BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig5919
         (704 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|F84921|F84921 hypothetical protein At2g47960 [imported] - Ar...   102   3e-30   Arabidopsis thaliana [mouse-ear cress]
gb:AC005309_1532472 Arabidopsis thaliana chromosome 2 clone F17A...   102   3e-30   
gb:AE016959_1023273 Oryza sativa (japonica cultivar-group) chrom...    70   1e-21   
gb:AE014134_1128531 Drosophila melanogaster chromosome 2L, compl...    34   0.001   
gb:BC059537_2552514 Danio rerio zgc:73187, mRNA (cDNA clone MGC:...    42   0.014   
gb:AJ720892_2503079 Gallus gallus mRNA for hypothetical protein,...    40   0.031   
gb:HSM807181_2018593 Homo sapiens mRNA; cDNA DKFZp686I20227 (fro...    40   0.031   
gb:CR861256_1185263 Pongo pygmaeus mRNA; cDNA DKFZp459P083 (from...    40   0.031   
gb:CR858310_1182495 Pongo pygmaeus mRNA; cDNA DKFZp468J127 (from...    40   0.031   
gb:BC088172_2110373 Rattus norvegicus cDNA clone MGC:108800 IMAG...    40   0.040   
gb:BC021756_2093609 Mus musculus RIKEN cDNA 2410002O22 gene, mRN...    40   0.040   
gb:AX883131_1479208 Sequence 18036 from Patent EP1074617.>gb:AK0...    40   0.040   
gb:AK084373_1174219 Mus musculus 12 days embryo eyeball cDNA, RI...    40   0.040   
gb:AK013956_1157720 Mus musculus 13 days embryo head cDNA, RIKEN...    40   0.040   
gb:AK010346_1155695 Mus musculus ES cells cDNA, RIKEN full-lengt...    40   0.040   
gb:BC073045_2556957 Xenopus laevis MGC82662 protein, mRNA (cDNA ...    39   0.089   
gb:AB050090_1520943 Angiopteris lygodiifolia AnLFY1 mRNA for LFY...    36   0.76    
gb:BC071597_1988678 Homo sapiens KIAA0286 protein, mRNA (cDNA cl...    33   3.8     
gb:AB006624_1863850 Homo sapiens mRNA for KIAA0286 gene, partial...    33   3.8     
sp|O14524|Y286_HUMAN|Y286_HUMAN Hypothetical protein KIAA0286 (HA6800) (Fra...    33   3.8     Homo sapiens [man]


>pir|F84921|F84921 hypothetical protein At2g47960 [imported] -
           Arabidopsis thaliana
          Length = 508

 Score =  102 bits (253), Expect(2) = 3e-30
 Identities = 58/107 (54%), Positives = 72/107 (67%), Gaps = 5/107 (4%)
 Frame = +2

Query: 128 SATQT----PHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPR-LLS 292
           SATQT    PHSLAFRVMRLC+PS HV+ PLR +  DLL GED  DD  +A    R + S
Sbjct: 2   SATQTQTHGPHSLAFRVMRLCKPSFHVDPPLRIDPFDLLAGEDFSDDPSSASLFRRHVSS 61

Query: 293 GDSVNAGPNVVDPSDLSYRSRFLLEQSSESVGLPGLLVLPQSFGLVF 433
            D+V+        SDLSYR+RFLL   ++ +GL GLL+LPQSFG ++
Sbjct: 62  ADAVD--------SDLSYRNRFLLNHPTDPIGLSGLLLLPQSFGAIY 100



 Score = 52.8 bits (125), Expect(2) = 3e-30
 Identities = 23/30 (76%), Positives = 27/30 (90%)
 Frame = +1

Query: 535 AIYLGETFCSYISINNSSSFEVRDIVIKVD 624
           AIYLGETFCSYIS+NNSS+ EVRD+ IK +
Sbjct: 98  AIYLGETFCSYISVNNSSTSEVRDVTIKAE 127



>gb:AC005309_1532472 Arabidopsis thaliana chromosome 2 clone F17A22
           map CIC06C03, complete sequence.>gb:AC006072_1533405
           Arabidopsis thaliana chromosome 2 clone T9J23 map
           CIC06C03, complete sequence.>gb:AY074352_1567507
           Arabidopsis thaliana unknown protein (At2g47960) mRNA,
           complete cds.>gb:AY113973_1578384 Arabidopsis thaliana
           unknown protein (At2g47960) mRNA, complete
           cds.>gb:AF428334_1799264 Arabidopsis thaliana
           At2g47960/T9J23.10 mRNA, complete cds.
          Length = 442

 Score =  102 bits (253), Expect(2) = 3e-30
 Identities = 58/107 (54%), Positives = 72/107 (67%), Gaps = 5/107 (4%)
 Frame = +2

Query: 128 SATQT----PHSLAFRVMRLCRPSLHVETPLRFNACDLLFGEDLFDDSLAADHLPR-LLS 292
           SATQT    PHSLAFRVMRLC+PS HV+ PLR +  DLL GED  DD  +A    R + S
Sbjct: 2   SATQTQTHGPHSLAFRVMRLCKPSFHVDPPLRIDPFDLLAGEDFSDDPSSASLFRRHVSS 61

Query: 293 GDSVNAGPNVVDPSDLSYRSRFLLEQSSESVGLPGLLVLPQSFGLVF 433
            D+V+        SDLSYR+RFLL   ++ +GL GLL+LPQSFG ++
Sbjct: 62  ADAVD--------SDLSYRNRFLLNHPTDPIGLSGLLLLPQSFGAIY 100



 Score = 52.8 bits (125), Expect(2) = 3e-30
 Identities = 23/30 (76%), Positives = 27/30 (90%)
 Frame = +1

Query: 535 AIYLGETFCSYISINNSSSFEVRDIVIKVD 624
           AIYLGETFCSYIS+NNSS+ EVRD+ IK +
Sbjct: 98  AIYLGETFCSYISVNNSSTSEVRDVTIKAE 127



>gb:AE016959_1023273 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC079888_1732973
           Oryza sativa chromosome 10 BAC OSJNBa0078O01 genomic
           sequence, complete sequence.>gb:AE017109_1753092 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           63 of 77 of the complete sequence.
          Length = 473

 Score = 70.1 bits (170), Expect(2) = 1e-21
 Identities = 46/106 (43%), Positives = 56/106 (52%), Gaps = 7/106 (6%)
 Frame = +2

Query: 137 QTPHSLAFRVMRLCRPSLHVE--TPLRFNACDLLFGEDLFDD-----SLAADHLPRLLSG 295
           Q  HSLAFRVMRL RPSL  +    LRF+  D+   ED         S AAD    L   
Sbjct: 28  QQNHSLAFRVMRLSRPSLQPDQAAALRFDPRDVFLPEDALTGPDPSASSAADAAAFLQGL 87

Query: 296 DSVNAGPNVVDPSDLSYRSRFLLEQSSESVGLPGLLVLPQSFGLVF 433
                 P    P D ++R RFLL    +++ LPGLLVLPQSFG ++
Sbjct: 88  LHPLDSPATTVPGDFTFRDRFLLRDPVDALALPGLLVLPQSFGAIY 133



 Score = 55.8 bits (133), Expect(2) = 1e-21
 Identities = 25/30 (83%), Positives = 27/30 (90%)
 Frame = +1

Query: 535 AIYLGETFCSYISINNSSSFEVRDIVIKVD 624
           AIYLGETFCSYISINNSSSFE RD+ IK +
Sbjct: 131 AIYLGETFCSYISINNSSSFEARDVAIKAE 160



>gb:AE014134_1128531 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003628_1218638 Drosophila melanogaster
           chromosome 2L, section 37 of 83 of the complete
           sequence.>gb:AY058665_1291819 Drosophila melanogaster
           LD37668 full length cDNA.
          Length = 438

 Score = 34.3 bits (77), Expect(2) = 0.001
 Identities = 14/30 (46%), Positives = 21/30 (70%)
 Frame = +1

Query: 535 AIYLGETFCSYISINNSSSFEVRDIVIKVD 624
           +IYLGETF SYI ++N++   V  + +K D
Sbjct: 72  SIYLGETFASYICVHNTTPNPVECVTVKAD 101



 Score = 30.0 bits (66), Expect(2) = 0.001
 Identities = 25/72 (34%), Positives = 34/72 (47%), Gaps = 11/72 (15%)
 Frame = +2

Query: 251 DDSLAADHLPRLLSGDSVNAGPNVV-DPSDLSYRSRFLLEQSSESVGLPG---------- 397
           D  L A  + RL+    V  GP V  +P+DL  R       S ES G+ G          
Sbjct: 7   DAHLVALKVMRLMRPTLVGLGPVVTCEPTDLVQR----FSSSQESDGMSGACAETLAAGQ 62

Query: 398 LLVLPQSFGLVF 433
           +L+LPQSFG ++
Sbjct: 63  VLLLPQSFGSIY 74



>gb:BC059537_2552514 Danio rerio zgc:73187, mRNA (cDNA clone
           MGC:73187 IMAGE:4787496), complete
           cds.>gb:BC071349_2556091 Danio rerio zgc:73187, mRNA
           (cDNA clone MGC:86664 IMAGE:6894565), complete cds.
          Length = 385

 Score = 41.6 bits (96), Expect = 0.014
 Identities = 21/44 (47%), Positives = 30/44 (68%), Gaps = 2/44 (4%)
 Frame = +1

Query: 499 ILINEKLRCPCRA--IYLGETFCSYISINNSSSFEVRDIVIKVD 624
           +++ E L  P     I+LGETF SYIS++N SS  V+DI++K D
Sbjct: 32  LILGEMLTLPQNFGNIFLGETFSSYISVHNDSSQVVKDILVKAD 75



>gb:AJ720892_2503079 Gallus gallus mRNA for hypothetical protein,
           clone 29c21.
          Length = 207

 Score = 40.4 bits (93), Expect = 0.031
 Identities = 20/44 (45%), Positives = 30/44 (68%), Gaps = 2/44 (4%)
 Frame = +1

Query: 499 ILINEKLRCPCRA--IYLGETFCSYISINNSSSFEVRDIVIKVD 624
           +++ E L  P     I+LGETF SYIS++N S+  V+DI++K D
Sbjct: 59  LMLGEMLTLPQNFGNIFLGETFSSYISVHNDSNQVVKDILVKAD 102



>gb:HSM807181_2018593 Homo sapiens mRNA; cDNA DKFZp686I20227 (from
           clone DKFZp686I20227).
          Length = 309

 Score = 40.4 bits (93), Expect = 0.031
 Identities = 20/44 (45%), Positives = 30/44 (68%), Gaps = 2/44 (4%)
 Frame = +1

Query: 499 ILINEKLRCPCRA--IYLGETFCSYISINNSSSFEVRDIVIKVD 624
           +++ E L  P     I+LGETF SYIS++N S+  V+DI++K D
Sbjct: 59  LMLGEMLTLPQNFGNIFLGETFSSYISVHNDSNQVVKDILVKAD 102



>gb:CR861256_1185263 Pongo pygmaeus mRNA; cDNA DKFZp459P083 (from
           clone DKFZp459P083).
          Length = 411

 Score = 40.4 bits (93), Expect = 0.031
 Identities = 20/44 (45%), Positives = 30/44 (68%), Gaps = 2/44 (4%)
 Frame = +1

Query: 499 ILINEKLRCPCRA--IYLGETFCSYISINNSSSFEVRDIVIKVD 624
           +++ E L  P     I+LGETF SYIS++N S+  V+DI++K D
Sbjct: 59  LMLGEMLTLPQNFGNIFLGETFSSYISVHNDSNQVVKDILVKAD 102



>gb:CR858310_1182495 Pongo pygmaeus mRNA; cDNA DKFZp468J127 (from
           clone DKFZp468J127).
          Length = 417

 Score = 40.4 bits (93), Expect = 0.031
 Identities = 20/44 (45%), Positives = 30/44 (68%), Gaps = 2/44 (4%)
 Frame = +1

Query: 499 ILINEKLRCPCRA--IYLGETFCSYISINNSSSFEVRDIVIKVD 624
           +++ E L  P     I+LGETF SYIS++N S+  V+DI++K D
Sbjct: 59  LMLGEMLTLPQNFGNIFLGETFSSYISVHNDSNQVVKDILVKAD 102



>gb:BC088172_2110373 Rattus norvegicus cDNA clone MGC:108800
           IMAGE:7323103, complete cds.
          Length = 359

 Score = 40.0 bits (92), Expect = 0.040
 Identities = 17/29 (58%), Positives = 24/29 (82%)
 Frame = +1

Query: 538 IYLGETFCSYISINNSSSFEVRDIVIKVD 624
           I+LGETF SYIS++N S+  V+DI++K D
Sbjct: 15  IFLGETFSSYISVHNDSNQVVKDILVKAD 43



>gb:BC021756_2093609 Mus musculus RIKEN cDNA 2410002O22 gene, mRNA
           (cDNA clone MGC:25526 IMAGE:3584010), complete cds.
          Length = 355

 Score = 40.0 bits (92), Expect = 0.040
 Identities = 17/29 (58%), Positives = 24/29 (82%)
 Frame = +1

Query: 538 IYLGETFCSYISINNSSSFEVRDIVIKVD 624
           I+LGETF SYIS++N S+  V+DI++K D
Sbjct: 11  IFLGETFSSYISVHNDSNQVVKDILVKAD 39



>gb:AX883131_1479208 Sequence 18036 from Patent
           EP1074617.>gb:AK023673_1909700 Homo sapiens cDNA
           FLJ13611 fis, clone PLACE1010802.
          Length = 354

 Score = 40.0 bits (92), Expect = 0.040
 Identities = 17/29 (58%), Positives = 24/29 (82%)
 Frame = +1

Query: 538 IYLGETFCSYISINNSSSFEVRDIVIKVD 624
           I+LGETF SYIS++N S+  V+DI++K D
Sbjct: 11  IFLGETFSSYISVHNDSNQVVKDILVKAD 39



>gb:AK084373_1174219 Mus musculus 12 days embryo eyeball cDNA, RIKEN
           full-length enriched library, clone:D230034D01
           product:hypothetical protein, full insert sequence.
          Length = 354

 Score = 40.0 bits (92), Expect = 0.040
 Identities = 17/29 (58%), Positives = 24/29 (82%)
 Frame = +1

Query: 538 IYLGETFCSYISINNSSSFEVRDIVIKVD 624
           I+LGETF SYIS++N S+  V+DI++K D
Sbjct: 11  IFLGETFSSYISVHNDSNQVVKDILVKAD 39



>gb:AK013956_1157720 Mus musculus 13 days embryo head cDNA, RIKEN
           full-length enriched library, clone:3110001K19
           product:hypothetical protein, full insert sequence.
          Length = 355

 Score = 40.0 bits (92), Expect = 0.040
 Identities = 17/29 (58%), Positives = 24/29 (82%)
 Frame = +1

Query: 538 IYLGETFCSYISINNSSSFEVRDIVIKVD 624
           I+LGETF SYIS++N S+  V+DI++K D
Sbjct: 11  IFLGETFSSYISVHNDSNQVVKDILVKAD 39



>gb:AK010346_1155695 Mus musculus ES cells cDNA, RIKEN full-length
           enriched library, clone:2410002O22 product:hypothetical
           protein, full insert sequence.
          Length = 349

 Score = 40.0 bits (92), Expect = 0.040
 Identities = 17/29 (58%), Positives = 24/29 (82%)
 Frame = +1

Query: 538 IYLGETFCSYISINNSSSFEVRDIVIKVD 624
           I+LGETF SYIS++N S+  V+DI++K D
Sbjct: 11  IFLGETFSSYISVHNDSNQVVKDILVKAD 39



>gb:BC073045_2556957 Xenopus laevis MGC82662 protein, mRNA (cDNA
           clone MGC:82662 IMAGE:5073416), complete cds.
          Length = 369

 Score = 38.9 bits (89), Expect = 0.089
 Identities = 19/44 (43%), Positives = 29/44 (65%), Gaps = 2/44 (4%)
 Frame = +1

Query: 499 ILINEKLRCPCRA--IYLGETFCSYISINNSSSFEVRDIVIKVD 624
           +++ E L  P     I+LGETF SYIS++N S+  V+D+ +K D
Sbjct: 14  LMLGEMLTLPQNFGNIFLGETFSSYISVHNDSNQVVKDVQVKAD 57



>gb:AB050090_1520943 Angiopteris lygodiifolia AnLFY1 mRNA for LFY
           homolog, complete cds.
          Length = 351

 Score = 35.8 bits (81), Expect = 0.76
 Identities = 24/62 (38%), Positives = 32/62 (51%), Gaps = 7/62 (11%)
 Frame = +2

Query: 251 DDSLAA----DHLPRLLSGDSVNAGPNVV---DPSDLSYRSRFLLEQSSESVGLPGLLVL 409
           D+S AA    D  PR   GD+    P+ +    P  L+ +  FLLEQS    G PGLL +
Sbjct: 95  DESAAAATSMDGTPREQRGDNGMMFPDPIVAAGPRSLNTKEPFLLEQSHAHFGTPGLLAI 154

Query: 410 PQ 415
           P+
Sbjct: 155 PE 156



>gb:BC071597_1988678 Homo sapiens KIAA0286 protein, mRNA (cDNA clone
           IMAGE:30344897), partial cds.
          Length = 450

 Score = 33.5 bits (75), Expect = 3.8
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 2/74 (2%)
 Frame = -1

Query: 668 CNSSLQRTNQPIIRQSTLITISLTSKLELLFILI*--LQNVSPRYIALQGHLNFSLIKIQ 495
           C   L R+   I   ST +T+ + + L ++  ++   +   SP Y+ L G  +FSL  IQ
Sbjct: 182 CGDLLSRSQ--IFYYSTGMTVGIVASLLIIIFILSKFMPKKSPIYVILVGGWSFSLYLIQ 239

Query: 494 KTLLNQDSVRQCIW 453
               N   + +C W
Sbjct: 240 LVFKNLQEIWRCYW 253



>gb:AB006624_1863850 Homo sapiens mRNA for KIAA0286 gene, partial
           cds.
          Length = 446

 Score = 33.5 bits (75), Expect = 3.8
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 2/74 (2%)
 Frame = -1

Query: 668 CNSSLQRTNQPIIRQSTLITISLTSKLELLFILI*--LQNVSPRYIALQGHLNFSLIKIQ 495
           C   L R+   I   ST +T+ + + L ++  ++   +   SP Y+ L G  +FSL  IQ
Sbjct: 178 CGDLLSRSQ--IFYYSTGMTVGIVASLLIIIFILSKFMPKKSPIYVILVGGWSFSLYLIQ 235

Query: 494 KTLLNQDSVRQCIW 453
               N   + +C W
Sbjct: 236 LVFKNLQEIWRCYW 249



>sp|O14524|Y286_HUMAN Hypothetical protein KIAA0286 (HA6800)
           (Fragment).
          Length = 429

 Score = 33.5 bits (75), Expect = 3.8
 Identities = 21/74 (28%), Positives = 35/74 (47%), Gaps = 2/74 (2%)
 Frame = -1

Query: 668 CNSSLQRTNQPIIRQSTLITISLTSKLELLFILI*--LQNVSPRYIALQGHLNFSLIKIQ 495
           C   L R+   I   ST +T+ + + L ++  ++   +   SP Y+ L G  +FSL  IQ
Sbjct: 161 CGDLLSRSQ--IFYYSTGMTVGIVASLLIIIFILSKFMPKKSPIYVILVGGWSFSLYLIQ 218

Query: 494 KTLLNQDSVRQCIW 453
               N   + +C W
Sbjct: 219 LVFKNLQEIWRCYW 232


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 596,881,223
Number of Sequences: 1806583
Number of extensions: 10592936
Number of successful extensions: 23567
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 23087
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23562
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 41055321816
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)