BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig5828
         (389 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:CQ871351_1454690 Sequence 3 from Patent WO2004078983.              100   9e-21   
gb:AP003227_1825661 Oryza sativa (japonica cultivar-group) genom...    40   0.014   
gb:BA000030_698873 Streptomyces avermitilis MA-4680 genomic DNA,...    34   1.0     
gb:AY056133_1563468 Arabidopsis thaliana unknown protein (At3g18...    32   3.8     
gb:CQ871361_1454695 Sequence 13 from Patent WO2004078983.>gb:AX7...    32   3.8     
gb:AY596298_634897 Haloarcula marismortui ATCC 43049 chromosome ...    31   6.6     
gb:BC068960_2555452 Xenopus laevis hypothetical protein LOC41449...    31   8.6     
gb:AB021865_1865396 Homo sapiens KCND1 mRNA for shal-type potass...    31   8.6     
gb:AF508368_1806974 Dichelostemma multiflorum NADH dehydrogenase...    31   8.6     
gb:AF508367_1806973 Dichelostemma ida-maia NADH dehydrogenase su...    31   8.6     
gb:AF508366_1806972 Dichelostemma congestum NADH dehydrogenase s...    31   8.6     
gb:AF508362_1806968 Brodiaea stellaris NADH dehydrogenase subuni...    31   8.6     
gb:AF508360_1806966 Brodiaea minor NADH dehydrogenase subunit F ...    31   8.6     
gb:AF508359_1806965 Brodiaea jolonensis NADH dehydrogenase subun...    31   8.6     
gb:AF508358_1806964 Brodiaea filifolia NADH dehydrogenase subuni...    31   8.6     
gb:AF508355_1806961 Brodiaea appendiculata NADH dehydrogenase su...    31   8.6     
gb:CP000001_850930 Bacillus cereus ZK, complete genome.                31   8.6     
gb:AE017355_461623 Bacillus thuringiensis serovar konkukian str....    31   8.6     
gb:AE017265_421594 Bacillus cereus ATCC 10987, section 2 of 18 o...    31   8.6     
gb:AE017225_405721 Bacillus anthracis str. Sterne, complete genome.    31   8.6     
gb:AE017025_380604 Bacillus anthracis str. Ames section 2 of 18 ...    31   8.6     
gb:AE016999_375356 Bacillus cereus ATCC 14579 section 2 of 18 of...    31   8.6     
sp|Q9NSA2|KCD1_HUMAN|KCD1_HUMAN Potassium voltage-gated channel subfamily D...    31   8.6     Homo sapiens [man]


>gb:CQ871351_1454690 Sequence 3 from Patent WO2004078983.
          Length = 648

 Score =  100 bits (249), Expect = 9e-21
 Identities = 48/83 (57%), Positives = 65/83 (78%)
 Frame = +3

Query: 129 GGVGGASPGLIEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPIL 308
           G + G  P  IEPRQRLS  T  E+T+KRR LRSK +++G++AL SPTK+R+ TCKFP +
Sbjct: 3   GSLAGGPPSPIEPRQRLSVFT--EETSKRRFLRSKVFRDGERALHSPTKNRNFTCKFPTV 60

Query: 309 KLVFAVIALGALFTLWHSPAIHS 377
           KL+  VIAL A+++LWHSPAI++
Sbjct: 61  KLILGVIALVAIWSLWHSPAIYN 83



>gb:AP003227_1825661 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0018C10.
          Length = 635

 Score = 40.0 bits (92), Expect = 0.014
 Identities = 24/68 (35%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +3

Query: 174 RLSSSTSSEDTNKRRLLRSKSYKEGDK-ALFSPTKDRSLTCKFPILKLVFAVIALGALFT 350
           R   + +++DT KRR  +SKS+KE +K  +F    ++S  CKF  L+L+   I   A  T
Sbjct: 10  RYRPAGAADDTAKRRTQKSKSFKEVEKFDVF--VLEKSSGCKFRSLQLLLFAIMSAAFLT 67

Query: 351 LWHSPAIH 374
           L ++P+++
Sbjct: 68  LLYTPSVY 75



>gb:BA000030_698873 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 466

 Score = 33.9 bits (76), Expect = 1.0
 Identities = 14/28 (50%), Positives = 17/28 (60%)
 Frame = -1

Query: 164 LNETRGSTTDSTKGSSHIFNLVAARRKW 81
           +  TRG  T ST G  H+ NL+AA R W
Sbjct: 101 IGRTRGEATASTPGERHMVNLLAAARSW 128



>gb:AY056133_1563468 Arabidopsis thaliana unknown protein
           (At3g18660) mRNA, complete cds.>gb:AY142690_1583106
           Arabidopsis thaliana unknown protein (At3g18660) mRNA,
           complete cds.
          Length = 655

 Score = 32.0 bits (71), Expect = 3.8
 Identities = 29/87 (33%), Positives = 45/87 (51%), Gaps = 12/87 (13%)
 Frame = +3

Query: 162 EPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSP-------TKDRSLTC----KFPIL 308
           + R+RLS+S   E   KRR  R+ S   G   +  P       T+D++ +C    KF I+
Sbjct: 17  DSRRRLSASI--EAICKRRFRRN-SKGGGRSDMVKPFNIINFSTQDKNSSCCCFTKFQIV 73

Query: 309 KLVFAVIALGALFTLWHSP-AIHSEIS 386
           KL+  ++    LFT+ +SP A H  +S
Sbjct: 74  KLLLFILLSATLFTIIYSPEAYHHSLS 100



>gb:CQ871361_1454695 Sequence 13 from Patent
           WO2004078983.>gb:AX720343_1473822 Sequence 2 from Patent
           WO03014365.>gb:AB026654_1517295 Arabidopsis thaliana
           genomic DNA, chromosome 3, P1 clone:
           MVE11.>gb:AY749109_1626644 Arabidopsis thaliana
           glycogenin-like starch initiation protein (PGSIP1) mRNA,
           complete cds.
          Length = 659

 Score = 32.0 bits (71), Expect = 3.8
 Identities = 29/87 (33%), Positives = 45/87 (51%), Gaps = 12/87 (13%)
 Frame = +3

Query: 162 EPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSP-------TKDRSLTC----KFPIL 308
           + R+RLS+S   E   KRR  R+ S   G   +  P       T+D++ +C    KF I+
Sbjct: 17  DSRRRLSASI--EAICKRRFRRN-SKGGGRSDMVKPFNIINFSTQDKNSSCCCFTKFQIV 73

Query: 309 KLVFAVIALGALFTLWHSP-AIHSEIS 386
           KL+  ++    LFT+ +SP A H  +S
Sbjct: 74  KLLLFILLSATLFTIIYSPEAYHHSLS 100



>gb:AY596298_634897 Haloarcula marismortui ATCC 43049 chromosome II,
           complete sequence.
          Length = 572

 Score = 31.2 bits (69), Expect = 6.6
 Identities = 21/85 (24%), Positives = 37/85 (43%)
 Frame = +3

Query: 48  RFLALLDRTQMPFSTSCY*VENMRGTLGGVGGASPGLIEPRQRLSSSTSSEDTNKRRLLR 227
           +F+   D   +P    C    +  G + G G    G++E  +++  +TSS    K+ ++ 
Sbjct: 400 QFIWTCDAYNIPLLYLC----DTPGFMAGSGVEKEGILEQGKKMIYATSSATVPKQSVVV 455

Query: 228 SKSYKEGDKALFSPTKDRSLTCKFP 302
            K+Y  G  A+  P  D   T   P
Sbjct: 456 RKAYGAGIYAMSGPAYDPESTIGLP 480



>gb:BC068960_2555452 Xenopus laevis hypothetical protein LOC414497,
           mRNA (cDNA clone IMAGE:6636061), partial cds.
          Length = 1317

 Score = 30.8 bits (68), Expect = 8.6
 Identities = 23/68 (33%), Positives = 30/68 (44%)
 Frame = -1

Query: 350 CKQRSQCNNSKDKLQYREFAGQRPIFGGTEECLIPFFVAFTSQKPPFVGILTRCRRR*PL 171
           CK  S C  +  KL    F G+   F G EEC+  F V F       +G    C+R+  L
Sbjct: 590 CKMCSYCYQTSPKLVRNHFGGKLEEFCG-EECMSKFTVLFYQ-----MGKCDGCKRQGKL 643

Query: 170 SGLNETRG 147
           S   + RG
Sbjct: 644 SDCLKWRG 651



>gb:AB021865_1865396 Homo sapiens KCND1 mRNA for shal-type potassium
           channel (Kv4.1), complete cds.
          Length = 647

 Score = 30.8 bits (68), Expect = 8.6
 Identities = 24/104 (23%), Positives = 41/104 (39%)
 Frame = -1

Query: 350 CKQRSQCNNSKDKLQYREFAGQRPIFGGTEECLIPFFVAFTSQKPPFVGILTRCRRR*PL 171
           C +++ C+   D+L + E  G     G T         + +SQ      +L+ C  R   
Sbjct: 484 CLEKTTCHEFTDELTFSEALGAVSPGGRTSRS-----TSVSSQPVGPGSLLSSCCPRRAK 538

Query: 170 SGLNETRGSTTDSTKGSSHIFNLVAARRKWHLSPIQESKKTKPH 39
                   ST   ++GS    +++A  R+ H    + S   KPH
Sbjct: 539 RRAIRLANSTASVSRGSMQELDMLAGLRRSHAPQSRSSLNAKPH 582



>gb:AF508368_1806974 Dichelostemma multiflorum NADH dehydrogenase
           subunit F (ndhF) gene, partial cds; chloroplast gene for
           chloroplast product.
          Length = 673

 Score = 30.8 bits (68), Expect = 8.6
 Identities = 17/55 (30%), Positives = 29/55 (52%)
 Frame = +3

Query: 180 SSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVIALGAL 344
           S  T   D N R+++R+ S   G+K  +S   +   T  FP+L LV   + +G++
Sbjct: 482 SKGTYQIDDNVRKIIRNFSTYFGNKYTYSYPHESDNTMLFPLLVLVLFTLFVGSI 536



>gb:AF508367_1806973 Dichelostemma ida-maia NADH dehydrogenase
           subunit F (ndhF) gene, partial cds; chloroplast gene for
           chloroplast product.
          Length = 678

 Score = 30.8 bits (68), Expect = 8.6
 Identities = 17/55 (30%), Positives = 29/55 (52%)
 Frame = +3

Query: 180 SSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVIALGAL 344
           S  T   D N R+++R+ S   G+K  +S   +   T  FP+L LV   + +G++
Sbjct: 487 SKGTYQIDDNVRKIIRNFSTYFGNKYTYSYPHESDNTMLFPLLVLVLFTLFVGSI 541



>gb:AF508366_1806972 Dichelostemma congestum NADH dehydrogenase
           subunit F (ndhF) gene, partial cds; chloroplast gene for
           chloroplast product.
          Length = 678

 Score = 30.8 bits (68), Expect = 8.6
 Identities = 17/55 (30%), Positives = 29/55 (52%)
 Frame = +3

Query: 180 SSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVIALGAL 344
           S  T   D N R+++R+ S   G+K  +S   +   T  FP+L LV   + +G++
Sbjct: 487 SKGTYQIDDNVRKIIRNFSTYFGNKYTYSYPHESDNTMLFPLLVLVLFTLFVGSI 541



>gb:AF508362_1806968 Brodiaea stellaris NADH dehydrogenase subunit F
           (ndhF) gene, partial cds; chloroplast gene for
           chloroplast product.>gb:AF508363_1806969 Brodiaea
           terrestris subsp. terrestris NADH dehydrogenase subunit
           F (ndhF) gene, partial cds; chloroplast gene for
           chloroplast product.
          Length = 678

 Score = 30.8 bits (68), Expect = 8.6
 Identities = 17/55 (30%), Positives = 29/55 (52%)
 Frame = +3

Query: 180 SSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVIALGAL 344
           S  T   D N R+++R+ S   G+K  +S   +   T  FP+L LV   + +G++
Sbjct: 487 SKGTYQIDDNVRKIIRNFSTYFGNKYTYSYPHESDNTMLFPLLVLVLFTLFVGSI 541



>gb:AF508360_1806966 Brodiaea minor NADH dehydrogenase subunit F
           (ndhF) gene, partial cds; chloroplast gene for
           chloroplast product.
          Length = 671

 Score = 30.8 bits (68), Expect = 8.6
 Identities = 17/55 (30%), Positives = 29/55 (52%)
 Frame = +3

Query: 180 SSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVIALGAL 344
           S  T   D N R+++R+ S   G+K  +S   +   T  FP+L LV   + +G++
Sbjct: 480 SKGTYQIDDNVRKIIRNFSTYFGNKYTYSYPHESDNTMLFPLLVLVLFTLFVGSI 534



>gb:AF508359_1806965 Brodiaea jolonensis NADH dehydrogenase subunit
           F (ndhF) gene, partial cds; chloroplast gene for
           chloroplast product.
          Length = 678

 Score = 30.8 bits (68), Expect = 8.6
 Identities = 17/55 (30%), Positives = 29/55 (52%)
 Frame = +3

Query: 180 SSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVIALGAL 344
           S  T   D N R+++R+ S   G+K  +S   +   T  FP+L LV   + +G++
Sbjct: 487 SKGTYQIDDNVRKIIRNFSTYFGNKYTYSYPHESDNTMLFPLLVLVLFTLFVGSI 541



>gb:AF508358_1806964 Brodiaea filifolia NADH dehydrogenase subunit F
           (ndhF) gene, partial cds; chloroplast gene for
           chloroplast product.>gb:AF508361_1806967 Brodiaea
           orcuttii NADH dehydrogenase subunit F (ndhF) gene,
           partial cds; chloroplast gene for chloroplast product.
          Length = 678

 Score = 30.8 bits (68), Expect = 8.6
 Identities = 17/55 (30%), Positives = 29/55 (52%)
 Frame = +3

Query: 180 SSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVIALGAL 344
           S  T   D N R+++R+ S   G+K  +S   +   T  FP+L LV   + +G++
Sbjct: 487 SKGTYQIDDNVRKIIRNFSTYFGNKYTYSYPHESDNTMLFPLLVLVLFTLFVGSI 541



>gb:AF508355_1806961 Brodiaea appendiculata NADH dehydrogenase
           subunit F (ndhF) gene, partial cds; chloroplast gene for
           chloroplast product.>gb:AF508357_1806963 Brodiaea
           elegans subsp. elegans NADH dehydrogenase subunit F
           (ndhF) gene, partial cds; chloroplast gene for
           chloroplast product.
          Length = 678

 Score = 30.8 bits (68), Expect = 8.6
 Identities = 17/55 (30%), Positives = 29/55 (52%)
 Frame = +3

Query: 180 SSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLTCKFPILKLVFAVIALGAL 344
           S  T   D N R+++R+ S   G+K  +S   +   T  FP+L LV   + +G++
Sbjct: 487 SKGTYQIDDNVRKIIRNFSTYFGNKYTYSYPHESDNTMLFPLLVLVLFTLFVGSI 541



>gb:CP000001_850930 Bacillus cereus ZK, complete genome.
          Length = 409

 Score = 30.8 bits (68), Expect = 8.6
 Identities = 17/44 (38%), Positives = 23/44 (52%)
 Frame = +3

Query: 159 IEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLT 290
           I+P Q LS S   E     RL+  K+YK G K ++    D +LT
Sbjct: 21  IQPGQTLSISAPLEAVQFVRLVTEKAYKSGAKHVYVDWNDETLT 64



>gb:AE017355_461623 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.
          Length = 409

 Score = 30.8 bits (68), Expect = 8.6
 Identities = 17/44 (38%), Positives = 23/44 (52%)
 Frame = +3

Query: 159 IEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLT 290
           I+P Q LS S   E     RL+  K+YK G K ++    D +LT
Sbjct: 21  IQPGQTLSISAPLEAVQFVRLVTEKAYKSGAKHVYVDWNDETLT 64



>gb:AE017265_421594 Bacillus cereus ATCC 10987, section 2 of 18 of
           the complete genome.>gb:AE017194_1060013 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 409

 Score = 30.8 bits (68), Expect = 8.6
 Identities = 17/44 (38%), Positives = 23/44 (52%)
 Frame = +3

Query: 159 IEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLT 290
           I+P Q LS S   E     RL+  K+YK G K ++    D +LT
Sbjct: 21  IQPGQTLSISAPLEAVQFVRLVTEKAYKSGAKHVYVDWNDETLT 64



>gb:AE017225_405721 Bacillus anthracis str. Sterne, complete genome.
          Length = 409

 Score = 30.8 bits (68), Expect = 8.6
 Identities = 17/44 (38%), Positives = 23/44 (52%)
 Frame = +3

Query: 159 IEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLT 290
           I+P Q LS S   E     RL+  K+YK G K ++    D +LT
Sbjct: 21  IQPGQTLSISAPLEAVQFVRLVTEKAYKSGAKHVYVDWNDETLT 64



>gb:AE017025_380604 Bacillus anthracis str. Ames section 2 of 18 of
           the complete genome.>gb:AE017334_450453 Bacillus
           anthracis str. 'Ames Ancestor', complete
           genome.>gb:AE016879_1010309 Bacillus anthracis str. Ames
           complete genome.
          Length = 409

 Score = 30.8 bits (68), Expect = 8.6
 Identities = 17/44 (38%), Positives = 23/44 (52%)
 Frame = +3

Query: 159 IEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLT 290
           I+P Q LS S   E     RL+  K+YK G K ++    D +LT
Sbjct: 21  IQPGQTLSISAPLEAVQFVRLVTEKAYKSGAKHVYVDWNDETLT 64



>gb:AE016999_375356 Bacillus cereus ATCC 14579 section 2 of 18 of
           the complete genome.>gb:AE016877_1015606 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 409

 Score = 30.8 bits (68), Expect = 8.6
 Identities = 17/44 (38%), Positives = 23/44 (52%)
 Frame = +3

Query: 159 IEPRQRLSSSTSSEDTNKRRLLRSKSYKEGDKALFSPTKDRSLT 290
           I+P Q LS S   E     RL+  K+YK G K ++    D +LT
Sbjct: 21  IQPGQTLSISAPLEAVQFVRLVTEKAYKSGAKHVYVDWNDETLT 64



>sp|Q9NSA2|KCD1_HUMAN Potassium voltage-gated channel subfamily D
           member 1 (Voltage-gated potassium channel subunit
           Kv4.1).>gb:AF166003_1887273 Homo sapiens voltage-gated
           potassium channel Kv4.1 (KCND1) mRNA, complete
           cds.>gb:AF166004S3_1887274 Homo sapiens voltage-gated
           potassium channel Kv4.1 (KCND1) gene, exon 6; and
           complete cds.>gb:BC045659_1983613 Homo sapiens potassium
           voltage-gated channel, Shal-related subfamily, member 1,
           mRNA (cDNA clone MGC:43677 IMAGE:5271042), complete
           cds.>gb:HSA005898_1999925 Homo sapiens mRNA for
           shal-type potassium channel KCND1 (Kv4.1), complete CDS
           (clone IMAGE 37769, IMAGE 327112 and LLNLc110P1332Q7
           (RZPD Berlin)).
          Length = 647

 Score = 30.8 bits (68), Expect = 8.6
 Identities = 24/104 (23%), Positives = 41/104 (39%)
 Frame = -1

Query: 350 CKQRSQCNNSKDKLQYREFAGQRPIFGGTEECLIPFFVAFTSQKPPFVGILTRCRRR*PL 171
           C +++ C+   D+L + E  G     G T         + +SQ      +L+ C  R   
Sbjct: 484 CLEKTTCHEFTDELTFSEALGAVSPGGRTSRS-----TSVSSQPVGPGSLLSSCCPRRAK 538

Query: 170 SGLNETRGSTTDSTKGSSHIFNLVAARRKWHLSPIQESKKTKPH 39
                   ST   ++GS    +++A  R+ H    + S   KPH
Sbjct: 539 RRAIRLANSTASVSRGSMQELDMLAGLRRSHAPQSRSSLNAKPH 582


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 393,491,989
Number of Sequences: 1806583
Number of extensions: 7257859
Number of successful extensions: 31191
Number of sequences better than 10.0: 23
Number of HSP's better than 10.0 without gapping: 30554
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 31179
length of database: 581,917,975
effective HSP length: 94
effective length of database: 412,099,173
effective search space used: 14423471055
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)