BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig5802
         (688 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AF487527_1804290 Nicotiana plumbaginifolia D1 protease-like p...   131   9e-37   
gb:AP003222_1825521 Oryza sativa (japonica cultivar-group) genom...   103   6e-28   
gb:AB010698_1511230 Arabidopsis thaliana genomic DNA, chromosome...   109   8e-28   
gb:AY062767_1565423 Arabidopsis thaliana carboxy-terminal protei...   109   8e-28   
gb:AF487526_1804289 Triticum aestivum D1 protease-like protein p...    97   1e-26   
gb:HVPEPD1PR_1682490 H.vulgare mRNA for peptidase of D1 protein.       76   4e-20   
pir|T05975|T05975 probable carboxy-terminal proteinase (EC 3.4.2...    76   4e-20   Hordeum vulgare [barley]
gb:BX572097_798118 Prochlorococcus marinus MIT9313 complete geno...    64   2e-09   
pir|S74579|S74579 carboxyl-terminal proteinase ctpB - Synechocys...    59   6e-08   Synechocystis sp. PCC 6803
gb:BX569692_776077 Synechococcus sp. WH8102 complete genome; seg...    57   3e-07   
gb:AE017162_394824 Prochlorococcus marinus subsp. marinus str. C...    57   4e-07   
pir|S77395|S77395 carboxyl-terminal proteinase prc - Synechocyst...    57   4e-07   Synechocystis sp. PCC 6803
gb:BA000045_740194 Gloeobacter violaceus PCC 7421 DNA, complete ...    56   7e-07   
gb:AP008231_580513 Synechococcus elongatus PCC 6301 DNA, complet...    55   1e-06   
gb:BX572091_796303 Prochlorococcus marinus MED4 complete genome;...    52   8e-06   
gb:BA000039_728109 Thermosynechococcus elongatus BP-1 DNA, compl...    52   8e-06   
gb:BA000045_743177 Gloeobacter violaceus PCC 7421 DNA, complete ...    52   1e-05   
pir|AE2233|AE2233 carboxyl-terminal processing proteinase [impor...    52   1e-05   Nostoc sp. PCC 7120
pir|AD2023|AD2023 carboxyl-terminal proteinase [imported] - Nost...    50   4e-05   Nostoc sp. PCC 7120
pir|AE2118|AE2118 carboxyl-terminal proteinase [imported] - Nost...    50   5e-05   Nostoc sp. PCC 7120
gb:AF022823_469973 Nostoc punctiforme carboxyl terminal protease...    49   6e-05   
gb:AE017164_395470 Prochlorococcus marinus subsp. marinus str. C...    49   6e-05   
gb:BA000039_727190 Thermosynechococcus elongatus BP-1 DNA, compl...    49   8e-05   
gb:BA000045_741384 Gloeobacter violaceus PCC 7421 DNA, complete ...    48   2e-04   
gb:BX572100_798992 Prochlorococcus marinus MIT9313 complete geno...    47   2e-04   
pir|T10500|T10500 carboxy-terminal proteinase (EC 3.4.21.-) - gr...    46   7e-04   Tetradesmus obliquus
gb:BX569694_776870 Synechococcus sp. WH8102 complete genome; seg...    45   0.001   
gb:BA000045_740142 Gloeobacter violaceus PCC 7421 DNA, complete ...    45   0.002   
gb:AP008231_581467 Synechococcus elongatus PCC 6301 DNA, complet...    44   0.002   
gb:AP008231_580699 Synechococcus elongatus PCC 6301 DNA, complet...    44   0.002   
sp|Q55669|CTPA_SYNY3|CTPA_SYNY3 Carboxyl-terminal processing protease precu...    44   0.003   Synechocystis sp.
gb:BA000039_727391 Thermosynechococcus elongatus BP-1 DNA, compl...    43   0.006   
gb:SOD1CTPA_1715665 S.oleracea mRNA for D1 protein C-terminal pr...    42   0.013   
pir|S65146|JH0263 carboxy-terminal proteinase (EC 3.4.21.-) D1 p...    42   0.013   
gb:AF487528_1804291 Nicotiana plumbaginifolia D1 protease precur...    40   0.039   
gb:BX572090_795950 Prochlorococcus marinus MED4 complete genome;...    40   0.039   
pir|S26195|S26195 probable carboxyl-terminal processing proteina...    40   0.039   Synechococcus sp.
sp|P42784|YPEB_SYNP2|YPEB_SYNP2 Hypothetical protein in PETB 5'region (Frag...    40   0.039   Synechococcus sp.
gb:ATH132544_1552012 Arabidopsis thaliana mRNA for D1-processing...    37   0.25    
pir|E71447|E71447 probable PSII D1 protein processing enzyme - A...    37   0.25    Arabidopsis thaliana [mouse-ear cress]
gb:AP003507_1830058 Oryza sativa (japonica cultivar-group) genom...    37   0.33    
gb:AF487525_1804288 Triticum aestivum D1 protease precursor (ctp...    37   0.33    
gb:AP003445_1829510 Oryza sativa (japonica cultivar-group) genom...    35   0.95    
gb:BX640445_815491 Bordetella bronchiseptica strain RB50, comple...    35   0.95    
gb:AP003766_1833196 Oryza sativa (japonica cultivar-group) genom...    35   1.2     
gb:BC079078_2107211 Rattus norvegicus cDNA clone MGC:94034 IMAGE...    35   1.6     
gb:AY230412S1_2080120 Rattus norvegicus artemin (Artn) mRNA, par...    35   1.6     
gb:AF184919_2058215 Rattus norvegicus artemin (ARTN) mRNA, parti...    35   1.6     
gb:AF159297_1773221 Zea mays pollen extensin-like protein (Pex2)...    35   1.6     
gb:AY237827_1427623 Canis familiaris SOX9 (Sox9) mRNA, complete ...    35   1.6     
gb:AK015393_1158370 Mus musculus adult male testis cDNA, RIKEN f...    35   1.6     
gb:AE014298_1126108 Drosophila melanogaster chromosome X, comple...    35   1.6     
pir|AB2234|AB2234 hypothetical protein alr3425 [imported] - Nost...    35   1.6     Nostoc sp. PCC 7120
gb:BC089121_2566058 Xenopus laevis cDNA clone IMAGE:6870338, par...    34   2.1     
gb:AK025837_1910410 Homo sapiens cDNA: FLJ22184 fis, clone HRC00...    34   2.8     
gb:AC138001_1743950 Oryza sativa chromosome 3 BAC OSJNBa0093M23 ...    34   2.8     
gb:CR382132_1666188 Yarrowia lipolytica chromosome F of strain C...    34   2.8     
gb:CR382132_1665577 Yarrowia lipolytica chromosome F of strain C...    33   3.6     
gb:AX877487_1477026 Sequence 12392 from Patent EP1074617.>gb:AK0...    33   3.6     
pir|S66569|S66569 biotin carboxyl carrier protein (clone BP6) pr...    33   3.6     Brassica napus [oilseed rape]
gb:AY427651S1_2532270 Danio rerio RGS12TS gene, exon 18 and comp...    33   4.7     
gb:AC096688_1736258 Oryza sativa chromosome 3 BAC OSJNBa0015N08 ...    33   4.7     
gb:BX842597_1643661 Neurospora crassa DNA linkage group II BAC c...    33   4.7     
gb:BX572593_799829 Rhodopseudomonas palustris CGA009 complete ge...    33   4.7     
gb:AB028964_1865820 Homo sapiens mRNA for KIAA1041 protein, part...    33   6.2     
gb:OSJN00135_1695470 Oryza sativa genomic DNA, chromosome 4, BAC...    33   6.2     
gb:AY056397_1563705 Arabidopsis thaliana AT5g46390/MPL12_19 mRNA...    33   6.2     
gb:AB030708_1518533 Triticum aestivum gene for AHM1, complete cds.     33   6.2     
gb:AE017325_443384 Listeria monocytogenes str. 4b F2365, section...    33   6.2     
pir|T09854|T09854 proline-rich cell wall protein - upland cotton...    33   6.2     Gossypium hirsutum [American cotton]
pir|T10737|T10737 extensin-like cell wall protein - sea-island c...    33   6.2     Gossypium barbadense [Egyptian cotton]
pir|T06752|T06752 carboxy-terminal proteinase homolog F15B8.130 ...    33   6.2     Arabidopsis thaliana [mouse-ear cress]
pir|S04713|EDBEIF immediate-early protein IE180 - suid herpesvir...    33   6.2     
sp|Q9UPW0|FXJ3_HUMAN|FXJ3_HUMAN Forkhead box protein J3.                          33   6.2     Homo sapiens [man]
gb:AP005104_1847904 Oryza sativa (japonica cultivar-group) genom...    32   8.0     
gb:BA000045_744301 Gloeobacter violaceus PCC 7421 DNA, complete ...    32   8.0     
gb:BA000035_716930 Corynebacterium efficiens YS-314 DNA, complet...    32   8.0     
gb:AE017313_439514 Desulfovibrio vulgaris subsp. vulgaris str. H...    32   8.0     
pir|T07907|T07907 hydroxyproline-rich glycoprotein GAS28 precurs...    32   8.0     Chlamydomonas reinhardtii
sp|Q92794|MYS3_HUMAN|MYS3_HUMAN MYST histone acetyltransferase 3 (Runt-rela...    32   8.0     Homo sapiens [man]
sp|Q01822|HXD1_MOUSE|HXD1_MOUSE Homeobox protein Hox-D1 (Hox-4.9).>pir|A565...    32   8.0     Mus musculus [mouse]
sp|Q9QY14|FXE3_MOUSE|FXE3_MOUSE Forkhead box protein E3.>gb:AF142647_205617...    32   8.0     Mus musculus [mouse]


>gb:AF487527_1804290 Nicotiana plumbaginifolia D1 protease-like
           protein precursor, mRNA, complete cds.
          Length = 467

 Score =  131 bits (330), Expect(2) = 9e-37
 Identities = 76/152 (50%), Positives = 92/152 (60%)
 Frame = +3

Query: 138 ASLHKASIPQKAFITTGVSVXXXXXXXXXXXXXXXEFSSDRLSAVALVQTNEEQQLDCRE 317
           ASL+ A  P +  ++TG+S+                  S  +             L+C E
Sbjct: 28  ASLNYAQKPLQQALSTGISLVLSLGLLVSAPNSILALESPSV-------LESSNSLNCPE 80

Query: 318 DEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSR 497
           +E E   +    +VVSNE IV E WQIVNDSFLNTS RSWSPE W  KK+DILS+SIQ+R
Sbjct: 81  NEVEEVYSTEVSKVVSNEKIVEEAWQIVNDSFLNTSPRSWSPESWLKKKDDILSSSIQTR 140

Query: 498 PRAHDIIRRMLASLGDPYTRFLSPAECFYSMA 593
            +AHDII+RMLASLGDPYTRFLSP E F  MA
Sbjct: 141 SKAHDIIKRMLASLGDPYTRFLSPEE-FSKMA 171



 Score = 44.7 bits (104), Expect(2) = 9e-37
 Identities = 19/24 (79%), Positives = 22/24 (91%)
 Frame = +2

Query: 617 KFSKMARYDMTGIGINLREVPGDN 688
           +FSKMARYDMTGIG+NLR+VP  N
Sbjct: 166 EFSKMARYDMTGIGVNLRDVPDGN 189



>gb:AP003222_1825521 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0003E08.
          Length = 461

 Score =  103 bits (258), Expect(2) = 6e-28
 Identities = 47/75 (62%), Positives = 62/75 (82%), Gaps = 1/75 (1%)
 Frame = +3

Query: 354 EVVSNEGIVAEVWQIVNDSFL-NTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRML 530
           EVV+NE +V E W++VN+ FL +   R WSPE+W  KK+DI+ TSI+SR RAHDII++ML
Sbjct: 86  EVVTNEQLVEEAWEVVNEGFLPDAGSRPWSPEMWMKKKQDIVQTSIRSRSRAHDIIQKML 145

Query: 531 ASLGDPYTRFLSPAE 575
           A+LGDPYTRFL+P+E
Sbjct: 146 ANLGDPYTRFLTPSE 160



 Score = 42.7 bits (99), Expect(2) = 6e-28
 Identities = 17/24 (70%), Positives = 22/24 (91%)
 Frame = +2

Query: 617 KFSKMARYDMTGIGINLREVPGDN 688
           +FSKM++YDMTGIG+NLRE+P  N
Sbjct: 160 EFSKMSKYDMTGIGLNLREIPDGN 183



>gb:AB010698_1511230 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MPL12.
          Length = 488

 Score =  109 bits (272), Expect(2) = 8e-28
 Identities = 50/93 (53%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = +3

Query: 306 DCREDEQ---ELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDIL 476
           DC  +E+   E+     EP++V+NEGIV E W+IVN +FL+T   SW+PE W+ +K+DIL
Sbjct: 96  DCPNEEEADTEIQDDDIEPQLVTNEGIVEEAWEIVNGAFLDTRSHSWTPETWQKQKDDIL 155

Query: 477 STSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE 575
           ++ I+SR +AH++I+ MLASLGD YTRFLSP E
Sbjct: 156 ASPIKSRSKAHEVIKNMLASLGDQYTRFLSPDE 188



 Score = 37.0 bits (84), Expect(2) = 8e-28
 Identities = 15/20 (75%), Positives = 20/20 (100%)
 Frame = +2

Query: 617 KFSKMARYDMTGIGINLREV 676
           +FS+M++YD+TGIGINLREV
Sbjct: 188 EFSRMSKYDITGIGINLREV 207



>gb:AY062767_1565423 Arabidopsis thaliana carboxy-terminal
           proteinase D1-like protein (At5g46390; MPL12.19) mRNA,
           complete cds.>gb:AY081650_1568910 Arabidopsis thaliana
           carboxy-terminal proteinase D1-like protein (At5g46390)
           mRNA, complete cds.
          Length = 428

 Score =  109 bits (272), Expect(2) = 8e-28
 Identities = 50/93 (53%), Positives = 70/93 (75%), Gaps = 3/93 (3%)
 Frame = +3

Query: 306 DCREDEQ---ELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDIL 476
           DC  +E+   E+     EP++V+NEGIV E W+IVN +FL+T   SW+PE W+ +K+DIL
Sbjct: 96  DCPNEEEADTEIQDDDIEPQLVTNEGIVEEAWEIVNGAFLDTRSHSWTPETWQKQKDDIL 155

Query: 477 STSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE 575
           ++ I+SR +AH++I+ MLASLGD YTRFLSP E
Sbjct: 156 ASPIKSRSKAHEVIKNMLASLGDQYTRFLSPDE 188



 Score = 37.0 bits (84), Expect(2) = 8e-28
 Identities = 15/20 (75%), Positives = 20/20 (100%)
 Frame = +2

Query: 617 KFSKMARYDMTGIGINLREV 676
           +FS+M++YD+TGIGINLREV
Sbjct: 188 EFSRMSKYDITGIGINLREV 207



>gb:AF487526_1804289 Triticum aestivum D1 protease-like protein
           precursor, mRNA, partial cds.
          Length = 400

 Score = 97.4 bits (241), Expect(2) = 1e-26
 Identities = 45/75 (60%), Positives = 58/75 (77%), Gaps = 1/75 (1%)
 Frame = +3

Query: 354 EVVSNEGIVAEVWQIVNDSFL-NTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRML 530
           E V+NE +V E W++VN+ FL +   R WSPE+W  +K+DIL  SI+SR RAHDII +ML
Sbjct: 25  EAVTNEQLVEEAWEVVNEGFLPDAGSRPWSPELWMQRKQDILQGSIKSRSRAHDIITKML 84

Query: 531 ASLGDPYTRFLSPAE 575
           ASLGDPYTRFLS ++
Sbjct: 85  ASLGDPYTRFLSSSD 99



 Score = 45.1 bits (105), Expect(2) = 1e-26
 Identities = 18/23 (78%), Positives = 22/23 (95%)
 Frame = +2

Query: 620 FSKMARYDMTGIGINLREVPGDN 688
           FSKM++YDMTGIG+NLRE+P DN
Sbjct: 100 FSKMSKYDMTGIGLNLREIPDDN 122



>gb:HVPEPD1PR_1682490 H.vulgare mRNA for peptidase of D1 protein.
          Length = 354

 Score = 76.3 bits (186), Expect(2) = 4e-20
 Identities = 34/49 (69%), Positives = 41/49 (83%)
 Frame = +3

Query: 429 RSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE 575
           R WSPE+W  +K+DIL  SI+SR RAHDII +MLASLGDPYTRFLS ++
Sbjct: 4   RPWSPELWMQRKQDILQGSIKSRSRAHDIITKMLASLGDPYTRFLSSSD 52



 Score = 44.3 bits (103), Expect(2) = 4e-20
 Identities = 17/23 (73%), Positives = 22/23 (95%)
 Frame = +2

Query: 620 FSKMARYDMTGIGINLREVPGDN 688
           FSKM++YDMTGIG+N+RE+P DN
Sbjct: 53  FSKMSKYDMTGIGLNIREIPDDN 75



>pir|T05975|T05975 probable carboxy-terminal proteinase (EC
           3.4.21.-) D1 - barley (fragment)
          Length = 354

 Score = 76.3 bits (186), Expect(2) = 4e-20
 Identities = 34/49 (69%), Positives = 41/49 (83%)
 Frame = +3

Query: 429 RSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE 575
           R WSPE+W  +K+DIL  SI+SR RAHDII +MLASLGDPYTRFLS ++
Sbjct: 4   RPWSPELWMQRKQDILQGSIKSRSRAHDIITKMLASLGDPYTRFLSSSD 52



 Score = 44.3 bits (103), Expect(2) = 4e-20
 Identities = 17/23 (73%), Positives = 22/23 (95%)
 Frame = +2

Query: 620 FSKMARYDMTGIGINLREVPGDN 688
           FSKM++YDMTGIG+N+RE+P DN
Sbjct: 53  FSKMSKYDMTGIGLNIREIPDDN 75



>gb:BX572097_798118 Prochlorococcus marinus MIT9313 complete genome;
           segment 3/7.
          Length = 453

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 28/71 (39%), Positives = 50/71 (70%)
 Frame = +3

Query: 363 SNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLG 542
           S + ++ +VWQIV   +L+++ + ++PE+W+  ++D+L+ +  +   +++ IR MLASL 
Sbjct: 50  SPKEVIDQVWQIVYRDYLDSTGK-YNPEVWKGLRKDLLAKNYSATSESYEAIRGMLASLD 108

Query: 543 DPYTRFLSPAE 575
           DPYTRFL P E
Sbjct: 109 DPYTRFLDPKE 119



>pir|S74579|S74579 carboxyl-terminal proteinase ctpB - Synechocystis
           sp.  (strain PCC 6803)>gb:SSPCTPB_190927 Synechocystis
           sp. ctpB gene.>gb:BA000022_687510 Synechocystis sp. PCC
           6803 DNA, complete genome.
          Length = 462

 Score = 59.3 bits (142), Expect = 6e-08
 Identities = 29/71 (40%), Positives = 44/71 (61%)
 Frame = +3

Query: 363 SNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLG 542
           S + +V EVWQ+VN  F++   + ++   W SK++++L  + Q    A+  I R+L  L 
Sbjct: 62  SPKAVVDEVWQLVNQQFVD---KDFNHSNWLSKRQELLGRNYQDNAEAYRQIGRILKDLN 118

Query: 543 DPYTRFLSPAE 575
           DPYTRFLSP E
Sbjct: 119 DPYTRFLSPEE 129



>gb:BX569692_776077 Synechococcus sp. WH8102 complete genome;
           segment 4/7.
          Length = 445

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 29/71 (40%), Positives = 45/71 (63%)
 Frame = +3

Query: 363 SNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLG 542
           S + ++ +VWQIV   +L+ S  ++S   WR  ++D+L+ S      +++ IR ML+SL 
Sbjct: 47  SPKEVIDQVWQIVFRDYLD-STGAYSDARWRQLRKDLLAKSYAGDEESYEAIRGMLSSLD 105

Query: 543 DPYTRFLSPAE 575
           DPYTRFL P E
Sbjct: 106 DPYTRFLDPKE 116



>gb:AE017162_394824 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 2 of 6 of the complete
           genome.>gb:AE017126_1030493 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 459

 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 30/77 (38%), Positives = 42/77 (54%), Gaps = 2/77 (2%)
 Frame = +3

Query: 345 AEPEVVSNEG--IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDII 518
           AEP +  N+G  +V E W IVN+ FLN  +  ++   WR  ++  +   I +   A+  I
Sbjct: 34  AEPLIALNDGQQLVLETWNIVNEGFLNPEK--FNEVQWRRLRQQAIEKPITTSDEAYSAI 91

Query: 519 RRMLASLGDPYTRFLSP 569
             ML  LGDPYTR L P
Sbjct: 92  ETMLLPLGDPYTRLLRP 108



>pir|S77395|S77395 carboxyl-terminal proteinase prc - Synechocystis
           sp. (strain PCC 6803)>gb:BA000022_688277 Synechocystis
           sp. PCC 6803 DNA, complete genome.
          Length = 423

 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 31/77 (40%), Positives = 49/77 (63%)
 Frame = +3

Query: 375 IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT 554
           +V EVWQIVN ++++ +   ++ E W + ++D L+   +++  A+  IR ML  L DPYT
Sbjct: 43  LVDEVWQIVNRTYVDGT---FNGEDWVAVRQDYLTRDYKNQEEAYTAIREMLEKLNDPYT 99

Query: 555 RFLSPAECFYSMAYITT 605
           RF+SP E F SM   T+
Sbjct: 100 RFMSPDE-FQSMRIDTS 115



>gb:BA000045_740194 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 428

 Score = 55.8 bits (133), Expect = 7e-07
 Identities = 32/92 (34%), Positives = 51/92 (55%), Gaps = 10/92 (10%)
 Frame = +3

Query: 330 LSAAPAEPEVV----------SNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILS 479
           ++AAP +P  +          S + IV EVWQ V+  F++ +   ++ + W + +E +L 
Sbjct: 23  VTAAPKQPVKLRAEYEARLEDSPKAIVDEVWQTVDREFVDPT---FNKQNWIAAREQLLG 79

Query: 480 TSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE 575
              +S+  A++ IR  L  LGDPYTRFL P E
Sbjct: 80  RDYKSKEEAYEAIRNSLKVLGDPYTRFLDPRE 111



>gb:AP008231_580513 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 425

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 25/71 (35%), Positives = 46/71 (64%)
 Frame = +3

Query: 363 SNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLG 542
           S + I+ EVWQ+V+ ++++ S  ++    WR  + + L+ + ++R  A+  ++ ML +LG
Sbjct: 39  SPKEIIDEVWQVVDRNYVD-SVGTFDRNKWRQLRREYLARNYKTREEAYSAVKEMLKTLG 97

Query: 543 DPYTRFLSPAE 575
           DPYTRF+ P E
Sbjct: 98  DPYTRFMDPDE 108



>gb:BX572091_796303 Prochlorococcus marinus MED4 complete genome;
           segment 2/5.
          Length = 429

 Score = 52.4 bits (124), Expect = 8e-06
 Identities = 26/67 (38%), Positives = 40/67 (59%)
 Frame = +3

Query: 375 IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT 554
           ++  VWQIV   FL++S + +    W + +++ L+        A+D IR ML++L DPYT
Sbjct: 25  VIDHVWQIVYRDFLDSSGK-FERSNWINLRKEFLAKKYSDNNEAYDAIRDMLSNLDDPYT 83

Query: 555 RFLSPAE 575
           RFL P E
Sbjct: 84  RFLDPKE 90



>gb:BA000039_728109 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 441

 Score = 52.4 bits (124), Expect = 8e-06
 Identities = 26/69 (37%), Positives = 43/69 (62%)
 Frame = +3

Query: 369 EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDP 548
           + +V E WQI+  S+L+   RS++   W++ + ++LS   + R  A+ +I++ L  L DP
Sbjct: 61  KALVDEAWQIIYKSYLD---RSFNRLDWQAIRRELLSQPYRDREAAYRVIQQTLVRLNDP 117

Query: 549 YTRFLSPAE 575
           YTRFL P E
Sbjct: 118 YTRFLPPHE 126



>gb:BA000045_743177 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 445

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 24/67 (35%), Positives = 40/67 (59%)
 Frame = +3

Query: 375 IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYT 554
           I+ EVWQ+VN  +++ +   ++ + W+  +   L+   +SR  A+   R ML  LGDPYT
Sbjct: 39  IIDEVWQVVNREYVDPT---FNNQNWQETRRKYLAKDYKSREDAYKSTREMLKGLGDPYT 95

Query: 555 RFLSPAE 575
           RF+ P +
Sbjct: 96  RFMDPKQ 102



>pir|AE2233|AE2233 carboxyl-terminal processing proteinase
           [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_684409 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 417

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 24/73 (32%), Positives = 44/73 (60%)
 Frame = +3

Query: 357 VVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLAS 536
           +   + +V+EVW+IVN S+L+    +++ + W + ++  L   +     A+  I+ ML +
Sbjct: 33  LTEEQKLVSEVWRIVNRSYLD---ETFNHQNWANVRQKALEKPLTDHKAAYGAIQNMLKT 89

Query: 537 LGDPYTRFLSPAE 575
           LGDP+TRFL P +
Sbjct: 90  LGDPFTRFLDPEQ 102



>pir|AD2023|AD2023 carboxyl-terminal proteinase [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_682727 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 445

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 23/71 (32%), Positives = 42/71 (59%)
 Frame = +3

Query: 363 SNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLG 542
           S + +V +VWQ+VN+ +++     ++ + W + ++ +LS    S+  A+  IR  L  L 
Sbjct: 44  SPKAVVDQVWQLVNNEYVDGK---FNQQDWLAVRKSLLSKDYSSKEEAYVAIREALQRLN 100

Query: 543 DPYTRFLSPAE 575
           DPYTRF+ P +
Sbjct: 101 DPYTRFMDPKQ 111



>pir|AE2118|AE2118 carboxyl-terminal proteinase [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_683489 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 428

 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 25/71 (35%), Positives = 43/71 (60%)
 Frame = +3

Query: 363 SNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLG 542
           S + +V EVWQIV   +++ +   ++   W++ +++ L+ S  ++  A+  IR ML  L 
Sbjct: 38  SPKELVDEVWQIVQRQYVDGT---FNQVDWQAVRKEYLNKSYSNQQEAYKSIREMLKRLN 94

Query: 543 DPYTRFLSPAE 575
           DPYTRF+ P E
Sbjct: 95  DPYTRFMDPQE 105



>gb:AF022823_469973 Nostoc punctiforme carboxyl terminal protease
           (ctpH) gene, complete cds.
          Length = 424

 Score = 49.3 bits (116), Expect = 6e-05
 Identities = 23/71 (32%), Positives = 45/71 (63%)
 Frame = +3

Query: 363 SNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLG 542
           S + +V EVWQI++ ++++++   ++ + W++ ++  LS S  S+  A+  I+ M++ LG
Sbjct: 36  SPQKLVDEVWQILDKNYVDSN---FNHQDWKAIRQQYLSRSYSSKKEAYGAIQEMVSKLG 92

Query: 543 DPYTRFLSPAE 575
           D YT F  P E
Sbjct: 93  DRYTEFYDPQE 103



>gb:AE017164_395470 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 4 of 6 of the complete
           genome.>gb:AE017126_1031139 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 447

 Score = 49.3 bits (116), Expect = 6e-05
 Identities = 24/71 (33%), Positives = 44/71 (61%)
 Frame = +3

Query: 363 SNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLG 542
           S + ++ +VWQI+   +++++ + +  + W   +  +LS    +  +A++ IR ML+SL 
Sbjct: 45  SPKEVMDQVWQIIYRDYMDSTGK-YDQKEWFKVRRKMLSNKYDNYSQAYESIRVMLSSLE 103

Query: 543 DPYTRFLSPAE 575
           DPYTRFL P E
Sbjct: 104 DPYTRFLEPKE 114



>gb:BA000039_727190 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 433

 Score = 48.9 bits (115), Expect = 8e-05
 Identities = 27/81 (33%), Positives = 45/81 (55%)
 Frame = +3

Query: 363 SNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLG 542
           S + +V EVWQ+++  +++ +   ++   WR+ + + LS +      A+   R ML  L 
Sbjct: 39  SPKELVDEVWQVIDREYVDAT---FNGNDWRAVRREFLSRNYTKPEEAYKAAREMLEKLN 95

Query: 543 DPYTRFLSPAECFYSMAYITT 605
           DPYTRF+ P E F SM   T+
Sbjct: 96  DPYTRFMDP-EQFRSMQIETS 115



>gb:BA000045_741384 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 433

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 28/85 (32%), Positives = 44/85 (51%), Gaps = 1/85 (1%)
 Frame = +3

Query: 324 QELSAAPAEPEVV-SNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRP 500
           Q  + AP +  +  S + +V EVWQ V   F + +   ++   W   + ++L     S+ 
Sbjct: 30  QAAAEAPIKSRLADSPKALVDEVWQTVGREFYDPA---FNRIDWLQVRSELLGREYASKD 86

Query: 501 RAHDIIRRMLASLGDPYTRFLSPAE 575
            A+  +R  L  LGDPYTRFL+P E
Sbjct: 87  DAYRAVRTALKKLGDPYTRFLTPRE 111



>gb:BX572100_798992 Prochlorococcus marinus MIT9313 complete genome;
           segment 6/7.
          Length = 446

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 26/77 (33%), Positives = 40/77 (51%), Gaps = 2/77 (2%)
 Frame = +3

Query: 345 AEPEVVSNEG--IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDII 518
           A P +  N+   +V E W++VN  +L+ ++  +    WR  +E  L  +I     A++ I
Sbjct: 33  AAPAMALNDAQQLVVESWRLVNQGYLDPAK--FDEVHWRRLREQALEKTINRSDEAYEAI 90

Query: 519 RRMLASLGDPYTRFLSP 569
             ML  L DPYTR L P
Sbjct: 91  EAMLLPLEDPYTRLLRP 107



>pir|T10500|T10500 carboxy-terminal proteinase (EC 3.4.21.-) - green
           alga  (Scenedesmus obliquus)>gb:SOU85200_1715941
           Scenedesmus obliquus photosystem II D1 protease mRNA,
           complete cds.
          Length = 464

 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 26/81 (32%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = +3

Query: 333 SAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTS-IQSRPRAH 509
           +A PA+  V S + +  E W+ V+ ++++   +S++ + W   +E  L    +  R + +
Sbjct: 71  AALPAQA-VTSEQLLFLEAWRAVDRAYVD---KSFNGQSWFKLRETYLKKEPMDRRAQTY 126

Query: 510 DIIRRMLASLGDPYTRFLSPA 572
           D IR++LA L DP+TRFL P+
Sbjct: 127 DAIRKLLAVLDDPFTRFLEPS 147



>gb:BX569694_776870 Synechococcus sp. WH8102 complete genome;
           segment 6/7.
          Length = 425

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 1/79 (1%)
 Frame = +3

Query: 336 AAPAEPEVVSN-EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHD 512
           A P     +S+ + +V + W++VN  +L+          WR +++  L  SI S   A+ 
Sbjct: 35  AGPCSATALSDTQQLVVDSWRLVNQGYLDPEHLD--SVRWRRQRQKALEKSIVSSEDAYS 92

Query: 513 IIRRMLASLGDPYTRFLSP 569
            I  ML++L DPYTR L P
Sbjct: 93  AIDGMLSALDDPYTRLLRP 111



>gb:BA000045_740142 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 423

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 30/105 (28%), Positives = 54/105 (51%)
 Frame = +3

Query: 309 CREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSI 488
           C  +    +A PA  EV++      E W  +N+ +++     ++ + W S ++  L    
Sbjct: 34  CSAEVLSSTAGPAPKEVLT------ETWTYINNEYVDPK---FNGQDWWSVRQTYLEKPA 84

Query: 489 QSRPRAHDIIRRMLASLGDPYTRFLSPAECFYSMAYITTITSESS 623
           ++  + ++ I  ML +L DPYTRFL+P + F S+   TT + E S
Sbjct: 85  ETSEQVYEQIASMLKTLDDPYTRFLNPKQ-FKSLQ--TTTSGELS 126



>gb:AP008231_581467 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 407

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 22/62 (35%), Positives = 35/62 (56%)
 Frame = +3

Query: 384 EVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYTRFL 563
           E W+IVN S+++ S   ++   W   +E IL   + +R + +  I  +LA L DP+TR L
Sbjct: 37  EAWRIVNQSYVDPS---FNHSNWFQLREKILKKPLDNRDQTYTAIEGLLAKLDDPFTRLL 93

Query: 564 SP 569
            P
Sbjct: 94  RP 95



>gb:AP008231_580699 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 440

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 22/79 (27%), Positives = 46/79 (58%)
 Frame = +3

Query: 339 APAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDII 518
           A A P   S + ++ + WQ+++  +++ +   ++ + W++ + ++LS +  S   A+  +
Sbjct: 32  ARALPWQDSPKVVLDQAWQLIDREYVDPT---FNRQDWQAVRRELLSRNYGSNEEAYAAL 88

Query: 519 RRMLASLGDPYTRFLSPAE 575
           R  L  L DPYTRFL+P +
Sbjct: 89  RSALRRLDDPYTRFLAPEQ 107



>sp|Q55669|CTPA_SYNY3 Carboxyl-terminal processing protease
           precursor (EC 3.4.21.102).>pir|A53964|A53964
           carboxyl-terminal processing proteinase precursor -
           Synechocystis sp. (strain PCC 6803)>gb:SYCCTPA_195441
           Synechocystis sp. protease (ctpA) gene, complete
           cds.>gb:BA000022_689578 Synechocystis sp. PCC 6803 DNA,
           complete genome.
          Length = 427

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 23/92 (25%), Positives = 47/92 (51%)
 Frame = +3

Query: 330 LSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAH 509
           L   P+       + ++ + W++VN S+L+    +++ + W   +E  +   +++R   +
Sbjct: 23  LGNTPSALAFTEEQKLLLQSWRLVNQSYLD---ETFNHQNWWLLREKYVKRPLRNREETY 79

Query: 510 DIIRRMLASLGDPYTRFLSPAECFYSMAYITT 605
             I  MLA+L +P+TR L P +  Y    +TT
Sbjct: 80  TAIEEMLATLDEPFTRLLRPEQ--YGNLQVTT 109



>gb:BA000039_727391 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 412

 Score = 42.7 bits (99), Expect = 0.006
 Identities = 21/64 (32%), Positives = 36/64 (56%)
 Frame = +3

Query: 384 EVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYTRFL 563
           E W+IVN ++++ +   ++ + W   +E  L   +  R   +  I  MLA+L DP+TRFL
Sbjct: 40  EAWRIVNQAYVDPT---FNGQNWWRVREKALKRPLPDREATYAAIEAMLATLEDPFTRFL 96

Query: 564 SPAE 575
            P +
Sbjct: 97  RPEQ 100



>gb:SOD1CTPA_1715665 S.oleracea mRNA for D1 protein C-terminal
           processing protease.
          Length = 539

 Score = 41.6 bits (96), Expect = 0.013
 Identities = 20/66 (30%), Positives = 40/66 (60%), Gaps = 1/66 (1%)
 Frame = +3

Query: 375 IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTS-IQSRPRAHDIIRRMLASLGDPY 551
           I  E W+ ++ ++++   ++++ + W   +E+ L    + SR   +  IR+M+A+L DP+
Sbjct: 157 IFLEAWRTIDRAYVD---KTFNGQSWFRYRENALRNEPMNSREETYTAIRKMVATLNDPF 213

Query: 552 TRFLSP 569
           TRFL P
Sbjct: 214 TRFLEP 219



>pir|S65146|JH0263 carboxy-terminal proteinase (EC 3.4.21.-) D1
           precursor - spinach>gb:SPICTPP_1721856 Spinacia oleracea
           mRNA for C-terminal processing protease for D1 precursor
           protein, complete cds.
          Length = 539

 Score = 41.6 bits (96), Expect = 0.013
 Identities = 20/66 (30%), Positives = 40/66 (60%), Gaps = 1/66 (1%)
 Frame = +3

Query: 375 IVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTS-IQSRPRAHDIIRRMLASLGDPY 551
           I  E W+ ++ ++++   ++++ + W   +E+ L    + SR   +  IR+M+A+L DP+
Sbjct: 157 IFLEAWRTIDRAYVD---KTFNGQSWFRYRENALRNEPMNSREETYTAIRKMVATLNDPF 213

Query: 552 TRFLSP 569
           TRFL P
Sbjct: 214 TRFLEP 219



>gb:AF487528_1804291 Nicotiana plumbaginifolia D1 protease precursor
           (ctpA) mRNA, complete cds.
          Length = 473

 Score = 40.0 bits (92), Expect = 0.039
 Identities = 18/63 (28%), Positives = 39/63 (61%), Gaps = 1/63 (1%)
 Frame = +3

Query: 384 EVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTS-IQSRPRAHDIIRRMLASLGDPYTRF 560
           E W+ ++ ++++   ++++ + W   +ED L    + +R   +  I++M+A+L DP+TRF
Sbjct: 94  EAWRTIDRAYID---KTFNGQSWFRYREDALRKEPMNTRQETYAAIKKMIATLDDPFTRF 150

Query: 561 LSP 569
           L P
Sbjct: 151 LEP 153



>gb:BX572090_795950 Prochlorococcus marinus MED4 complete genome;
           segment 1/5.
          Length = 429

 Score = 40.0 bits (92), Expect = 0.039
 Identities = 20/78 (25%), Positives = 37/78 (47%)
 Frame = +3

Query: 342 PAEPEVVSNEGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIR 521
           P+   +  ++  V + W +VN+ + +  R       W+  ++  L   I++   A+  I 
Sbjct: 31  PSADALSDSKQFVLDAWTLVNEGYYDPERLDELQ--WKRIRQKTLQKQIETSEEAYSAIE 88

Query: 522 RMLASLGDPYTRFLSPAE 575
            ML  L DP+TR L P +
Sbjct: 89  DMLKPLEDPFTRILKPKD 106



>pir|S26195|S26195 probable carboxyl-terminal processing proteinase
           - Synechococcus sp. (PCC 7002) (fragment)
          Length = 411

 Score = 40.0 bits (92), Expect = 0.039
 Identities = 17/69 (24%), Positives = 40/69 (57%)
 Frame = +3

Query: 369 EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDP 548
           + ++ + W+ V+ ++++    +++ + W   ++  L   +++R  A++ +  MLA L DP
Sbjct: 34  QDLLLQAWRYVSQAYVD---ETFNHQNWWLIRQKFLKRPLKTRDEAYEAVGEMLALLDDP 90

Query: 549 YTRFLSPAE 575
           YTR L P +
Sbjct: 91  YTRLLRPEQ 99



>sp|P42784|YPEB_SYNP2 Hypothetical protein in PETB 5'region
           (Fragment).>gb:AQPETBDOP_582475 A.quadruplicatum petBD
           operon.
          Length = 411

 Score = 40.0 bits (92), Expect = 0.039
 Identities = 17/69 (24%), Positives = 40/69 (57%)
 Frame = +3

Query: 369 EGIVAEVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDP 548
           + ++ + W+ V+ ++++    +++ + W   ++  L   +++R  A++ +  MLA L DP
Sbjct: 34  QDLLLQAWRYVSQAYVD---ETFNHQNWWLIRQKFLKRPLKTRDEAYEAVGEMLALLDDP 90

Query: 549 YTRFLSPAE 575
           YTR L P +
Sbjct: 91  YTRLLRPEQ 99



>gb:ATH132544_1552012 Arabidopsis thaliana mRNA for D1-processing
           protease, partial.
          Length = 500

 Score = 37.4 bits (85), Expect = 0.25
 Identities = 17/65 (26%), Positives = 39/65 (60%), Gaps = 1/65 (1%)
 Frame = +3

Query: 384 EVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTS-IQSRPRAHDIIRRMLASLGDPYTRF 560
           E W+ ++ ++++   ++++ + W   +E  L    + +R   +  I++M+A+L DP+TRF
Sbjct: 121 EAWRTIDRAYID---KTFNGQSWFRYRETALRNEPMNTREETYMAIKKMVATLDDPFTRF 177

Query: 561 LSPAE 575
           L P +
Sbjct: 178 LEPGK 182



>pir|E71447|E71447 probable PSII D1 protein processing enzyme -
           Arabidopsis thaliana>gb:ATCHRIV47_1545576 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           47.>gb:ATFCA9_1551824 Arabidopsis thaliana DNA
           chromosome 4, ESSA I FCA contig fragment No.
           9.>gb:AY054171_1562993 Arabidopsis thaliana
           AT4g17740/dl4905c mRNA, complete
           cds.>gb:BT006343_1639230 Arabidopsis thaliana
           At4g17740/dl4905c gene, complete
           cds.>gb:AF424602_1798941 Arabidopsis thaliana
           AT4g17740/dl4905c mRNA, complete cds.
          Length = 515

 Score = 37.4 bits (85), Expect = 0.25
 Identities = 17/65 (26%), Positives = 39/65 (60%), Gaps = 1/65 (1%)
 Frame = +3

Query: 384 EVWQIVNDSFLNTSRRSWSPEIWRSKKEDILSTS-IQSRPRAHDIIRRMLASLGDPYTRF 560
           E W+ ++ ++++   ++++ + W   +E  L    + +R   +  I++M+A+L DP+TRF
Sbjct: 136 EAWRTIDRAYID---KTFNGQSWFRYRETALRNEPMNTREETYMAIKKMVATLDDPFTRF 192

Query: 561 LSPAE 575
           L P +
Sbjct: 193 LEPGK 197



>gb:AP003507_1830058 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0468A12.>gb:AP003543_1830676 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0592B08.
          Length = 468

 Score = 37.0 bits (84), Expect = 0.33
 Identities = 20/76 (26%), Positives = 41/76 (53%), Gaps = 2/76 (2%)
 Frame = +3

Query: 354 EVVSNEGIVAEVWQIVNDSFLNTS--RRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRM 527
           EV   +  + E W ++ ++F++ +   + W   + ++  E      ++S   A+  I  M
Sbjct: 61  EVNRVQRTLVEAWGLIRETFVDPTFNHQDWDMRLQQTMVEMF---PLKSEDAAYGKISGM 117

Query: 528 LASLGDPYTRFLSPAE 575
           L++LGDP+T+ +SP E
Sbjct: 118 LSTLGDPFTKIISPKE 133



>gb:AF487525_1804288 Triticum aestivum D1 protease precursor (ctpA)
           mRNA, partial cds.
          Length = 389

 Score = 37.0 bits (84), Expect = 0.33
 Identities = 21/64 (32%), Positives = 37/64 (57%), Gaps = 2/64 (3%)
 Frame = +3

Query: 384 EVWQIVNDSFLNTS--RRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYTR 557
           E W+ V+ ++ + S   +SW     R+ ++D ++T    R   +  I++MLA+L DP+TR
Sbjct: 11  EAWRAVDRAYYDKSFNGQSWFRYRERALRDDPMNT----RQETYAAIKKMLATLDDPFTR 66

Query: 558 FLSP 569
            L P
Sbjct: 67  LLEP 70



>gb:AP003445_1829510 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OJ1029_F04.
          Length = 245

 Score = 35.4 bits (80), Expect = 0.95
 Identities = 19/46 (41%), Positives = 23/46 (50%)
 Frame = -2

Query: 468 PLSYYAKFQETTSDG*Y*ESYH*QSATPPPQSPHYSPLQAPPAPHS 331
           P+ YY  F+E        E    +   PPP SP YSP Q+PP P S
Sbjct: 6   PVRYYVPFEEADDRSHDLEDE--EPYCPPPLSPPYSPAQSPPPPTS 49



>gb:BX640445_815491 Bordetella bronchiseptica strain RB50, complete
           genome; segment 9/16.
          Length = 820

 Score = 35.4 bits (80), Expect = 0.95
 Identities = 18/41 (43%), Positives = 22/41 (53%), Gaps = 1/41 (2%)
 Frame = -2

Query: 393 ATPPPQSPHYSPLQAPPAPHSAPARL-RGNQAAAPHSSAPE 274
           A  P      +P   PPAP  APA   RG +AA PH+ AP+
Sbjct: 164 AAVPGDDAERAPATPPPAPEHAPAATPRGRRAAMPHTLAPQ 204



>gb:AP003766_1833196 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0009H10.>gb:AP004797_1845234 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0547F09.
          Length = 627

 Score = 35.0 bits (79), Expect = 1.2
 Identities = 14/28 (50%), Positives = 17/28 (60%)
 Frame = -2

Query: 408 YH*QSATPPPQSPHYSPLQAPPAPHSAP 325
           +H Q+  PPPQ PH+ P  A P P  AP
Sbjct: 15  FHPQAPPPPPQYPHHPPPYAAPLPQYAP 42



>gb:BC079078_2107211 Rattus norvegicus cDNA clone MGC:94034
           IMAGE:7122331, complete cds.
          Length = 224

 Score = 34.7 bits (78), Expect = 1.6
 Identities = 17/30 (56%), Positives = 19/30 (63%)
 Frame = -2

Query: 387 PPPQSPHYSPLQAPPAPHSAPARLRGNQAA 298
           PPPQSP  +P    PA  S PA LRG +AA
Sbjct: 81  PPPQSPQPAPPPPGPALQSPPAALRGARAA 110



>gb:AY230412S1_2080120 Rattus norvegicus artemin (Artn) mRNA,
           partial cds, 5' region.
          Length = 157

 Score = 34.7 bits (78), Expect = 1.6
 Identities = 17/30 (56%), Positives = 19/30 (63%)
 Frame = -2

Query: 387 PPPQSPHYSPLQAPPAPHSAPARLRGNQAA 298
           PPPQSP  +P    PA  S PA LRG +AA
Sbjct: 81  PPPQSPQPAPPPPGPALQSPPAALRGARAA 110



>gb:AF184919_2058215 Rattus norvegicus artemin (ARTN) mRNA, partial
           cds.
          Length = 125

 Score = 34.7 bits (78), Expect = 1.6
 Identities = 17/30 (56%), Positives = 19/30 (63%)
 Frame = -2

Query: 387 PPPQSPHYSPLQAPPAPHSAPARLRGNQAA 298
           PPPQSP  +P    PA  S PA LRG +AA
Sbjct: 14  PPPQSPQPAPPPPGPALQSPPAALRGARAA 43



>gb:AF159297_1773221 Zea mays pollen extensin-like protein (Pex2)
           gene, complete cds.
          Length = 1016

 Score = 34.7 bits (78), Expect = 1.6
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 5/45 (11%)
 Frame = -2

Query: 396 SATPPPQSPHYSPLQAP-----PAPHSAPARLRGNQAAAPHSSAP 277
           S + PP+ P  SP QAP     PAP S+P  L+ +    P SS P
Sbjct: 726 SKSSPPEEPVSSPPQAPKSSSPPAPVSSPPPLKSSPPPVPESSPP 770



>gb:AY237827_1427623 Canis familiaris SOX9 (Sox9) mRNA, complete
           cds.
          Length = 513

 Score = 34.7 bits (78), Expect = 1.6
 Identities = 18/43 (41%), Positives = 23/43 (53%)
 Frame = -2

Query: 399 QSATPPPQSPHYSPLQAPPAPHSAPARLRGNQAAAPHSSAPEQ 271
           Q+   PPQ+P  +P QAPP P  AP + +      P SS P Q
Sbjct: 354 QAPPQPPQAPPQAP-QAPPQPQPAPPQPQAAHTLTPLSSEPGQ 395



>gb:AK015393_1158370 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4930445K15
           product:artemin, full insert
           sequence.>gb:AK053914_1170638 Mus musculus 2 days
           pregnant adult female oviduct cDNA, RIKEN full-length
           enriched library, clone:E230001A22 product:artemin, full
           insert sequence.>gb:AX557230_1470468 Sequence 15 from
           Patent WO02072826.>gb:AX663019_1472895 Sequence 3 from
           Patent WO02078730.>gb:AF109402_2054835 Mus musculus
           neurotrophic factor artemin precursor (Artn) mRNA,
           complete cds.
          Length = 224

 Score = 34.7 bits (78), Expect = 1.6
 Identities = 17/30 (56%), Positives = 19/30 (63%)
 Frame = -2

Query: 387 PPPQSPHYSPLQAPPAPHSAPARLRGNQAA 298
           PPPQSP  +P    PA  S PA LRG +AA
Sbjct: 81  PPPQSPQPAPPPPGPALQSPPAALRGARAA 110



>gb:AE014298_1126108 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003504_1213117 Drosophila melanogaster
           chromosome X, section 56 of 74 of the complete
           sequence.>gb:AY128487_1302122 Drosophila melanogaster
           RE73921 full insert cDNA.
          Length = 170

 Score = 34.7 bits (78), Expect = 1.6
 Identities = 20/42 (47%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
 Frame = -2

Query: 399 QSATPPPQSPHYSPLQA-PPAPHSAPARLRGNQAAAPHSSAP 277
           +SA+PPP +   +P+QA  PAP  AP + R   A AP +SAP
Sbjct: 6   RSASPPPSTRRTAPVQARAPAPAPAPVQTR---APAPAASAP 44



>pir|AB2234|AB2234 hypothetical protein alr3425 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_684414 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 388

 Score = 34.7 bits (78), Expect = 1.6
 Identities = 25/110 (22%), Positives = 49/110 (44%)
 Frame = +3

Query: 246 FSSDRLSAVALVQTNEEQQLDCREDEQELSAAPAEPEVVSNEGIVAEVWQIVNDSFLNTS 425
           +S DR  AV  +  ++ + L C  D ++ +  P +PE++   G       + +   L T 
Sbjct: 164 YSRDRACAVNGIDPHKVKMLPCAIDGKKFTPGPKQPELIEKYG-------LSDAKVLMTV 216

Query: 426 RRSWSPEIWRSKKEDILSTSIQSRPRAHDIIRRMLASLGDPYTRFLSPAE 575
            R WS +I+  K  D+   ++    +A   ++ ++   GD   R    A+
Sbjct: 217 ARLWSGDIY--KGVDVTIRALPKIIQAFPEVKYLVIGRGDDQPRLAQLAQ 264



>gb:BC089121_2566058 Xenopus laevis cDNA clone IMAGE:6870338,
           partial cds.
          Length = 484

 Score = 34.3 bits (77), Expect = 2.1
 Identities = 18/38 (47%), Positives = 20/38 (52%)
 Frame = -2

Query: 390 TPPPQSPHYSPLQAPPAPHSAPARLRGNQAAAPHSSAP 277
           +PPP  P      APP P SAP  L     A+PHS AP
Sbjct: 333 SPPPVFPSLPGFPAPPPPPSAPTHL-DYPPASPHSPAP 369



>gb:AK025837_1910410 Homo sapiens cDNA: FLJ22184 fis, clone
           HRC00983.
          Length = 616

 Score = 33.9 bits (76), Expect = 2.8
 Identities = 19/42 (45%), Positives = 24/42 (57%), Gaps = 3/42 (7%)
 Frame = -2

Query: 393 ATPPPQSP---HYSPLQAPPAPHSAPARLRGNQAAAPHSSAP 277
           ATPPPQ+P      PLQAPP+P ++P     +  A P   AP
Sbjct: 107 ATPPPQAPPALALPPLQAPPSPPASPPL---SPLATPSPQAP 145



 Score = 32.7 bits (73), Expect = 6.2
 Identities = 15/27 (55%), Positives = 19/27 (70%), Gaps = 3/27 (11%)
 Frame = -2

Query: 396 SATPPPQSP---HYSPLQAPPAPHSAP 325
           SATPPPQ+P      PLQ PP+P ++P
Sbjct: 211 SATPPPQAPPPLAAPPLQVPPSPPASP 237



 Score = 32.3 bits (72), Expect = 8.0
 Identities = 20/43 (46%), Positives = 23/43 (53%), Gaps = 3/43 (6%)
 Frame = -2

Query: 396 SATPPPQSPHY---SPLQAPPAPHSAPARLRGNQAAAPHSSAP 277
           SATPPP+ P      PLQ PP+P   PA L  +  A P   AP
Sbjct: 242 SATPPPRVPPLLAAPPLQVPPSP---PASLPMSPLAKPPPQAP 281



>gb:AC138001_1743950 Oryza sativa chromosome 3 BAC OSJNBa0093M23
           genomic sequence, complete sequence.
          Length = 844

 Score = 33.9 bits (76), Expect = 2.8
 Identities = 16/36 (44%), Positives = 24/36 (66%)
 Frame = -2

Query: 387 PPPQSPHYSPLQAPPAPHSAPARLRGNQAAAPHSSA 280
           P P +P    ++APPAP+  PA++   QAAAP ++A
Sbjct: 55  PSPGAPSLGGIRAPPAPYQ-PAQVAAPQAAAPFAAA 89



>gb:CR382132_1666188 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 702

 Score = 33.9 bits (76), Expect = 2.8
 Identities = 14/32 (43%), Positives = 19/32 (59%)
 Frame = -2

Query: 387 PPPQSPHYSPLQAPPAPHSAPARLRGNQAAAP 292
           PPP S    P+ APP P   PA+  G+++ AP
Sbjct: 43  PPPASQQQQPMGAPPPPGPPPAQSSGSRSDAP 74



>gb:CR382132_1665577 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 954

 Score = 33.5 bits (75), Expect = 3.6
 Identities = 16/43 (37%), Positives = 23/43 (53%)
 Frame = -2

Query: 399 QSATPPPQSPHYSPLQAPPAPHSAPARLRGNQAAAPHSSAPEQ 271
           Q+A PPPQ+  +   Q PP P   P   +G +A   H+  P+Q
Sbjct: 149 QNAPPPPQNHGHGHYQQPPPPQRGP---QGYRAPPQHAPPPQQ 188



>gb:AX877487_1477026 Sequence 12392 from Patent
           EP1074617.>gb:AK001763_1908638 Homo sapiens cDNA
           FLJ10901 fis, clone NT2RP5003524.
          Length = 663

 Score = 33.5 bits (75), Expect = 3.6
 Identities = 21/61 (34%), Positives = 27/61 (44%)
 Frame = -2

Query: 453 AKFQETTSDG*Y*ESYH*QSATPPPQSPHYSPLQAPPAPHSAPARLRGNQAAAPHSSAPE 274
           A    + SDG   E    Q   PPP+SP      APP+    P  L G Q   P + +PE
Sbjct: 262 ASDDSSLSDGLLLEEEESQVPKPPPESP------APPSRPLPPQTLEGLQPTGPEAGSPE 315

Query: 273 Q 271
           +
Sbjct: 316 R 316



>pir|S66569|S66569 biotin carboxyl carrier protein (clone BP6)
           precursor - rape>gb:BNPBP6_1633615 B.napus mRNA for
           biotin carboxyl carrier protein (pBP6).
          Length = 251

 Score = 33.5 bits (75), Expect = 3.6
 Identities = 23/48 (47%), Positives = 24/48 (50%), Gaps = 4/48 (8%)
 Frame = -2

Query: 408 YH*QSATPP----PQSPHYSPLQAPPAPHSAPARLRGNQAAAPHSSAP 277
           YH     PP    P  P  SP  +PPAP SAPA    N A AP SS P
Sbjct: 132 YHSMMPPPPMEGLPMPP--SPPVSPPAPSSAPA--TANTATAPSSSHP 175



>gb:AY427651S1_2532270 Danio rerio RGS12TS gene, exon 18 and complete
            cds, alternatively spliced.>gb:AY427669_2532271 Danio
            rerio RGS12TS-L mRNA, complete cds, alternatively
            spliced.
          Length = 1540

 Score = 33.1 bits (74), Expect = 4.7
 Identities = 16/34 (47%), Positives = 19/34 (55%)
 Frame = -2

Query: 393  ATPPPQSPHYSPLQAPPAPHSAPARLRGNQAAAP 292
            + PPP  PH      PPAP SAP R+RG    +P
Sbjct: 1422 SAPPPPPPH-----PPPAPPSAPPRVRGAGKRSP 1450



>gb:AC096688_1736258 Oryza sativa chromosome 3 BAC OSJNBa0015N08
           genomic sequence, complete sequence.
          Length = 219

 Score = 33.1 bits (74), Expect = 4.7
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 3/39 (7%)
 Frame = -2

Query: 387 PPPQSPHYSPLQAPPAPHSA---PARLRGNQAAAPHSSA 280
           PP  SP  +P  +PP PHSA   P+ +  + A+AP  SA
Sbjct: 76  PPETSPLPAPSHSPPVPHSAAPEPSPMEHSAASAPAPSA 114



>gb:BX842597_1643661 Neurospora crassa DNA linkage group II BAC
           clone B22K18.
          Length = 1395

 Score = 33.1 bits (74), Expect = 4.7
 Identities = 18/40 (45%), Positives = 22/40 (55%), Gaps = 3/40 (7%)
 Frame = -2

Query: 384 PPQSPH--YSPLQAPPAPHSAPARLRGNQAAAPH-SSAPE 274
           PPQ+PH    P Q PP  H  P   + +QA  PH S AP+
Sbjct: 748 PPQAPHPPQVPHQHPPQAHQVPQVPQASQAPQPHVSRAPQ 787



>gb:BX572593_799829 Rhodopseudomonas palustris CGA009 complete
           genome; segment 1/16.
          Length = 689

 Score = 33.1 bits (74), Expect = 4.7
 Identities = 15/41 (36%), Positives = 21/41 (51%)
 Frame = -2

Query: 393 ATPPPQSPHYSPLQAPPAPHSAPARLRGNQAAAPHSSAPEQ 271
           A PPP  P       PP PH+AP      + +AP ++AP +
Sbjct: 115 AEPPPPPPPSHSAPPPPPPHAAPPPPPAPKPSAPPTAAPAE 155



>gb:AB028964_1865820 Homo sapiens mRNA for KIAA1041 protein, partial
           cds.
          Length = 642

 Score = 32.7 bits (73), Expect = 6.2
 Identities = 15/43 (34%), Positives = 20/43 (46%)
 Frame = -2

Query: 405 H*QSATPPPQSPHYSPLQAPPAPHSAPARLRGNQAAAPHSSAP 277
           H Q +  PP  PH  P     +PH AP   + +Q  +PH   P
Sbjct: 396 HPQPSPHPPHRPHGLPQHPQRSPHPAPHPQQHSQLQSPHPQHP 438



>gb:OSJN00135_1695470 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0033H08, complete sequence.
          Length = 637

 Score = 32.7 bits (73), Expect = 6.2
 Identities = 15/40 (37%), Positives = 22/40 (55%)
 Frame = -2

Query: 399 QSATPPPQSPHYSPLQAPPAPHSAPARLRGNQAAAPHSSA 280
           + A PP ++P   P  +P APH AP     +  AAP ++A
Sbjct: 360 EPAKPPARAPATRPAASPAAPHVAPIAAVASAPAAPAAAA 399



>gb:AY056397_1563705 Arabidopsis thaliana AT5g46390/MPL12_19 mRNA,
           complete cds.
          Length = 214

 Score = 32.7 bits (73), Expect = 6.2
 Identities = 13/17 (76%), Positives = 17/17 (100%)
 Frame = +2

Query: 626 KMARYDMTGIGINLREV 676
           +M++YD+TGIGINLREV
Sbjct: 2   RMSKYDITGIGINLREV 18



>gb:AB030708_1518533 Triticum aestivum gene for AHM1, complete cds.
          Length = 542

 Score = 32.7 bits (73), Expect = 6.2
 Identities = 15/25 (60%), Positives = 17/25 (68%)
 Frame = -2

Query: 399 QSATPPPQSPHYSPLQAPPAPHSAP 325
           Q+AT PP SP  SPLQA   P S+P
Sbjct: 264 QAATKPPPSPQPSPLQAATKPPSSP 288



>gb:AE017325_443384 Listeria monocytogenes str. 4b F2365, section 4
           of 10 of the complete genome.>gb:AE017262_1075740
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 685

 Score = 32.7 bits (73), Expect = 6.2
 Identities = 20/74 (27%), Positives = 36/74 (48%)
 Frame = +1

Query: 412 FSILAVARGLLKFGVVRKRTS*VHQFSQDQELMISLGGCWPAWVILIHGFFLLQSVFIPW 591
           F  LA+   L  F V R     ++Q +  Q+ ++     W AW+I + GFF +   F  +
Sbjct: 362 FLPLAIIGMLAIFLVYRNENKRIYQLTSRQKEIVF----WAAWLIPVAGFFSIAGFFHHY 417

Query: 592 HILLPSPLKVLQDG 633
           ++++ +P   L  G
Sbjct: 418 YLIMLAPPIALLSG 431



>pir|T09854|T09854 proline-rich cell wall protein - upland
           cotton>gb:COTCWPPR_1648383 Gossypium hirsutum
           proline-rich cell wall protein mRNA, complete cds.
          Length = 214

 Score = 32.7 bits (73), Expect = 6.2
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%)
 Frame = -2

Query: 393 ATPPPQSPHYSPLQAPPA--PHSAPARLRGNQAAAPHSSAP 277
           ATPPP +P  +PL +PPA  P  +P +       AP + AP
Sbjct: 131 ATPPPATPPPAPLASPPATVPAISPVQTPLTSPPAPPTEAP 171



>pir|T10737|T10737 extensin-like cell wall protein - sea-island
           cotton>gb:GBU04267_1679722 Gossypium barbadense Sea
           Island proline-rich cell wall protein gene complete cds.
          Length = 214

 Score = 32.7 bits (73), Expect = 6.2
 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%)
 Frame = -2

Query: 393 ATPPPQSPHYSPLQAPPA--PHSAPARLRGNQAAAPHSSAP 277
           ATPPP +P  +PL +PPA  P  +P +       AP + AP
Sbjct: 131 ATPPPATPPPAPLASPPATVPAISPVQTPLTSPPAPPTEAP 171



>pir|T06752|T06752 carboxy-terminal proteinase homolog F15B8.130 -
           Arabidopsis thaliana>gb:ATF15B8_1548676 Arabidopsis
           thaliana DNA chromosome 3, BAC clone F15B8.
          Length = 519

 Score = 32.7 bits (73), Expect = 6.2
 Identities = 14/45 (31%), Positives = 28/45 (62%), Gaps = 5/45 (11%)
 Frame = +3

Query: 456 SKKEDILSTSIQSRP-----RAHDIIRRMLASLGDPYTRFLSPAE 575
           S+  +++ T ++  P      A+  ++ ML++LGDP+TR ++P E
Sbjct: 109 SRAREVIETMVEMFPLRSADAAYGKLKAMLSTLGDPFTRLITPKE 153



>pir|S04713|EDBEIF immediate-early protein IE180 - suid herpesvirus
           1 (strain Indiana-Funkhauser)
          Length = 1460

 Score = 32.7 bits (73), Expect = 6.2
 Identities = 15/27 (55%), Positives = 16/27 (59%)
 Frame = -2

Query: 393 ATPPPQSPHYSPLQAPPAPHSAPARLR 313
           A PPPQ P   P  APPAP + PA  R
Sbjct: 167 ARPPPQPPRPPPPPAPPAPPAPPAPRR 193



>sp|Q9UPW0|FXJ3_HUMAN Forkhead box protein J3.
          Length = 622

 Score = 32.7 bits (73), Expect = 6.2
 Identities = 15/43 (34%), Positives = 20/43 (46%)
 Frame = -2

Query: 405 H*QSATPPPQSPHYSPLQAPPAPHSAPARLRGNQAAAPHSSAP 277
           H Q +  PP  PH  P     +PH AP   + +Q  +PH   P
Sbjct: 376 HPQPSPHPPHRPHGLPQHPQRSPHPAPHPQQHSQLQSPHPQHP 418



>gb:AP005104_1847904 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OSJNBa0042E08.>gb:AP005189_1849096 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0474B11.
          Length = 222

 Score = 32.3 bits (72), Expect = 8.0
 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 6/43 (13%)
 Frame = -2

Query: 396 SATPPPQS-PHYSPLQAPP-----APHSAPARLRGNQAAAPHS 286
           ++TPP  S P Y   + PP     +PH +PAR R     APHS
Sbjct: 101 ASTPPSSSFPAYIRRRPPPIPSSSSPHPSPARARRRTTTAPHS 143



>gb:BA000045_744301 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 3029

 Score = 32.3 bits (72), Expect = 8.0
 Identities = 22/45 (48%), Positives = 27/45 (60%), Gaps = 4/45 (8%)
 Frame = -2

Query: 399  QSATPPPQSPHY--SPLQAP--PAPHSAPARLRGNQAAAPHSSAP 277
            Q ATPPP +P    +P+QA   PAP SAPA    + AA   +SAP
Sbjct: 1655 QPATPPPPAPAKPAAPVQAATTPAPPSAPAITVVSHAANGTASAP 1699



>gb:BA000035_716930 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 271

 Score = 32.3 bits (72), Expect = 8.0
 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 2/43 (4%)
 Frame = -2

Query: 399 QSATPPPQSPHYS--PLQAPPAPHSAPARLRGNQAAAPHSSAP 277
           Q  + PPQ   Y   P Q PP PHS      G   A PH   P
Sbjct: 100 QQPSVPPQQYRYGHPPAQQPPHPHSPHGIPMGGHLAQPHQFTP 142



>gb:AE017313_439514 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 5 of 12 of the complete
           genome.>gb:AE017285_1072675 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 267

 Score = 32.3 bits (72), Expect = 8.0
 Identities = 24/84 (28%), Positives = 36/84 (42%), Gaps = 1/84 (1%)
 Frame = +1

Query: 367 MRGLWRRCGRLSMIAFSILAVARGLLKFGVVRKRTS*VHQFSQDQELMISLGGCWPAWVI 546
           +RG  R CG    + + ++ +A GLL F                  LM   G  WP  V 
Sbjct: 65  LRGKCRHCGSHISVRYPVVELASGLLAF-----------------LLMHRYGLTWPFAVY 107

Query: 547 LIHGFFLLQSVFIPWHI-LLPSPL 615
            + G  LL + FI + + +LP P+
Sbjct: 108 YVFGSALLVASFIDFELFILPDPI 131



>pir|T07907|T07907 hydroxyproline-rich glycoprotein GAS28 precursor
           - Chlamydomonas reinhardtii>gb:AF015883_1761474
           Chlamydomonas reinhardtii hydroxyproline-rich
           glycoprotein gas28p precursor (GAS28) mRNA, complete
           cds.
          Length = 446

 Score = 32.3 bits (72), Expect = 8.0
 Identities = 15/32 (46%), Positives = 18/32 (56%)
 Frame = -2

Query: 387 PPPQSPHYSPLQAPPAPHSAPARLRGNQAAAP 292
           PPP +P   P + PPA   APAR R    A+P
Sbjct: 247 PPPPTPSPPPPELPPAQPDAPARKRPPPPASP 278



>sp|Q92794|MYS3_HUMAN MYST histone acetyltransferase 3 (Runt-related
            transcription factor binding protein 2) (Monocytic
            leukemia zinc finger protein) (Zinc finger protein
            220).>gb:HSU47742_2024493 Human monocytic leukaemia zinc
            finger protein (MOZ) mRNA, complete cds.
          Length = 2004

 Score = 32.3 bits (72), Expect = 8.0
 Identities = 15/41 (36%), Positives = 17/41 (41%)
 Frame = -2

Query: 399  QSATPPPQSPHYSPLQAPPAPHSAPARLRGNQAAAPHSSAP 277
            Q   PPPQ P   P Q  PAP   P + +  Q   P    P
Sbjct: 1650 QPPPPPPQQPQPPPPQPQPAPQPPPPQQQPQQQPQPQPQQP 1690



>sp|Q01822|HXD1_MOUSE Homeobox protein Hox-D1
           (Hox-4.9).>pir|A56553|A56553 homeotic protein Hox 4.9 -
           mouse>gb:MMHOX49R_2115373 M.musculus mRNA for Hox-4.9
           gene.
          Length = 327

 Score = 32.3 bits (72), Expect = 8.0
 Identities = 17/37 (45%), Positives = 20/37 (54%), Gaps = 2/37 (5%)
 Frame = -2

Query: 384 PPQSPHYSPLQAPPAPHSAPARLRG--NQAAAPHSSA 280
           PP  P  SP+  P AP  AP  L G   + AAP S+A
Sbjct: 67  PPAGPAQSPVPQPAAPRYAPCTLEGAYERGAAPASAA 103



>sp|Q9QY14|FXE3_MOUSE Forkhead box protein E3.>gb:AF142647_2056171
           Mus musculus forkhead transcription factor FOXE3 (FoxE3)
           gene, complete cds.
          Length = 288

 Score = 32.3 bits (72), Expect = 8.0
 Identities = 21/48 (43%), Positives = 22/48 (45%), Gaps = 8/48 (16%)
 Frame = -2

Query: 393 ATPPPQSPH-YSPLQAPPAPHSAPA-------RLRGNQAAAPHSSAPE 274
           A PPP  P  Y+P   PPAP SAP         L G Q   P   APE
Sbjct: 167 APPPPPPPFPYAPFPPPPAPASAPPARLFRLDSLLGLQPEPPGPVAPE 214


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 625,065,666
Number of Sequences: 1806583
Number of extensions: 11631136
Number of successful extensions: 58922
Number of sequences better than 10.0: 82
Number of HSP's better than 10.0 without gapping: 45504
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 56514
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 39433825620
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)