGRLSAVWGFGLGLLSSGAMVLATQPIDVVKTRLQS 250


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,017,660,747
Number of Sequences: 1806583
Number of extensions: 18524948
Number of successful extensions: 47808
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 44189
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 47182
length of database: 581,917,975
effective HSP length: 126
effective length of database: 354,288,517
effective search space used: 92469302937
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)