BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig5774
         (577 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AP004120_1837886 Oryza sativa (japonica cultivar-group) genom...   185   4e-46   
gb:AY453395_1606939 Glycine max ribosomal protein L37 (RPL37) mR...   184   9e-46   
gb:AP004752_1844400 Oryza sativa (japonica cultivar-group) genom...   183   1e-45   
gb:AY084836_1569919 Arabidopsis thaliana clone 11912 mRNA, compl...   182   3e-45   
gb:AY085343_1570415 Arabidopsis thaliana clone 14710 mRNA, compl...   180   2e-44   
sp|Q43292|RL37_ARATH|RL37_ARATH 60S ribosomal protein L37.>pir|B96563|B9656...   179   4e-44   Arabidopsis thaliana [mouse-ear cress]
gb:AY552059_1335067 Aedes aegypti 60S ribosomal protein L37 mRNA...   141   8e-33   
sp|Q9VXX8|R37A_DROME|R37A_DROME Probable 60S ribosomal protein L37-A.>gb:AE...   140   2e-32   Drosophila melanogaster
gb:AY231733_1177026 Drosophila yakuba clone yak-em_CG9091 mRNA s...   139   2e-32   
gb:AY769308_1350459 Bombyx mori ribosomal protein L37 (RpL37) mR...   137   1e-31   
gb:BC073638_2557462 Xenopus laevis MGC82973 protein, mRNA (cDNA ...   136   2e-31   
gb:AF400199_1268298 Spodoptera frugiperda ribosomal protein L37 ...   135   5e-31   
gb:AF401593_2492020 Ictalurus punctatus ribosomal protein L37 mR...   135   6e-31   
gb:AF486842_1276110 Aplysia californica 60S ribosomal protein L3...   135   6e-31   
gb:AY674227_1179825 Ixodes pacificus clone IP_7_60_92_114_CLU 60...   135   6e-31   
gb:AY181248_1587578 Kluyveromyces delphensis putative mating-typ...   134   8e-31   
gb:AB180422_1202440 Plutella xylostella mRNA for Ribosomal prote...   134   8e-31   
pir|JN0478|R6RT37 ribosomal protein L37, cytosolic [validated] -...   134   8e-31   
sp|Q962S7|RL37_SPOFR|RL37_SPOFR 60S ribosomal protein L37.                       134   1e-30   Spodoptera frugiperda
sp|Q90YT1|RL37_ICTPU|RL37_ICTPU 60S ribosomal protein L37.                       134   1e-30   Ictalurus punctatus
gb:AE016819_1749524 Ashbya gossypii (= Eremothecium gossypii) AT...   133   2e-30   
sp|P61927|RL37_HUMAN|RL37_HUMAN 60S ribosomal protein L37 (G1.16).>sp|Q9D82...   133   2e-30   Homo sapiens [man]
gb:AY190733_2518051 Pagrus major ribosomal protein L37 mRNA, com...   132   3e-30   
gb:S79979_2041886 Homo sapiens ribosomal protein L37 gene, compl...   132   4e-30   
gb:AK008563_1154651 Mus musculus adult male small intestine cDNA...   132   4e-30   
pir|S51430|S51430 ribosomal protein L37.e.A, cytosolic - yeast (...   131   9e-30   Saccharomyces cerevisiae [brewer's yeast]
gb:AY181247_1587567 Candida glabrata putative mating-type locus,...   130   2e-29   
gb:S79980_1444508 ribosomal protein L37 [cattle, BT cells, mRNA ...   129   3e-29   
sp|P49166|R37A_YEAST|R37A_YEAST 60S ribosomal protein L37-A (L35) (YP55).        129   3e-29   Saccharomyces cerevisiae [brewer's yeast]
gb:CR382123_1655542 Kluyveromyces lactis strain NRRL Y-1140 chro...   128   6e-29   
pir|S69558|S69558 ribosomal protein L37.e.B, cytosolic - yeast (...   128   6e-29   Saccharomyces cerevisiae [brewer's yeast]
sp|P79244|RL37_BOVIN|RL37_BOVIN 60S ribosomal protein L37 (Fragment).            128   6e-29   Bos taurus [bovine]
gb:AE017343_1755306 Cryptococcus neoformans var. neoformans JEC2...   127   1e-28   
gb:A63907_1450134 Sequence 32 from Patent WO9723633.                  127   1e-28   
sp|Q9C0T1|RL37_EMENI|RL37_EMENI 60S ribosomal protein L37.>gb:AF277381_1782...   127   1e-28   
pir|S44313|S44313 ribosomal protein L37, cytosolic - tomato (fra...   127   1e-28   Solanum lycopersicum
sp|P49212|RL37_LYCES|RL37_LYCES 60S ribosomal protein L37 (Fragment).>gb:LE...   127   1e-28   Solanum lycopersicum
sp|P51402|R37B_YEAST|R37B_YEAST 60S ribosomal protein L37-B (L35) (YP55).        126   2e-28   Saccharomyces cerevisiae [brewer's yeast]
gb:AY829769_1180168 Lonomia obliqua ribosomal protein 12 mRNA, c...   125   4e-28   
gb:AF035770_1234849 Schistosoma mansoni ribosomal protein L37 mR...   124   8e-28   
sp|O44125|RL37_SCHMA|RL37_SCHMA 60S ribosomal protein L37.                       123   2e-27   Schistosoma mansoni
pir|T40865|T40865 60s ribosomal protein L37 - fission yeast  (Sc...   122   4e-27   Schizosaccharomyces pombe
pir|T26055|T26055 ribosomal protein L37 W01D2.1 [similarity] - C...   122   5e-27   Caenorhabditis elegans [roundworm]
pir|T43306|T43306 ribosomal protein L37 [similarity] - fission y...   121   9e-27   Schizosaccharomyces pombe
sp|Q9P836|RL37_CANAL|RL37_CANAL 60S ribosomal protein L37 (Fragment).>gb:CA...   121   9e-27   Candida albicans
sp|P05733|R37B_SCHPO|R37B_SCHPO 60S ribosomal protein L37-B (L37-2) (YL27).      121   9e-27   Schizosaccharomyces pombe
gb:CR382137_1670146 Debaryomyces hansenii chromosome E of strain...   120   2e-26   
sp|Q9W1U6|R37B_DROME|R37B_DROME Probable 60S ribosomal protein L37-B.>gb:AE...   120   2e-26   Drosophila melanogaster
sp|P59289|R37A_SCHPO|R37A_SCHPO 60S ribosomal protein L37-A (L37-1).             120   2e-26   Schizosaccharomyces pombe
gb:BC067790_1987486 Homo sapiens cDNA clone IMAGE:5310673, parti...   116   2e-25   
sp|P49622|RL37_CAEEL|RL37_CAEEL 60S ribosomal protein L37.>pir|T20195|T2019...   112   4e-24   Caenorhabditis elegans [roundworm]
gb:CR382131_1663513 Yarrowia lipolytica chromosome E of strain C...   112   5e-24   
gb:AC005801_1203280 Leishmania major strain Friedlin chromosome ...   107   1e-22   
sp|P39094|RL37_LEIIN|RL37_LEIIN 60S ribosomal protein L37.                       106   2e-22   Leishmania infantum
gb:BX842630_1643968 Neurospora crassa DNA linkage group I BAC co...   103   2e-21   
gb:SPU97370_1722280 Schizosaccharomyces pombe 60S ribosomal prot...    94   1e-18   
gb:AP003886_1834842 Oryza sativa (japonica cultivar-group) genom...    88   8e-17   
gb:CNS07EGE_1373733 chromosome VII of strain GB-M1 of Encephalit...    82   6e-15   
sp|Q8TYS1|RL37_METKA|RL37_METKA 50S ribosomal protein L37e.>gb:AE010320_261...    69   5e-11   Methanopyrus kandleri
sp|P54011|RL37_METJA|RL37_METJA 50S ribosomal protein L37e.>pir|B64312|B643...    69   7e-11   Methanocaldococcus jannaschii
sp|Q9YEQ4|RL37_AERPE|RL37_AERPE 50S ribosomal protein L37e.>pir|H72749|H727...    62   8e-09   Aeropyrum pernix
sp|O26744|RL37_METTH|RL37_METTH 50S ribosomal protein L37e.>pir|B69186|B691...    60   2e-08   Methanothermobacter thermautotrophicus
sp|Q8U0P5|RL37_PYRFU|RL37_PYRFU 50S ribosomal protein L37e.>gb:AE010255_261...    60   3e-08   Pyrococcus furiosus
gb:AP006878_576127 Thermococcus kodakaraensis strain KOD1 DNA, c...    58   9e-08   
sp|Q975S6|RL37_SULTO|RL37_SULTO 50S ribosomal protein L37e.>gb:BA000023_690...    58   1e-07   Sulfurisphaera tokodaii
sp|P62004|RL37_PYRAB|RL37_PYRAB 50S ribosomal protein L37e.>sp|P62005|RL37_...    58   1e-07   Pyrococcus abyssi
sp|Q97BU6|RL37_THEVO|RL37_THEVO 50S ribosomal protein L37e.>gb:BA000011_664...    57   2e-07   Thermoplasma volcanium
sp|Q9HIT7|RL37_THEAC|RL37_THEAC 50S ribosomal protein L37e.>gb:TACID5_19699...    57   2e-07   Thermoplasma acidophilum
sp|Q8TL48|RL37_METAC|RL37_METAC 50S ribosomal protein L37e.>gb:AE011023_268...    57   3e-07   Methanosarcina acetivorans
sp|P32410|RL37_HALMA|RL37_HALMA 50S ribosomal protein L37e (L35e).>pir|S337...    56   4e-07   Haloarcula marismortui
sp|Q9HPS3|RL37_HALN1|RL37_HALN1 50S ribosomal protein L37e.>pir|F84303|F843...    55   8e-07   Halobacterium sp.
sp|Q8PZZ8|RL37_METMA|RL37_METMA 50S ribosomal protein L37e.>gb:AE013259_290...    54   1e-06   Methanosarcina mazei
sp|O29387|RL37_ARCFU|RL37_ARCFU 50S ribosomal protein L37e.>pir|B69359|B693...    54   1e-06   Archaeoglobus fulgidus
gb:BX957222_844400 Methanococcus maripaludis S2 complete genome;...    54   2e-06   
sp|Q97ZQ1|RL37_SULSO|RL37_SULSO 50S ribosomal protein L37e.>pir|E90224|E902...    52   7e-06   Saccharolobus solfataricus
gb:AB007183_1863948 Homo sapiens gene for ribosomal protein L37,...    44   0.002   
gb:AB012247_1511820 Arabidopsis thaliana genomic DNA, chromosome...    42   0.007   
gb:AY463611_1607700 Arabidopsis thaliana mutant TFIIF-alpha (TFI...    34   1.9     
pir|D85135|D85135 hypothetical protein AT4g12610 [imported] - Ar...    34   1.9     Arabidopsis thaliana [mouse-ear cress]
pir|S10052|S10052 ribosomal protein L37.e - fission yeast (Schiz...    34   1.9     Schizosaccharomyces pombe
sp|Q9F495|OPGH_ERWCH|OPGH_ERWCH Glucans biosynthesis glucosyltransferase H ...    34   1.9     Dickeya chrysanthemi
gb:AF254792_2482686 Danio rerio Period3 circadian clock protein ...    33   2.5     
gb:ATAC011623_1543314 Arabidopsis thaliana chromosome III BAC F2...    32   5.5     
pir|A84512|A84512 hypothetical protein At2g13920 [imported] - Ar...    32   5.5     Arabidopsis thaliana [mouse-ear cress]
gb:CR382134_1667453 Debaryomyces hansenii chromosome B of strain...    32   7.2     
gb:AB020711_1865309 Homo sapiens mRNA for KIAA0904 protein, part...    32   9.4     
pir|S67050|S67050 probable membrane protein YOR162c - yeast (Sac...    32   9.4     Saccharomyces cerevisiae [brewer's yeast]
sp|Q9NYV4|CRK7_HUMAN|CRK7_HUMAN Cell division cycle 2-related protein kinas...    32   9.4     Homo sapiens [man]


>gb:AP004120_1837886 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1293_E04.
          Length = 95

 Score =  185 bits (470), Expect = 4e-46
 Identities = 85/95 (89%), Positives = 92/95 (96%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKS CS+C YPAARIRKYNWSVKAIRRKTTG
Sbjct: 1   MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPRKKGAAAAS 337
           TGRMRYLR+VP+RFK+NFREGTEA PRKKGAAA++
Sbjct: 61  TGRMRYLRHVPKRFKSNFREGTEAAPRKKGAAASN 95



>gb:AY453395_1606939 Glycine max ribosomal protein L37 (RPL37) mRNA,
           complete cds.
          Length = 95

 Score =  184 bits (467), Expect = 9e-46
 Identities = 84/95 (88%), Positives = 92/95 (96%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKSRC+ACA+PAAR RKYNWSVKAIRRKTTG
Sbjct: 1   MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSRCAACAFPAARTRKYNWSVKAIRRKTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPRKKGAAAAS 337
           TGRMRYLRNVPRRFK+ FR+GTEA PRK+GAAA++
Sbjct: 61  TGRMRYLRNVPRRFKSGFRDGTEAAPRKRGAAAST 95



>gb:AP004752_1844400 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0501G04.
          Length = 94

 Score =  183 bits (465), Expect = 1e-45
 Identities = 84/93 (90%), Positives = 90/93 (96%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           MGKGTGSFGKRRNKTHTLCVRCGRRSFH+QKS CS+C YPAARIRKYNWSVKAIRRKTTG
Sbjct: 1   MGKGTGSFGKRRNKTHTLCVRCGRRSFHLQKSTCSSCGYPAARIRKYNWSVKAIRRKTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPRKKGAAA 331
           TGRMRY+R+VPRRFK+NFREGTEATPRK+ AAA
Sbjct: 61  TGRMRYMRHVPRRFKSNFREGTEATPRKRAAAA 93



>gb:AY084836_1569919 Arabidopsis thaliana clone 11912 mRNA, complete
           sequence.>gb:BT004963_1637909 Arabidopsis thaliana clone
           U51079 putative 60s ribosomal protein L37 (At1g15250)
           mRNA, complete cds.>gb:AK118761_1816723 Arabidopsis
           thaliana At1g15250 mRNA for putative 60s ribosomal
           protein L37, complete cds, clone: RAFL21-10-H10.
          Length = 95

 Score =  182 bits (462), Expect = 3e-45
 Identities = 86/95 (90%), Positives = 90/95 (94%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           MGKGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR R YNWSVKAIRRKTTG
Sbjct: 1   MGKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPRKKGAAAAS 337
           TGRMRYLRNVPRRFKT FREGT+ATPR K AA++S
Sbjct: 61  TGRMRYLRNVPRRFKTCFREGTQATPRNKAAASSS 95



>gb:AY085343_1570415 Arabidopsis thaliana clone 14710 mRNA, complete
           sequence.
          Length = 95

 Score =  180 bits (456), Expect = 2e-44
 Identities = 84/95 (88%), Positives = 89/95 (93%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           MGKGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR R YNWSVKAIRRKTTG
Sbjct: 1   MGKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPRKKGAAAAS 337
           TGRMRYLRNVPRRFKT FREGTEA PR K +A+++
Sbjct: 61  TGRMRYLRNVPRRFKTGFREGTEAKPRSKASASSA 95



>sp|Q43292|RL37_ARATH 60S ribosomal protein L37.>pir|B96563|B96563
           hypothetical protein F19K6.12 [imported] - Arabidopsis
           thaliana>gb:AE005173_893142 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC037424_1540008 Arabidopsis thaliana
           chromosome 1 BAC F19K6 genomic sequence, complete
           sequence.>gb:AY113921_1578332 Arabidopsis thaliana
           putative 60S ribosomal protein L37 (At1g52300) mRNA,
           complete cds.>gb:AF370216_1792103 Arabidopsis thaliana
           putative 60S ribosomal protein L37 (At1g52300) mRNA,
           complete cds.
          Length = 95

 Score =  179 bits (453), Expect = 4e-44
 Identities = 84/95 (88%), Positives = 88/95 (92%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGTGSFGKRRNK+HTLCVRCGRRSFHIQKSRCSACAYPAAR R YNWSVKAIRRKTTG
Sbjct: 1   MTKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPRKKGAAAAS 337
           TGRMRYLRNVPRRFKT FREGTEA PR KG A+++
Sbjct: 61  TGRMRYLRNVPRRFKTGFREGTEAKPRNKGVASSA 95



>gb:AY552059_1335067 Aedes aegypti 60S ribosomal protein L37 mRNA,
           complete cds.
          Length = 91

 Score =  141 bits (355), Expect = 8e-33
 Identities = 66/91 (72%), Positives = 72/91 (79%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT SFGKRRNKTHTLC RCGR S+HIQK  CS C YPAA+IR YNWS+KA RRKTTG
Sbjct: 1   MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKHTCSQCGYPAAKIRSYNWSIKAKRRKTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPRKKGA 325
           TGRMRYL+ V R+F+  FREG  A PRK  A
Sbjct: 61  TGRMRYLKVVRRKFRNGFREGQVAKPRKATA 91



>sp|Q9VXX8|R37A_DROME Probable 60S ribosomal protein
           L37-A.>gb:AE014298_1125705 Drosophila melanogaster
           chromosome X, complete sequence.>gb:AE003498_1212714
           Drosophila melanogaster chromosome X, section 50 of 74
           of the complete sequence.
          Length = 93

 Score =  140 bits (352), Expect = 2e-32
 Identities = 64/92 (69%), Positives = 75/92 (81%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT SFGKR NKTHTLC RCGR S+HIQKS C+ C YPAA++R YNWSVKA RRKTTG
Sbjct: 1   MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWSVKAKRRKTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPRKKGAA 328
           TGRM++L+ V RRF+  FREGT+A P+K  A+
Sbjct: 61  TGRMQHLKVVRRRFRNGFREGTQAKPKKAVAS 92



>gb:AY231733_1177026 Drosophila yakuba clone yak-em_CG9091 mRNA
           sequence.>gb:AY232019_1177312 Drosophila yakuba clone
           yak-ad_CG9091 mRNA sequence.
          Length = 89

 Score =  139 bits (351), Expect = 2e-32
 Identities = 63/88 (71%), Positives = 73/88 (82%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT SFGKR NKTHTLC RCGR S+HIQKS C+ C YPAA++R YNWSVKA RRKTTG
Sbjct: 1   MTKGTSSFGKRHNKTHTLCRRCGRSSYHIQKSTCAQCGYPAAKLRSYNWSVKAKRRKTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPRK 316
           TGRM++L+ V RRF+  FREGT+A P+K
Sbjct: 61  TGRMQHLKVVRRRFRNGFREGTQAKPKK 88



>gb:AY769308_1350459 Bombyx mori ribosomal protein L37 (RpL37) mRNA,
           complete cds.
          Length = 93

 Score =  137 bits (345), Expect = 1e-31
 Identities = 64/94 (68%), Positives = 77/94 (81%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YPAA++R Y+WSVKA RRKTTG
Sbjct: 1   MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAKRRKTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPRKKGAAAA 334
           TGRMR+L+ V RRF+  F+EG + TP KK  A++
Sbjct: 61  TGRMRHLKIVRRRFRNGFKEG-KPTPPKKAVASS 93



>gb:BC073638_2557462 Xenopus laevis MGC82973 protein, mRNA (cDNA
           clone MGC:82973 IMAGE:5515565), complete cds.
          Length = 97

 Score =  136 bits (343), Expect = 2e-31
 Identities = 63/95 (66%), Positives = 73/95 (76%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT SFGKRRNKTH+LC RCG +++H+QKS C  CAYPA R RKYNWS KA RR TTG
Sbjct: 1   MTKGTSSFGKRRNKTHSLCRRCGSKAYHLQKSTCGKCAYPAKRKRKYNWSAKAKRRNTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPRKKGAAAAS 337
           TGRMR+L+ V RRFK  FREGT   P++   AA+S
Sbjct: 61  TGRMRHLKVVYRRFKNGFREGTTPKPKRAAVAASS 95



>gb:AF400199_1268298 Spodoptera frugiperda ribosomal protein L37
           mRNA, complete cds.
          Length = 92

 Score =  135 bits (340), Expect = 5e-31
 Identities = 63/93 (67%), Positives = 77/93 (82%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YPAA++R Y+WSVKA RRKTTG
Sbjct: 1   MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAKRRKTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPRKKGAAA 331
           TGRMR+L+ V RRF+  F+EG + TP+K  A++
Sbjct: 61  TGRMRHLKIVRRRFRNGFKEG-KPTPKKAVASS 92



>gb:AF401593_2492020 Ictalurus punctatus ribosomal protein L37 mRNA,
           complete cds.>gb:BC071408_2556149 Danio rerio zgc:86733,
           mRNA (cDNA clone MGC:86733 IMAGE:6897981), complete cds.
          Length = 97

 Score =  135 bits (339), Expect = 6e-31
 Identities = 62/95 (65%), Positives = 72/95 (75%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT SFGKRRNKTHTLC RCG +++H+QKS C  C YPA R RKYNWS KA RR TTG
Sbjct: 1   MTKGTSSFGKRRNKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRSTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPRKKGAAAAS 337
           TGRMR+++ V RRF+  FREGT   PR+   AA+S
Sbjct: 61  TGRMRHMKVVFRRFRNGFREGTVPKPRRAAVAASS 95



>gb:AF486842_1276110 Aplysia californica 60S ribosomal protein L37
           mRNA, complete cds.
          Length = 101

 Score =  135 bits (339), Expect = 6e-31
 Identities = 64/95 (67%), Positives = 70/95 (73%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT SFGKR NKTHT C RCG RSFHIQK  C+ C YP+ R R YNWS KA RRKTTG
Sbjct: 1   MTKGTSSFGKRHNKTHTFCRRCGHRSFHIQKKMCARCGYPSPRQRHYNWSKKAQRRKTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPRKKGAAAAS 337
           TGRMR+++ V RRF+  FREGT   PR K AA AS
Sbjct: 61  TGRMRHMKVVFRRFRNGFREGTVPKPRNKAAAPAS 95



>gb:AY674227_1179825 Ixodes pacificus clone IP_7_60_92_114_CLU 60S
           ribosomal protein L37 mRNA, complete cds.
          Length = 100

 Score =  135 bits (339), Expect = 6e-31
 Identities = 63/95 (66%), Positives = 74/95 (77%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YP +++R +NWSVKA RRKTTG
Sbjct: 1   MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSKCAQCGYPNSKLRHFNWSVKAKRRKTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPRKKGAAAAS 337
           TGR+R+LR V RRF+  FREG     +K   AAAS
Sbjct: 61  TGRLRHLRKVWRRFRNGFREGGLQKSQKHAGAAAS 95



>gb:AY181248_1587578 Kluyveromyces delphensis putative mating-type
           locus, partial sequence.
          Length = 87

 Score =  134 bits (338), Expect = 8e-31
 Identities = 61/84 (72%), Positives = 67/84 (79%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           MGKGT SFGKR NK+HTLC RCGRRSFH+QK  CSAC YPAA+ R YNW  KA RR TTG
Sbjct: 1   MGKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSACGYPAAKTRSYNWGQKAKRRHTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEA 304
           TGRMRYL++V RRFK  F+ GT A
Sbjct: 61  TGRMRYLKHVSRRFKNGFQSGTAA 84



>gb:AB180422_1202440 Plutella xylostella mRNA for Ribosomal protein
           L37, complete cds.
          Length = 92

 Score =  134 bits (338), Expect = 8e-31
 Identities = 63/93 (67%), Positives = 76/93 (81%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YPAA++R Y+WSVKA RRKTTG
Sbjct: 1   MTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAKRRKTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPRKKGAAA 331
           TGRMR+L+ V RRF+  F+EG   TP+K  A++
Sbjct: 61  TGRMRHLKIVRRRFRNGFKEGL-PTPKKAVASS 92



>pir|JN0478|R6RT37 ribosomal protein L37, cytosolic [validated] -
           rat>pir|S47646|S47646 ribosomal protein L37, cytosolic -
           human>gb:AK002592_1151316 Mus musculus adult male kidney
           cDNA, RIKEN full-length enriched library,
           clone:0610012E05 product:RIBOSOMAL PROTEIN L37 homolog
           [Homo sapiens], full insert
           sequence.>gb:AK011101_1156197 Mus musculus 13 days
           embryo liver cDNA, RIKEN full-length enriched library,
           clone:2510044B06 product:RIBOSOMAL PROTEIN L37 homolog
           [Homo sapiens], full insert
           sequence.>gb:AK012544_1157018 Mus musculus 11 days
           embryo whole body cDNA, RIKEN full-length enriched
           library, clone:2700080P07 product:RIBOSOMAL PROTEIN L37
           homolog [Homo sapiens], full insert
           sequence.>gb:AK014003_1157743 Mus musculus 13 days
           embryo head cDNA, RIKEN full-length enriched library,
           clone:3110005M08 product:RIBOSOMAL PROTEIN L37 homolog
           [Homo sapiens], full insert
           sequence.>gb:AK019020_1159864 Mus musculus 10 day old
           male pancreas cDNA, RIKEN full-length enriched library,
           clone:1810021H16 product:RIBOSOMAL PROTEIN L37 homolog
           [Homo sapiens], full insert
           sequence.>gb:AK019294_1160002 Mus musculus 10, 11 days
           embryo whole body cDNA, RIKEN full-length enriched
           library, clone:2810466O19 product:RIBOSOMAL PROTEIN L37
           homolog [Homo sapiens], full insert
           sequence.>gb:AK028138_1160808 Mus musculus adult male
           stomach cDNA, RIKEN full-length enriched library,
           clone:2210418J10 product:RIBOSOMAL PROTEIN L37 homolog
           [Homo sapiens], full insert
           sequence.>gb:AB061834_1868810 Homo sapiens RPL37 gene
           for ribosomal protein L37, complete cds and
           sequence.>gb:BC079477_1989708 Homo sapiens ribosomal
           protein L37, mRNA (cDNA clone MGC:99571 IMAGE:2819896),
           complete cds.>gb:BC084576_1989896 Homo sapiens ribosomal
           protein L37, mRNA (cDNA clone MGC:99572 IMAGE:6671394),
           complete cds.>gb:CR456890_1993097 Homo sapiens full open
           reading frame cDNA clone RZPDo834D017D for gene RPL37,
           ribosomal protein L37; complete cds, incl.
           stopcodon.>gb:HUMRPL37_2036350 Homo sapiens mRNA for
           ribosomal protein L37, complete
           cds.>gb:HUMRPL37Z_2036352 Homo sapiens ribosomal protein
           L37 mRNA, complete cds.>gb:BC054388_2101672 Mus musculus
           ribosomal protein L37, mRNA (cDNA clone MGC:62564
           IMAGE:6478626), complete cds.>gb:BC059132_2103650 Rattus
           norvegicus ribosomal protein L37, mRNA (cDNA clone
           MGC:72793 IMAGE:6919306), complete
           cds.>gb:BC069173_2106114 Rattus norvegicus ribosomal
           protein L37, mRNA (cDNA clone MGC:91649 IMAGE:7103990),
           complete cds.>gb:BC081438_2107915 Mus musculus ribosomal
           protein L37, mRNA (cDNA clone MGC:102020 IMAGE:6817584),
           complete cds.>gb:RNRPL37_2136374 R.norvegicus mRNA for
           ribosomal protein L37.>gb:S79981_2139644 ribosomal
           protein L37 [rats, myoblast L6 cells, mRNA Partial, 366
           nt].
          Length = 97

 Score =  134 bits (338), Expect = 8e-31
 Identities = 62/95 (65%), Positives = 72/95 (75%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT SFGKRRNKTHTLC RCG +++H+QKS C  C YPA R RKYNWS KA RR TTG
Sbjct: 1   MTKGTSSFGKRRNKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPRKKGAAAAS 337
           TGRMR+L+ V RRF+  FREGT   P++   AA+S
Sbjct: 61  TGRMRHLKIVYRRFRHGFREGTTPKPKRAAVAASS 95



>sp|Q962S7|RL37_SPOFR 60S ribosomal protein L37.
          Length = 91

 Score =  134 bits (337), Expect = 1e-30
 Identities = 62/91 (68%), Positives = 76/91 (83%)
 Frame = +2

Query: 59  KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTGTG 238
           KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YPAA++R Y+WSVKA RRKTTGTG
Sbjct: 2   KGTSSFGKRRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAKRRKTTGTG 61

Query: 239 RMRYLRNVPRRFKTNFREGTEATPRKKGAAA 331
           RMR+L+ V RRF+  F+EG + TP+K  A++
Sbjct: 62  RMRHLKIVRRRFRNGFKEG-KPTPKKAVASS 91



>sp|Q90YT1|RL37_ICTPU 60S ribosomal protein L37.
          Length = 96

 Score =  134 bits (336), Expect = 1e-30
 Identities = 61/93 (65%), Positives = 71/93 (76%)
 Frame = +2

Query: 59  KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTGTG 238
           KGT SFGKRRNKTHTLC RCG +++H+QKS C  C YPA R RKYNWS KA RR TTGTG
Sbjct: 2   KGTSSFGKRRNKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRSTTGTG 61

Query: 239 RMRYLRNVPRRFKTNFREGTEATPRKKGAAAAS 337
           RMR+++ V RRF+  FREGT   PR+   AA+S
Sbjct: 62  RMRHMKVVFRRFRNGFREGTVPKPRRAAVAASS 94



>gb:AE016819_1749524 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 88

 Score =  133 bits (335), Expect = 2e-30
 Identities = 61/87 (70%), Positives = 71/87 (81%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           MGKGT SFGKR NK+HTLC RCGRRSFHIQK  CS+C YPAA++R YNW+ KA RR+TTG
Sbjct: 1   MGKGTPSFGKRHNKSHTLCNRCGRRSFHIQKKTCSSCGYPAAKMRSYNWATKAKRRRTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPR 313
           TGRMRYL+ V R+FK  F+ G EA P+
Sbjct: 61  TGRMRYLKTVARKFKNGFQTG-EAKPQ 86



>sp|P61927|RL37_HUMAN 60S ribosomal protein L37
           (G1.16).>sp|Q9D823|RL37_MOUSE 60S ribosomal protein
           L37.>sp|P61928|RL37_RAT 60S ribosomal protein L37.
          Length = 96

 Score =  133 bits (335), Expect = 2e-30
 Identities = 61/93 (65%), Positives = 71/93 (76%)
 Frame = +2

Query: 59  KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTGTG 238
           KGT SFGKRRNKTHTLC RCG +++H+QKS C  C YPA R RKYNWS KA RR TTGTG
Sbjct: 2   KGTSSFGKRRNKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTG 61

Query: 239 RMRYLRNVPRRFKTNFREGTEATPRKKGAAAAS 337
           RMR+L+ V RRF+  FREGT   P++   AA+S
Sbjct: 62  RMRHLKIVYRRFRHGFREGTTPKPKRAAVAASS 94



>gb:AY190733_2518051 Pagrus major ribosomal protein L37 mRNA,
           complete cds.
          Length = 97

 Score =  132 bits (333), Expect = 3e-30
 Identities = 61/95 (64%), Positives = 70/95 (73%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT SFGKRRNKTHTLC RCG  ++H+QKS C  C YP  R RKYNWS KA RR TTG
Sbjct: 1   MTKGTSSFGKRRNKTHTLCRRCGSNAYHLQKSSCGKCGYPEKRKRKYNWSAKAKRRNTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPRKKGAAAAS 337
           TGR+R+L+ V RRF+  FREGT   PR+   AA+S
Sbjct: 61  TGRLRHLKVVYRRFRNGFREGTTPKPRRAAVAASS 95



>gb:S79979_2041886 Homo sapiens ribosomal protein L37 gene, complete
           cds.
          Length = 97

 Score =  132 bits (332), Expect = 4e-30
 Identities = 61/95 (64%), Positives = 71/95 (74%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT SFGKRRNKTHTLC RCG +++H+QKS C  C YPA R RKYNWS KA RR TTG
Sbjct: 1   MTKGTSSFGKRRNKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPRKKGAAAAS 337
           TGRM +L+ V RRF+  FREGT   P++   AA+S
Sbjct: 61  TGRMSHLKIVYRRFRHGFREGTTPKPKRAAVAASS 95



>gb:AK008563_1154651 Mus musculus adult male small intestine cDNA,
           RIKEN full-length enriched library, clone:2010311G18
           product:RIBOSOMAL PROTEIN L37 homolog [Homo sapiens],
           full insert sequence.
          Length = 97

 Score =  132 bits (332), Expect = 4e-30
 Identities = 61/95 (64%), Positives = 71/95 (74%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT SFGKRRNKTH LC RCG +++H+QKS C  C YPA R RKYNWS KA RR TTG
Sbjct: 1   MTKGTSSFGKRRNKTHRLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPRKKGAAAAS 337
           TGRMR+L+ V RRF+  FREGT   P++   AA+S
Sbjct: 61  TGRMRHLKIVYRRFRHGFREGTTPKPKRAAVAASS 95



>pir|S51430|S51430 ribosomal protein L37.e.A, cytosolic - yeast
           (Saccharomyces cerevisiae)>gb:YSCL9470_1729703
           Saccharomyces cerevisiae chromosome XII cosmid 9470.
          Length = 88

 Score =  131 bits (329), Expect = 9e-30
 Identities = 58/82 (70%), Positives = 66/82 (80%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           MGKGT SFGKR NK+HTLC RCGRRSFH+QK  CS+C YPAA+ R YNW  KA RR TTG
Sbjct: 1   MGKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGAKAKRRHTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGT 298
           TGRMRYL++V RRFK  F+ G+
Sbjct: 61  TGRMRYLKHVSRRFKNGFQTGS 82



>gb:AY181247_1587567 Candida glabrata putative mating-type locus,
           partial sequence.>gb:CR380948_1649248 Candida glabrata
           strain CBS138 chromosome B complete sequence.
          Length = 88

 Score =  130 bits (326), Expect = 2e-29
 Identities = 57/82 (69%), Positives = 66/82 (80%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           MGKGT SFGKR NK+HTLC RCGRRSFH+QK  C++C YP+A+ R YNW  KA RR TTG
Sbjct: 1   MGKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCASCGYPSAKTRSYNWGQKAKRRHTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGT 298
           TGRMRYL++V RRFK  F+ GT
Sbjct: 61  TGRMRYLKHVARRFKNGFQSGT 82



>gb:S79980_1444508 ribosomal protein L37 [cattle, BT cells, mRNA
           Partial, 307 nt].
          Length = 93

 Score =  129 bits (325), Expect = 3e-29
 Identities = 63/95 (66%), Positives = 72/95 (75%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT SFGKRRNKT TLC RCG +++H+QKS C  C YPA R RKYNWS KA RR TTG
Sbjct: 1   MTKGTSSFGKRRNKTDTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPRKKGAAAAS 337
           TGRMR+L+ V RRF+  FREGT  TP+ K AA A+
Sbjct: 61  TGRMRHLKIVYRRFRHGFREGT--TPKPKRAAVAA 93



>sp|P49166|R37A_YEAST 60S ribosomal protein L37-A (L35) (YP55).
          Length = 87

 Score =  129 bits (324), Expect = 3e-29
 Identities = 57/81 (70%), Positives = 65/81 (80%)
 Frame = +2

Query: 56  GKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTGT 235
           GKGT SFGKR NK+HTLC RCGRRSFH+QK  CS+C YPAA+ R YNW  KA RR TTGT
Sbjct: 1   GKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGAKAKRRHTTGT 60

Query: 236 GRMRYLRNVPRRFKTNFREGT 298
           GRMRYL++V RRFK  F+ G+
Sbjct: 61  GRMRYLKHVSRRFKNGFQTGS 81



>gb:CR382123_1655542 Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 88

 Score =  128 bits (322), Expect = 6e-29
 Identities = 56/81 (69%), Positives = 67/81 (82%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           MGKGT SFGKR NK+HTLC RCGR S+HIQK  CS+C YPAA++R +NW+ KA RR+TTG
Sbjct: 1   MGKGTPSFGKRHNKSHTLCKRCGRSSYHIQKHTCSSCGYPAAKMRSHNWAAKAKRRRTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREG 295
           TGRMRYL++V RRFK  F+ G
Sbjct: 61  TGRMRYLKHVSRRFKNGFQSG 81



>pir|S69558|S69558 ribosomal protein L37.e.B, cytosolic - yeast
           (Saccharomyces cerevisiae)>gb:SCD9717_1707595
           Saccharomyces cerevisiae chromosome IV cosmids 8166,
           9787, 9717, and lambda 3073.
          Length = 88

 Score =  128 bits (322), Expect = 6e-29
 Identities = 56/82 (68%), Positives = 67/82 (81%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           MGKGT SFGKR NK+HTLC RCGRRSFH+QK  CS+C YP+A+ R +NW+ KA RR TTG
Sbjct: 1   MGKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPSAKTRSHNWAAKAKRRHTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGT 298
           TGRMRYL++V RRFK  F+ G+
Sbjct: 61  TGRMRYLKHVSRRFKNGFQTGS 82



>sp|P79244|RL37_BOVIN 60S ribosomal protein L37 (Fragment).
          Length = 92

 Score =  128 bits (322), Expect = 6e-29
 Identities = 62/93 (66%), Positives = 71/93 (76%)
 Frame = +2

Query: 59  KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTGTG 238
           KGT SFGKRRNKT TLC RCG +++H+QKS C  C YPA R RKYNWS KA RR TTGTG
Sbjct: 2   KGTSSFGKRRNKTDTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTG 61

Query: 239 RMRYLRNVPRRFKTNFREGTEATPRKKGAAAAS 337
           RMR+L+ V RRF+  FREGT  TP+ K AA A+
Sbjct: 62  RMRHLKIVYRRFRHGFREGT--TPKPKRAAVAA 92



>gb:AE017343_1755306 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 91

 Score =  127 bits (320), Expect = 1e-28
 Identities = 58/89 (65%), Positives = 68/89 (76%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           MGKGT SFGKR +K+HTLC RCG RSFH QK  C+ C YPAA++R +NW +KA RRKTTG
Sbjct: 1   MGKGTPSFGKRHSKSHTLCRRCGNRSFHKQKLTCAQCGYPAAKLRSFNWGLKAKRRKTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPRKK 319
           TGRM +L+NV RRFK  FREG  A  + K
Sbjct: 61  TGRMAHLKNVNRRFKNGFREGGAAAKKAK 89



>gb:A63907_1450134 Sequence 32 from Patent WO9723633.
          Length = 91

 Score =  127 bits (320), Expect = 1e-28
 Identities = 57/89 (64%), Positives = 68/89 (76%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT SFGKR  KTHT+C RCG R+FH QK  C+ C YPAA++R +NW  KA RRKTTG
Sbjct: 1   MTKGTSSFGKRHTKTHTICRRCGNRAFHRQKKTCAQCGYPAAKMRSFNWGEKAKRRKTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPRKK 319
           TGRM++L++V RRFK  FREGT AT + K
Sbjct: 61  TGRMQHLKDVSRRFKNGFREGTSATKKVK 89



>sp|Q9C0T1|RL37_EMENI 60S ribosomal protein L37.>gb:AF277381_1782767
           Aspergillus nidulans ribosomal protein L37 (rpl37) gene,
           complete cds.>gb:AF277382_1782768 Aspergillus nidulans
           ribosomal protein L37 mRNA, complete cds.
          Length = 92

 Score =  127 bits (320), Expect = 1e-28
 Identities = 59/82 (71%), Positives = 66/82 (80%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT SFGKR NKTHTLC RCGRRS+HIQKS C+ C YPAA+ RKYNWS KA RRKTTG
Sbjct: 1   MTKGTSSFGKRHNKTHTLCRRCGRRSYHIQKSTCANCGYPAAKTRKYNWSEKAKRRKTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGT 298
           +GR  +LR+V RRFK  F+ GT
Sbjct: 61  SGRTAHLRDVHRRFKNGFQVGT 82



>pir|S44313|S44313 ribosomal protein L37, cytosolic - tomato
           (fragment)
          Length = 64

 Score =  127 bits (319), Expect = 1e-28
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +2

Query: 149 RCSACAYPAARIRKYNWSVKAIRRKTTGTGRMRYLRNVPRRFKTNFREGTEATPRKKGAA 328
           RCSACAYPAAR+RKYNWSVKA+RRKTTGTGRMRYLRNVPRRFKTNFREGTEA PRKKG A
Sbjct: 2   RCSACAYPAARLRKYNWSVKALRRKTTGTGRMRYLRNVPRRFKTNFREGTEAAPRKKGTA 61

Query: 329 AAS 337
           AAS
Sbjct: 62  AAS 64



>sp|P49212|RL37_LYCES 60S ribosomal protein L37
           (Fragment).>gb:LEMRL37_1684374 L.esculentum Mill
           (Rutgers) ribosomal protein L37 mRNA.
          Length = 64

 Score =  127 bits (319), Expect = 1e-28
 Identities = 59/63 (93%), Positives = 61/63 (96%)
 Frame = +2

Query: 149 RCSACAYPAARIRKYNWSVKAIRRKTTGTGRMRYLRNVPRRFKTNFREGTEATPRKKGAA 328
           RCSACAYPAAR+RKYNWSVKA+RRKTTGTGRMRYLRNVPRRFKTNFREGTEA PRKKG A
Sbjct: 2   RCSACAYPAARLRKYNWSVKALRRKTTGTGRMRYLRNVPRRFKTNFREGTEAAPRKKGTA 61

Query: 329 AAS 337
           AAS
Sbjct: 62  AAS 64



>sp|P51402|R37B_YEAST 60S ribosomal protein L37-B (L35) (YP55).
          Length = 87

 Score =  126 bits (317), Expect = 2e-28
 Identities = 55/81 (67%), Positives = 66/81 (81%)
 Frame = +2

Query: 56  GKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTGT 235
           GKGT SFGKR NK+HTLC RCGRRSFH+QK  CS+C YP+A+ R +NW+ KA RR TTGT
Sbjct: 1   GKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPSAKTRSHNWAAKAKRRHTTGT 60

Query: 236 GRMRYLRNVPRRFKTNFREGT 298
           GRMRYL++V RRFK  F+ G+
Sbjct: 61  GRMRYLKHVSRRFKNGFQTGS 81



>gb:AY829769_1180168 Lonomia obliqua ribosomal protein 12 mRNA,
           complete cds.
          Length = 109

 Score =  125 bits (315), Expect = 4e-28
 Identities = 60/95 (63%), Positives = 75/95 (78%), Gaps = 1/95 (1%)
 Frame = +2

Query: 50  QMGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTT 229
           +M KGT SFGKRRNKTHTLC RCGR S+HIQKS+C+ C YPAA++R Y+WSVKA RRKTT
Sbjct: 16  KMTKGTSSFGKRRNKTHTLCRRCGRSSYHIQKSKCAQCGYPAAKLRSYHWSVKAKRRKTT 75

Query: 230 GTGRMRYLRNVPRR-FKTNFREGTEATPRKKGAAA 331
           GTGRMR+L+      F+  F+EG + TP+K  A++
Sbjct: 76  GTGRMRHLKTGQEGVFRNGFKEG-KVTPKKAVASS 109



>gb:AF035770_1234849 Schistosoma mansoni ribosomal protein L37 mRNA,
           complete cds.
          Length = 88

 Score =  124 bits (312), Expect = 8e-28
 Identities = 56/81 (69%), Positives = 65/81 (80%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT SFGKR NK+HT C RCGR+S+HIQK  CS+C YP+AR+RKYNWS KA RR+TTG
Sbjct: 1   MTKGTTSFGKRHNKSHTQCRRCGRKSYHIQKKTCSSCGYPSARLRKYNWSEKAKRRRTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREG 295
           TGRM +L+ V RRFK  FR G
Sbjct: 61  TGRMLHLKRVHRRFKQGFRSG 81



>sp|O44125|RL37_SCHMA 60S ribosomal protein L37.
          Length = 87

 Score =  123 bits (309), Expect = 2e-27
 Identities = 55/79 (69%), Positives = 64/79 (81%)
 Frame = +2

Query: 59  KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTGTG 238
           KGT SFGKR NK+HT C RCGR+S+HIQK  CS+C YP+AR+RKYNWS KA RR+TTGTG
Sbjct: 2   KGTTSFGKRHNKSHTQCRRCGRKSYHIQKKTCSSCGYPSARLRKYNWSEKAKRRRTTGTG 61

Query: 239 RMRYLRNVPRRFKTNFREG 295
           RM +L+ V RRFK  FR G
Sbjct: 62  RMLHLKRVHRRFKQGFRSG 80



>pir|T40865|T40865 60s ribosomal protein L37 - fission yeast
           (Schizosaccharomyces pombe)>gb:SPCC1223_1720790 S.pombe
           chromosome III cosmid c1223.
          Length = 91

 Score =  122 bits (306), Expect = 4e-27
 Identities = 55/84 (65%), Positives = 62/84 (73%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT SFG R NK+HT+C RCG+RSFHIQKS C+ C YPAA+ R YNW  KA RR+TTG
Sbjct: 1   MTKGTQSFGMRHNKSHTICRRCGKRSFHIQKSTCACCGYPAAKTRSYNWGAKAKRRRTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEA 304
           TGRM YL+ V R FK  FR G  A
Sbjct: 61  TGRMSYLKKVHRSFKNGFRSGKPA 84



>pir|T26055|T26055 ribosomal protein L37 W01D2.1 [similarity] -
           Caenorhabditis elegans>gb:CEW01D2_1368792 Caenorhabditis
           elegans cosmid W01D2, complete sequence.
          Length = 92

 Score =  122 bits (305), Expect = 5e-27
 Identities = 54/87 (62%), Positives = 66/87 (75%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT +FGK+  K+HTLC RCG+ SFHIQK RC++C YP A+ R YNW  K+IRR+TTG
Sbjct: 1   MTKGTQAFGKKHVKSHTLCKRCGKSSFHIQKKRCASCGYPDAKKRTYNWGAKSIRRRTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPR 313
           TGR R+LR+V  RF+  FREGT   PR
Sbjct: 61  TGRTRHLRDVNARFRNGFREGTTPKPR 87



>pir|T43306|T43306 ribosomal protein L37 [similarity] - fission
           yeast  (Schizosaccharomyces pombe)>gb:AB009637_1510796
           Schizosaccharomyces pombe mRNA for ribosomal protein
           L37, complete cds.>gb:SPAPB17E12_1718626 S.pombe
           chromosome I BAC pB17E12.
          Length = 89

 Score =  121 bits (303), Expect = 9e-27
 Identities = 54/81 (66%), Positives = 61/81 (75%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT SFG R NK+HT+C RCG+RSFHIQKS C+ C YPAA+ R YNW  KA RR+TTG
Sbjct: 1   MTKGTQSFGMRHNKSHTICRRCGKRSFHIQKSTCACCGYPAAKTRSYNWGAKAKRRRTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREG 295
           TGRM YL+ V R FK  FR G
Sbjct: 61  TGRMSYLKKVHRSFKNGFRAG 81



>sp|Q9P836|RL37_CANAL 60S ribosomal protein L37
           (Fragment).>gb:CAL390504_1644990 Candida albicans
           partial mRNA for ribosomal protein L37 (rpl37 gene).
          Length = 88

 Score =  121 bits (303), Expect = 9e-27
 Identities = 52/79 (65%), Positives = 65/79 (82%)
 Frame = +2

Query: 59  KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTGTG 238
           +GT S GKR NK+HTLC RCGRRSFH+QK  CS+C YPAA++R +NW++KA RR+TTGTG
Sbjct: 1   EGTPSLGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKMRSHNWALKAKRRRTTGTG 60

Query: 239 RMRYLRNVPRRFKTNFREG 295
           RM YL++V RRFK  F+ G
Sbjct: 61  RMAYLKHVTRRFKNGFQTG 79



>sp|P05733|R37B_SCHPO 60S ribosomal protein L37-B (L37-2) (YL27).
          Length = 90

 Score =  121 bits (303), Expect = 9e-27
 Identities = 54/82 (65%), Positives = 61/82 (74%)
 Frame = +2

Query: 59  KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTGTG 238
           KGT SFG R NK+HT+C RCG+RSFHIQKS C+ C YPAA+ R YNW  KA RR+TTGTG
Sbjct: 2   KGTQSFGMRHNKSHTICRRCGKRSFHIQKSTCACCGYPAAKTRSYNWGAKAKRRRTTGTG 61

Query: 239 RMRYLRNVPRRFKTNFREGTEA 304
           RM YL+ V R FK  FR G  A
Sbjct: 62  RMSYLKKVHRSFKNGFRSGKPA 83



>gb:CR382137_1670146 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 88

 Score =  120 bits (301), Expect = 2e-26
 Identities = 51/81 (62%), Positives = 64/81 (79%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT S GKR NK+H LC RCG+RSFH+QK  C++C YPAA++R +NW+ KA RR+TTG
Sbjct: 1   MSKGTPSLGKRHNKSHVLCNRCGKRSFHVQKKTCASCGYPAAKLRSHNWATKAKRRRTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREG 295
           TGRM YL++V RRFK  F+ G
Sbjct: 61  TGRMAYLKHVSRRFKNGFQTG 81



>sp|Q9W1U6|R37B_DROME Probable 60S ribosomal protein
           L37-B.>gb:AE013599_1133452 Drosophila melanogaster
           chromosome 2R, complete sequence.>gb:AE003459_1210751
           Drosophila melanogaster chromosome 2R, section 67 of 74
           of the complete sequence.
          Length = 89

 Score =  120 bits (300), Expect = 2e-26
 Identities = 54/84 (64%), Positives = 63/84 (75%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT SFGKR NKTHT+C RCG  S+H+QKS+CS C YPAA+ R +NWS KA  RK  G
Sbjct: 1   MTKGTTSFGKRHNKTHTICRRCGNSSYHLQKSKCSQCGYPAAKTRSFNWSRKAKGRKAQG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEA 304
           TGRMRYL+N+ RRF+   REG  A
Sbjct: 61  TGRMRYLKNLRRRFRNGLREGGAA 84



>sp|P59289|R37A_SCHPO 60S ribosomal protein L37-A (L37-1).
          Length = 88

 Score =  120 bits (300), Expect = 2e-26
 Identities = 53/79 (67%), Positives = 60/79 (75%)
 Frame = +2

Query: 59  KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTGTG 238
           KGT SFG R NK+HT+C RCG+RSFHIQKS C+ C YPAA+ R YNW  KA RR+TTGTG
Sbjct: 2   KGTQSFGMRHNKSHTICRRCGKRSFHIQKSTCACCGYPAAKTRSYNWGAKAKRRRTTGTG 61

Query: 239 RMRYLRNVPRRFKTNFREG 295
           RM YL+ V R FK  FR G
Sbjct: 62  RMSYLKKVHRSFKNGFRAG 80



>gb:BC067790_1987486 Homo sapiens cDNA clone IMAGE:5310673, partial
           cds.
          Length = 105

 Score =  116 bits (291), Expect = 2e-25
 Identities = 53/86 (61%), Positives = 63/86 (73%)
 Frame = +2

Query: 80  KRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTGTGRMRYLRN 259
           K  NKTHTLC RCG +++H+QKS C  C YPA R RKYNWS KA RR TTGTGRMR+L+ 
Sbjct: 18  KASNKTHTLCRRCGSKAYHLQKSTCGKCGYPAKRKRKYNWSAKAKRRNTTGTGRMRHLKI 77

Query: 260 VPRRFKTNFREGTEATPRKKGAAAAS 337
           V RRF+  FREGT   P++   AA+S
Sbjct: 78  VYRRFRHGFREGTTPKPKRAAVAASS 103



>sp|P49622|RL37_CAEEL 60S ribosomal protein L37.>pir|T20195|T20195
           ribosomal protein L37 C54C6.1 [similarity] -
           Caenorhabditis elegans>gb:CEC54C6_1361568 Caenorhabditis
           elegans cosmid C54C6, complete sequence.
          Length = 91

 Score =  112 bits (280), Expect = 4e-24
 Identities = 52/87 (59%), Positives = 64/87 (73%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT +FGK+  K+HTLC RCG+ SFHIQK RC++C Y  A+ R YNW  K+IRR+TTG
Sbjct: 1   MTKGTQAFGKKHVKSHTLCKRCGKSSFHIQKKRCASCGYQDAKKRTYNWGAKSIRRRTTG 60

Query: 233 TGRMRYLRNVPRRFKTNFREGTEATPR 313
           TGR R+LR+V  RF+  FR GT   PR
Sbjct: 61  TGRTRHLRDVNARFRNGFR-GTTPKPR 86



>gb:CR382131_1663513 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 84

 Score =  112 bits (279), Expect = 5e-24
 Identities = 49/78 (62%), Positives = 59/78 (75%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT SFGK+  K+HTLC RCG+RSFH QK  C++C YP+A+IR YNW  KA RR TTG
Sbjct: 1   MTKGTTSFGKKHTKSHTLCTRCGKRSFHCQKKTCASCGYPSAKIRSYNWGQKAKRRHTTG 60

Query: 233 TGRMRYLRNVPRRFKTNF 286
           TGRMR L+ V R+F+  F
Sbjct: 61  TGRMRSLKLVDRKFRNGF 78



>gb:AC005801_1203280 Leishmania major strain Friedlin chromosome 35
           clone 5.1.1, complete sequence.>gb:AC009603_1204168
           Leishmania major strain Friedlin chromosome 35 clone
           L3342, complete sequence.>gb:LDU35461_1387338 Leishmania
           donovani ribosomal protein L37 (rpl37beta) mRNA,
           complete cds.>gb:LEIRPL37X_1387442 Leishmania infantum
           ribsomal protein L37 (RPL37) gene, complete
           cds.>gb:LIU35460_1387587 Leishmania infantum ribosomal
           protein L37 (rpl37alpha) mRNA, complete cds.
          Length = 83

 Score =  107 bits (268), Expect = 1e-22
 Identities = 48/79 (60%), Positives = 59/79 (74%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT S G+R  +TH LC RCGR S+H+Q  RC+ACAYP A  R+YNWSVKAI+R+ TG
Sbjct: 1   MTKGTTSMGQRHGRTHILCRRCGRNSYHVQWERCAACAYPRASRRRYNWSVKAIKRRRTG 60

Query: 233 TGRMRYLRNVPRRFKTNFR 289
           TGR RYL+ V RR   +F+
Sbjct: 61  TGRCRYLKVVNRRIANHFK 79



>sp|P39094|RL37_LEIIN 60S ribosomal protein L37.
          Length = 82

 Score =  106 bits (265), Expect = 2e-22
 Identities = 47/77 (61%), Positives = 58/77 (75%)
 Frame = +2

Query: 59  KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTGTG 238
           KGT S G+R  +TH LC RCGR S+H+Q  RC+ACAYP A  R+YNWSVKAI+R+ TGTG
Sbjct: 2   KGTTSMGQRHGRTHILCRRCGRNSYHVQWERCAACAYPRASRRRYNWSVKAIKRRRTGTG 61

Query: 239 RMRYLRNVPRRFKTNFR 289
           R RYL+ V RR   +F+
Sbjct: 62  RCRYLKVVNRRIANHFK 78



>gb:BX842630_1643968 Neurospora crassa DNA linkage group I BAC
           contig B13D15.
          Length = 124

 Score =  103 bits (257), Expect = 2e-21
 Identities = 59/126 (46%), Positives = 65/126 (51%), Gaps = 32/126 (25%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGR--------------------------------RSFH 136
           M KGT SFGKR  KTH LC RCGR                                RS H
Sbjct: 1   MTKGTSSFGKRHTKTHGLCRRCGRIYGSTAAKMNENYQRRPAATREQEIDNRFTSRRSLH 60

Query: 137 IQKSRCSACAYPAARIRKYNWSVKAIRRKTTGTGRMRYLRNVPRRFKTNFREGTEATPRK 316
            QK  C++C YPAA+ RKYNWS KA RRKTTGTGR+RYL  V R+FK  F+ G       
Sbjct: 61  NQKKVCASCGYPAAKTRKYNWSEKAKRRKTTGTGRLRYLSTVSRKFKNGFQTG--VPKGS 118

Query: 317 KGAAAA 334
           KG  AA
Sbjct: 119 KGPVAA 124



>gb:SPU97370_1722280 Schizosaccharomyces pombe 60S ribosomal protein
           homolog mRNA, partial cds.
          Length = 60

 Score = 94.4 bits (233), Expect = 1e-18
 Identities = 40/60 (66%), Positives = 45/60 (75%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT SFG R NK+HT+C RCG+RSFHIQKS C  C YPAA+ R YNW  K  RR+TTG
Sbjct: 1   MAKGTQSFGMRHNKSHTICRRCGKRSFHIQKSTCGMCGYPAAKTRSYNWGAKGKRRRTTG 60



>gb:AP003886_1834842 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1163_G08.>gb:AP004591_1841997 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0582D05.
          Length = 58

 Score = 88.2 bits (217), Expect = 8e-17
 Identities = 40/46 (86%), Positives = 44/46 (95%)
 Frame = +2

Query: 194 NWSVKAIRRKTTGTGRMRYLRNVPRRFKTNFREGTEATPRKKGAAA 331
           NWSVKAIRRKTTGTGRMRY+R+VPRRFK+NFREGTEATPRK+ A A
Sbjct: 12  NWSVKAIRRKTTGTGRMRYMRHVPRRFKSNFREGTEATPRKRAAVA 57



>gb:CNS07EGE_1373733 chromosome VII of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 90

 Score = 82.0 bits (201), Expect = 6e-15
 Identities = 38/79 (48%), Positives = 52/79 (65%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRKTTG 232
           M KGT SFGK+  +   +C RCGR+S+H QK+ CS+C YP  ++R    S+KA RR+T G
Sbjct: 1   MSKGTASFGKKNKRNTEMCRRCGRQSYHKQKNSCSSCGYPNPKMRNPG-SIKARRRRTIG 59

Query: 233 TGRMRYLRNVPRRFKTNFR 289
           TGRMRY++   R  K   +
Sbjct: 60  TGRMRYMKRELRAAKNGHK 78



>sp|Q8TYS1|RL37_METKA 50S ribosomal protein L37e.>gb:AE010320_261853
           Methanopyrus kandleri AV19 section 19 of 157 of the
           complete genome.>gb:AE009439_902634 Methanopyrus
           kandleri AV19, complete genome.
          Length = 62

 Score = 68.9 bits (167), Expect = 5e-11
 Identities = 31/59 (52%), Positives = 42/59 (71%), Gaps = 2/59 (3%)
 Frame = +2

Query: 53  MGKGTGSFGKR-RNKTHTLCVRCGRRSFHIQKSRCSACAY-PAARIRKYNWSVKAIRRK 223
           M KGT SFGKR + KTH  C RCGRR++H++K  C+AC +  + RIR+Y+W  K + RK
Sbjct: 1   MAKGTPSFGKRNKTKTHVRCRRCGRRAYHVRKGYCAACGFGRSRRIRRYSWQNKKVNRK 59



>sp|P54011|RL37_METJA 50S ribosomal protein L37e.>pir|B64312|B64312
           ribosomal protein L37 - Methanococcus
           jannaschii>gb:U67467_206184 Methanocaldococcus
           jannaschii DSM 2661 section 9 of 150 of the complete
           genome.>gb:L77117_1098942 Methanocaldococcus jannaschii
           DSM 2661, complete genome.
          Length = 61

 Score = 68.6 bits (166), Expect = 7e-11
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 1/58 (1%)
 Frame = +2

Query: 53  MGKGTGSFGKR-RNKTHTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWSVKAIRRK 223
           M KGT S GKR +   H  C RCGRR++H++K RC+AC +P  R+RKY+W  K +  K
Sbjct: 1   MSKGTPSMGKRNKGSYHIRCRRCGRRAYHVRKKRCAACGFPNKRMRKYSWQNKKVNGK 58



>sp|Q9YEQ4|RL37_AERPE 50S ribosomal protein L37e.>pir|H72749|H72749
           probable ribosomal protein L37 APES023 - Aeropyrum
           pernix  (strain K1)>gb:BA000002_651236 Aeropyrum pernix
           K1 DNA, complete genome.
          Length = 62

 Score = 61.6 bits (148), Expect = 8e-09
 Identities = 29/58 (50%), Positives = 40/58 (68%), Gaps = 2/58 (3%)
 Frame = +2

Query: 53  MGKGTGSFGKR-RNKTHTLCVRCGRRSFHIQKSRCSACAY-PAARIRKYNWSVKAIRR 220
           MGKGT S GK  R+KTH +C RCGRRS+++ K  C+AC +  + R+R+Y+W  K   R
Sbjct: 1   MGKGTPSMGKHGRSKTHIVCRRCGRRSYNVAKGYCAACGFGRSRRMRRYSWQNKKWNR 58



>sp|O26744|RL37_METTH 50S ribosomal protein L37e.>pir|B69186|B69186
           ribosomal protein L37 - Methanobacterium
           thermoautotrophicum (strain Delta H)>gb:AE000845_28349
           Methanobacterium thermoautotrophicum from bases 571179
           to 587367 (section 51 of 148) of the complete
           genome.>gb:AE000666_925431 Methanobacterium
           thermoautotrophicum str. Delta H complete genome.
          Length = 60

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 1/53 (1%)
 Frame = +2

Query: 59  KGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAY-PAARIRKYNWSVKAI 214
           KGT SFGKR    H  C RCG+ S+H++K  C+AC +  + RIR+Y+W  K I
Sbjct: 2   KGTPSFGKRNKNLHIRCRRCGKNSYHVRKKVCAACGFGRSRRIRRYSWQNKKI 54



>sp|Q8U0P5|RL37_PYRFU 50S ribosomal protein L37e.>gb:AE010255_261108
           Pyrococcus furiosus DSM 3638, section 130 of 173 of the
           complete genome.>gb:AE009950_901889 Pyrococcus furiosus
           DSM 3638, complete genome.
          Length = 62

 Score = 59.7 bits (143), Expect = 3e-08
 Identities = 28/59 (47%), Positives = 40/59 (67%), Gaps = 2/59 (3%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNK-THTLCVRCGRRSFHIQKSRCSACAY-PAARIRKYNWSVKAIRRK 223
           MG GT +FGKR +  TH  C RCGR S++++K  C+AC +  + R+RKY WS K  ++K
Sbjct: 1   MGSGTATFGKRNSTPTHIRCRRCGRVSYNVKKGYCAACGFGRSRRLRKYRWSKKWKKKK 59



>gb:AP006878_576127 Thermococcus kodakaraensis strain KOD1 DNA,
           complete genome.
          Length = 63

 Score = 58.2 bits (139), Expect = 9e-08
 Identities = 28/54 (51%), Positives = 37/54 (68%), Gaps = 2/54 (3%)
 Frame = +2

Query: 53  MGKGTGSFGKR-RNKTHTLCVRCGRRSFHIQKSRCSACAY-PAARIRKYNWSVK 208
           MG GT   GKR R  TH  C RCGRR+F+++K  C+AC +  + R+RKY+WS K
Sbjct: 1   MGAGTAPKGKRNRTPTHIRCRRCGRRAFNVKKGYCAACGFGRSRRMRKYSWSHK 54



>sp|Q975S6|RL37_SULTO 50S ribosomal protein L37e.>gb:BA000023_690907
           Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 61

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 26/54 (48%), Positives = 37/54 (68%), Gaps = 2/54 (3%)
 Frame = +2

Query: 59  KGTGSFGK-RRNKTHTLCVRCGRRSFHIQKSRCSACAY-PAARIRKYNWSVKAI 214
           KGT SFGK  ++ TH  C RCGR SF+++K  C+AC +  + +IR+YNW  K +
Sbjct: 2   KGTPSFGKMNKSPTHVRCRRCGRNSFNVRKGYCAACGFGRSKKIRRYNWQNKKV 55



>sp|P62004|RL37_PYRAB 50S ribosomal protein
           L37e.>sp|P62005|RL37_PYRHO 50S ribosomal protein
           L37e.>pir|C75106|C75106 ribosomal protein L37 PAB7160
           [similarity] - Pyrococcus abyssi (strain
           Orsay)>pir|C71028|C71028 ribosomal protein L37
           [similarity] - Pyrococcus horikoshii>gb:BA000001_650189
           Pyrococcus horikoshii OT3 DNA, complete
           genome.>gb:CNSPAX03_849405 Pyrococcus abyssi complete
           genome; segment 3/6.
          Length = 62

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 27/59 (45%), Positives = 39/59 (66%), Gaps = 2/59 (3%)
 Frame = +2

Query: 53  MGKGTGSFGKR-RNKTHTLCVRCGRRSFHIQKSRCSACAY-PAARIRKYNWSVKAIRRK 223
           M  GT S GKR +  TH  C RCGR++F+++K  C+AC +  + R+RKY WS K  ++K
Sbjct: 1   MSSGTPSLGKRNKTPTHIRCRRCGRKAFNVKKGYCAACGFGRSRRLRKYRWSKKWKKKK 59



>sp|Q97BU6|RL37_THEVO 50S ribosomal protein L37e.>gb:BA000011_664801
           Thermoplasma volcanium GSS1 DNA, complete genome.
          Length = 54

 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 24/51 (47%), Positives = 31/51 (60%), Gaps = 1/51 (1%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNK-THTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWS 202
           M  GT   GK  NK TH  C RCG  +++++  RCS C +PA RIR Y W+
Sbjct: 1   MSNGTAVMGKINNKKTHITCRRCGHHTYNVRTKRCSHCGFPAPRIRSYKWA 51



>sp|Q9HIT7|RL37_THEAC 50S ribosomal protein L37e.>gb:TACID5_196995
           Thermoplasma acidophilum complete genome; segment 5/5.
          Length = 54

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 24/51 (47%), Positives = 31/51 (60%), Gaps = 1/51 (1%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNK-THTLCVRCGRRSFHIQKSRCSACAYPAARIRKYNWS 202
           M  GT   GK  NK TH  C RCG  +++++  RCS C +PA RIR Y W+
Sbjct: 1   MSNGTAVMGKINNKKTHIRCRRCGHHTYNVRTKRCSHCGFPAPRIRSYRWA 51



>sp|Q8TL48|RL37_METAC 50S ribosomal protein L37e.>gb:AE011023_268501
           Methanosarcina acetivorans str. C2A, section 368 of 534
           of the complete genome.>gb:AE010299_909060
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 56

 Score = 56.6 bits (135), Expect = 3e-07
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 1/53 (1%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAY-PAARIRKYNWSVK 208
           M KGT S GKR+ +TH  C RCG  SF++   +C++C +   +R+R Y W  K
Sbjct: 1   MSKGTSSMGKRQKRTHAKCRRCGSVSFNVHTKQCTSCGFGKTSRMRTYKWQAK 53



>sp|P32410|RL37_HALMA 50S ribosomal protein L37e
           (L35e).>pir|S33789|S33789 ribosomal protein L37.eR
           [validated] - Haloarcula marismortui
          Length = 56

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 25/53 (47%), Positives = 33/53 (62%), Gaps = 1/53 (1%)
 Frame = +2

Query: 56  GKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAY-PAARIRKYNWSVKA 211
           G GT S GK+   THT C RCG +S+H +K  CS+C +  +A+ R Y W  KA
Sbjct: 2   GAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKA 54



>sp|Q9HPS3|RL37_HALN1 50S ribosomal protein L37e.>pir|F84303|F84303
           50S ribosomal protein L37E [imported] - Halobacterium
           sp. NRC-1>gb:AE005064_62954 Halobacterium sp. NRC-1
           section 95 of 170 of the complete
           genome.>gb:AE004437_887873 Halobacterium sp. NRC-1
           complete genome.
          Length = 58

 Score = 55.1 bits (131), Expect = 8e-07
 Identities = 25/52 (48%), Positives = 32/52 (61%), Gaps = 1/52 (1%)
 Frame = +2

Query: 56  GKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAYPA-ARIRKYNWSVK 208
           G GT S GK+   THT C RCG +S+H +K  CS+C + A A+ R Y W  K
Sbjct: 3   GAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGASAKRRDYEWQGK 54



>sp|Q8PZZ8|RL37_METMA 50S ribosomal protein L37e.>gb:AE013259_290670
           Methanosarcina mazei strain Goe1, section 41 of 379 of
           the complete genome.>gb:AE008384_964779 Methanosarcina
           mazei strain Goe1, complete genome.
          Length = 56

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 1/53 (1%)
 Frame = +2

Query: 53  MGKGTGSFGKRRNKTHTLCVRCGRRSFHIQKSRCSACAY-PAARIRKYNWSVK 208
           M KGT S GKR+ +TH  C RCG  S ++   +C++C +   +R+R Y W  K
Sbjct: 1   MSKGTASMGKRQKRTHAKCRRCGSVSLNVHTKQCTSCGFGKTSRMRTYKWQAK 53



>sp|O29387|RL37_ARCFU 50S ribosomal protein L37e.>pir|B69359|B69359
           LSU ribosomal protein L37E (rpl37E) homolog -
           Archaeoglobus fulgidus>gb:AE001044_31038 Archaeoglobus
           fulgidus DSM 4304 section 63 of 172 of the complete
           genome.>gb:AE000782_974764 Archaeoglobus fulgidus DSM
           4304 complete genome.
          Length = 59

 Score = 54.3 bits (129), Expect = 1e-06
 Identities = 27/63 (42%), Positives = 37/63 (58%), Gaps = 2/63 (3%)
 Frame = +2

Query: 53  MGKGTGSFGKR-RNKTHTLCVRCGRRSFHIQKSRCSACAY-PAARIRKYNWSVKAIRRKT 226
           M  GT + GK+ R + H  C RCGR SFH +K  C+AC +  + R+R YNW    +R+K 
Sbjct: 1   MSDGTAAMGKKGRKRVHIRCRRCGRHSFHRRKGYCAACGFGRSKRLRSYNW----VRKKK 56

Query: 227 TGT 235
             T
Sbjct: 57  NRT 59



>gb:BX957222_844400 Methanococcus maripaludis S2 complete genome;
           segment 4/5.
          Length = 64

 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 27/64 (42%), Positives = 40/64 (62%), Gaps = 2/64 (3%)
 Frame = +2

Query: 53  MGKGTGSFGKR-RNKTHTLCVRCGRRSFHIQKSRCSACAY-PAARIRKYNWSVKAIRRKT 226
           M KGT S GK  +   H +C RCGRR+FH++K  C+AC +  +++I+++ W  K    K 
Sbjct: 1   MTKGTPSQGKHNKGSNHIVCRRCGRRAFHVRKKVCAACGFGRSSKIKRFAWQWK----KV 56

Query: 227 TGTG 238
           TG G
Sbjct: 57  TGKG 60



>sp|Q97ZQ1|RL37_SULSO 50S ribosomal protein L37e.>pir|E90224|E90224
           lSU ribosomal protein L37E (rpl37E) [imported] -
           Sulfolobus solfataricus>gb:AE006699_221650 Sulfolobus
           solfataricus P2 section 58 of 272 of the complete
           genome.>gb:AE006641_1107498 Sulfolobus solfataricus P2,
           complete genome.
          Length = 61

 Score = 52.0 bits (123), Expect = 7e-06
 Identities = 23/54 (42%), Positives = 35/54 (64%), Gaps = 2/54 (3%)
 Frame = +2

Query: 59  KGTGSFGK-RRNKTHTLCVRCGRRSFHIQKSRCSACAY-PAARIRKYNWSVKAI 214
           KGT SFGK  ++ TH  C RCGR ++++ K  C+AC +    +IR+Y+W  K +
Sbjct: 2   KGTPSFGKMNKSHTHIRCRRCGRNAYNVSKHYCAACGFGRTKKIRRYSWQNKKV 55



>gb:AB007183_1863948 Homo sapiens gene for ribosomal protein L37,
           partial cds.
          Length = 27

 Score = 43.5 bits (101), Expect = 0.002
 Identities = 20/27 (74%), Positives = 22/27 (81%)
 Frame = +2

Query: 194 NWSVKAIRRKTTGTGRMRYLRNVPRRF 274
           NWS KA RR TTGTGRMR+L+ V RRF
Sbjct: 1   NWSAKAKRRNTTGTGRMRHLKIVYRRF 27



>gb:AB012247_1511820 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MSL1.
          Length = 123

 Score = 42.0 bits (97), Expect = 0.007
 Identities = 18/39 (46%), Positives = 25/39 (64%)
 Frame = +1

Query: 133 PYPEEPVFRLCLSCCTH*KI*LECQGN*EKDYWNWPHEV 249
           P+PEE +  LCL  C+   + LEC+G+ E+DYW    EV
Sbjct: 26  PHPEESLLGLCLPSCSQEDLQLECEGHQEEDYWYRKDEV 64



>gb:AY463611_1607700 Arabidopsis thaliana mutant TFIIF-alpha
           (TFIIF-alpha) mRNA, partial cds.
          Length = 640

 Score = 33.9 bits (76), Expect = 1.9
 Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +2

Query: 101 TLCVRCGRRSFHIQKSRCSACAYPAAR-IRKYNWSVKAIRRKTTGTGRMRYLRNVPRRFK 277
           TLC++CG R+    KS+C  C     R IR+YN    A   K    G  R++  +P    
Sbjct: 29  TLCLKCG-RTMAQNKSKCHECGTVVTRLIREYNVRAAAPTDKNYFIG--RFVTGLP---- 81

Query: 278 TNFREGTE 301
            NF++G+E
Sbjct: 82  -NFKKGSE 88



>pir|D85135|D85135 hypothetical protein AT4g12610 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV34_1545026 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           34.>gb:ATT1P17_1554924 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T1P17 (ESSA project).
          Length = 649

 Score = 33.9 bits (76), Expect = 1.9
 Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +2

Query: 101 TLCVRCGRRSFHIQKSRCSACAYPAAR-IRKYNWSVKAIRRKTTGTGRMRYLRNVPRRFK 277
           TLC++CG R+    KS+C  C     R IR+YN    A   K    G  R++  +P    
Sbjct: 29  TLCLKCG-RTMAQNKSKCHECGTVVTRLIREYNVRAAAPTDKNYFIG--RFVTGLP---- 81

Query: 278 TNFREGTE 301
            NF++G+E
Sbjct: 82  -NFKKGSE 88



>pir|S10052|S10052 ribosomal protein L37.e - fission yeast
           (Schizosaccharomyces pombe) (fragment)
          Length = 28

 Score = 33.9 bits (76), Expect = 1.9
 Identities = 16/29 (55%), Positives = 21/29 (72%)
 Frame = +2

Query: 59  KGTGSFGKRRNKTHTLCVRCGRRSFHIQK 145
           KGT SFG R +K+HT+  R G+  FH+QK
Sbjct: 2   KGTZSFGMRHBKSHTIGRRKGK--FHVQK 28



>sp|Q9F495|OPGH_ERWCH Glucans biosynthesis glucosyltransferase H (EC
           2.4.1.-).>gb:ECH294718_125843 Erwinia chrysanthemi opgG
           gene and opgH gene.
          Length = 850

 Score = 33.9 bits (76), Expect = 1.9
 Identities = 24/78 (30%), Positives = 36/78 (46%), Gaps = 3/78 (3%)
 Frame = -2

Query: 249 YLMRPVPVVFLLIALTLQLYFLMRAAG*AQAEHRLFWIWKLRRPHLT---HSVCVLFLRL 79
           YL  P+  +FL ++  LQ+   +          +LF +W   RP L     S  ++ L L
Sbjct: 530 YLSAPLWFMFLALSTALQVVHTLMEPQYFLQPRQLFPVWPQWRPELAIALFSTTLVLLFL 589

Query: 78  PKLPVPFPICAAEAKNPG 25
           PKL     +CA  AK+ G
Sbjct: 590 PKLLSVILVCAKGAKSYG 607



>gb:AF254792_2482686 Danio rerio Period3 circadian clock protein
           (Per3) mRNA, complete cds.
          Length = 1281

 Score = 33.5 bits (75), Expect = 2.5
 Identities = 18/43 (41%), Positives = 24/43 (55%)
 Frame = -3

Query: 155 NTGSSGYGSCGGRISHIVYVSCSSAYQNFRYLFPFAQRRRKTL 27
           N GSSGYGS G   SH  Y+S +S+  +   L+  + R   TL
Sbjct: 522 NNGSSGYGSLGSNGSHEHYISVASSSDSNGNLWEDSHRETMTL 564



>gb:ATAC011623_1543314 Arabidopsis thaliana chromosome III BAC F24P17
            genomic sequence, complete sequence.
          Length = 1088

 Score = 32.3 bits (72), Expect = 5.5
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 3/57 (5%)
 Frame = +2

Query: 41   SAAQMGKGTGSFGKRRNKTHTLC---VRCGRRSFHIQKSRCSACAYPAARIRKYNWS 202
            S    G+G G F  RR ++ +     VR  RRS    +SR  + +Y  +R R  +WS
Sbjct: 936  SGRGFGRGVGRFDNRRGRSRSRSPDLVRPRRRSSSYSRSRSRSGSYSRSRSRSRSWS 992



>pir|A84512|A84512 hypothetical protein At2g13920 [imported] -
           Arabidopsis thaliana>gb:AC006218_1533636 Arabidopsis
           thaliana chromosome 2 clone F17L24 map GPC6, complete
           sequence.>gb:AC006528_1534348 Arabidopsis thaliana
           chromosome 2 clone F9B22 map mi398, complete sequence.
          Length = 533

 Score = 32.3 bits (72), Expect = 5.5
 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 1/37 (2%)
 Frame = +1

Query: 73  FW*A-EEQDTYTMCEMRPPQLPYPEEPVFRLCLSCCT 180
           FW   EE D Y  CE+   Q+ Y  E  F  C  CCT
Sbjct: 424 FWEGKEESDQYGWCEVCENQIVYSREDGFYACDDCCT 460



>gb:CR382134_1667453 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 1140

 Score = 32.0 bits (71), Expect = 7.2
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 4/57 (7%)
 Frame = +2

Query: 80  KRRNKTHTLCVRCGRRSFHIQKSR-CSACAYPAARIR---KYNWSVKAIRRKTTGTG 238
           +RRN+   +C  C +R     K R CS C            YNW +K  +R ++ TG
Sbjct: 11  RRRNRPSLVCNACRQRKIKCNKGRPCSGCVKNKIEHLCKYDYNWPIKKKQRTSSTTG 67



>gb:AB020711_1865309 Homo sapiens mRNA for KIAA0904 protein, partial
           cds.
          Length = 1535

 Score = 31.6 bits (70), Expect = 9.4
 Identities = 29/111 (26%), Positives = 46/111 (41%), Gaps = 1/111 (0%)
 Frame = +2

Query: 8   YCELQKPGFFASAAQMGKGTGSFGKRRNKTHTLCVRCGRRS-FHIQKSRCSACAYPAARI 184
           Y   +   +  S +  G+    +G+RR+ +  L  R   RS    +KS  S    PA   
Sbjct: 359 YSRRRSSSYERSGSYSGRSPSPYGRRRSSSPFLSKRSLSRSPLPSRKSMKSRSRSPA--- 415

Query: 185 RKYNWSVKAIRRKTTGTGRMRYLRNVPRRFKTNFREGTEATPRKKGAAAAS 337
             Y+    +  +K   + R R+    P R   N   G E + +KK  AAA+
Sbjct: 416 --YSRHSSSHSKKKRSSSRSRHSSISPVRLPLNSSLGAELSRKKKERAAAA 464



>pir|S67050|S67050 probable membrane protein YOR162c - yeast
           (Saccharomyces cerevisiae)>gb:AY692760_1622807
           Saccharomyces cerevisiae clone FLH113061.01X YOR162C
           gene, complete cds.>gb:SCU55021_1710493 Saccharomyces
           cerevisiae cosmid pUOA1258 from chromosome
           15R.>gb:SCYOR162C_1714394 S.cerevisiae chromosome XV
           reading frame ORF YOR162c.
          Length = 810

 Score = 31.6 bits (70), Expect = 9.4
 Identities = 17/44 (38%), Positives = 21/44 (47%), Gaps = 2/44 (4%)
 Frame = +2

Query: 38  ASAAQMGKGTGSFGKRRNKTHTLCVRCGRRSFHI--QKSRCSAC 163
           A+ +  G  T + GK+RNK    C  C RR      QK  CS C
Sbjct: 31  ANGSNSGTPTSTSGKKRNKLIKSCGFCRRRKLRCDQQKPMCSTC 74



>sp|Q9NYV4|CRK7_HUMAN Cell division cycle 2-related protein kinase 7
           (EC 2.7.1.37) (CDC2- related protein kinase 7)
           (CrkRS).>gb:AF227198_1891524 Homo sapiens CrkRS mRNA,
           complete cds.
          Length = 1490

 Score = 31.6 bits (70), Expect = 9.4
 Identities = 29/111 (26%), Positives = 46/111 (41%), Gaps = 1/111 (0%)
 Frame = +2

Query: 8   YCELQKPGFFASAAQMGKGTGSFGKRRNKTHTLCVRCGRRS-FHIQKSRCSACAYPAARI 184
           Y   +   +  S +  G+    +G+RR+ +  L  R   RS    +KS  S    PA   
Sbjct: 305 YSRRRSSSYERSGSYSGRSPSPYGRRRSSSPFLSKRSLSRSPLPSRKSMKSRSRSPA--- 361

Query: 185 RKYNWSVKAIRRKTTGTGRMRYLRNVPRRFKTNFREGTEATPRKKGAAAAS 337
             Y+    +  +K   + R R+    P R   N   G E + +KK  AAA+
Sbjct: 362 --YSRHSSSHSKKKRSSSRSRHSSISPVRLPLNSSLGAELSRKKKERAAAA 410


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 555,067,530
Number of Sequences: 1806583
Number of extensions: 10483778
Number of successful extensions: 26601
Number of sequences better than 10.0: 88
Number of HSP's better than 10.0 without gapping: 25910
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26587
length of database: 581,917,975
effective HSP length: 118
effective length of database: 368,741,181
effective search space used: 26918106213
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)