BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig5760
         (691 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:LTU73106_1685432 Liriodendron tulipifera high-pI laccase (LAC...   324   8e-88   
gb:LTU73104_1685430 Liriodendron tulipifera high-pI laccase (LAC...   321   9e-87   
gb:LTU73105_1685431 Liriodendron tulipifera high-pI laccase (LAC...   315   4e-85   
gb:AB015475_1512594 Arabidopsis thaliana genomic DNA, chromosome...   311   9e-84   
gb:PTY13773_1702846 Populus trichocarpa mRNA for laccase, lac110...   301   5e-81   
gb:AF132123_1770857 Pinus taeda laccase (Lac5) mRNA, complete cds.    299   4e-80   
gb:AF132121_1770855 Pinus taeda laccase (Lac3) mRNA, complete cds.    298   6e-80   
gb:AP003240_1826031 Oryza sativa (japonica cultivar-group) genom...   298   8e-80   
pir|T02743|T02743 laccase (EC 1.10.3.2) At2g29130 - Arabidopsis ...   294   1e-78   Arabidopsis thaliana [mouse-ear cress]
gb:AF548614_1810733 Lolium perenne laccase LAC11 mRNA, partial cds.   292   3e-78   
gb:AF465468_1802143 Lolium perenne laccase LAC5-6 mRNA, complete...   290   1e-77   
gb:AF132124_1770858 Pinus taeda laccase (Lac6) mRNA, complete cds.    290   2e-77   
gb:LTU73103_1685429 Liriodendron tulipifera high-pI laccase (LAC...   289   4e-77   
gb:AF132119_1770853 Pinus taeda laccase (Lac1) mRNA, complete cds.    287   1e-76   
gb:AP003240_1826033 Oryza sativa (japonica cultivar-group) genom...   287   1e-76   
gb:AF047697_1763911 Oryza sativa putative high-pI laccase mRNA, ...   284   1e-75   
pir|T02752|T02752 probable laccase (EC 1.10.3.2) - rice (fragment)    284   1e-75   Oryza sativa Japonica Group [Japonica rice]
gb:AP003240_1826045 Oryza sativa (japonica cultivar-group) genom...   281   6e-75   
gb:AF132126_1770860 Pinus taeda laccase (Lac8) mRNA, complete cds.    281   8e-75   
gb:AF132125_1770859 Pinus taeda laccase (Lac7) mRNA, complete cds.    270   2e-71   
pir|JC5229|JC5229 laccase (EC 1.10.3.2) precursor - common tobac...   269   4e-71   Nicotiana tabacum [American tobacco]
gb:AC003028_1530965 Arabidopsis thaliana chromosome 2 clone F16M...   260   2e-68   
pir|T01240|T01240 laccase (EC 1.10.3.2) F16M14.1 - Arabidopsis t...   260   2e-68   Arabidopsis thaliana [mouse-ear cress]
gb:BT014855_1641845 Arabidopsis thaliana At5g01190 gene, complet...   251   7e-66   
pir|T45959|T45959 laccase-like protein - Arabidopsis thaliana>gb...   251   7e-66   Arabidopsis thaliana [mouse-ear cress]
gb:AY065128_1566282 Arabidopsis thaliana laccase (diphenol oxida...   245   6e-64   
pir|T48347|T48347 laccase-like protein F15A17.290 [similarity] -...   245   6e-64   Arabidopsis thaliana [mouse-ear cress]
gb:AP004317_1840132 Oryza sativa (japonica cultivar-group) genom...   241   7e-63   
gb:PTY13771_1702844 Populus trichocarpa mRNA for laccase, lac3 g...   239   3e-62   
gb:PTR18218_1702693 Populus trichocarpa GLac3 gene.                   239   3e-62   
gb:AP003734_1832581 Oryza sativa (japonica cultivar-group) genom...   230   2e-59   
pir|F84828|F84828 probable laccase (diphenol oxidase) [imported]...   223   2e-57   Arabidopsis thaliana [mouse-ear cress]
gb:AF132120_1770854 Pinus taeda laccase (Lac2) mRNA, complete cds.    222   4e-57   
gb:T10F20_1723317 Sequence of BAC T10F20 from Arabidopsis thalia...   221   9e-57   
gb:AC105770_1738222 Oryza sativa (japonica cultivar-group) chrom...   219   3e-56   
gb:AB010692_1511112 Arabidopsis thaliana genomic DNA, chromosome...   218   8e-56   
gb:AF132122_1770856 Pinus taeda laccase (Lac4) mRNA, complete cds.    218   1e-55   
gb:PTR18219_1702694 Populus trichocarpa GLac90 gene.>gb:PTY13772...   213   3e-54   
gb:AY113187_1578253 Glycine max diphenol oxidase laccase mRNA, c...   213   3e-54   
pir|E86316|E86316 protein T10O22.11 [imported] - Arabidopsis tha...   212   4e-54   Arabidopsis thaliana [mouse-ear cress]
gb:ATAC011436_1543241 Arabidopsis thaliana chromosome III BAC F3...   212   6e-54   
pir|T00579|T00579 probable laccase [imported] - Arabidopsis thal...   209   4e-53   Arabidopsis thaliana [mouse-ear cress]
pir|E84904|E84904 probable laccase (diphenol oxidase) [imported]...   209   4e-53   Arabidopsis thaliana [mouse-ear cress]
gb:AP004774_1844827 Oryza sativa (japonica cultivar-group) genom...   206   2e-52   
gb:AY464022_1607883 Zea mays genotype B73 laccase 1 (Lac1) gene,...   206   2e-52   
gb:AY464017_1607878 Zea mays genotype Wis93-3520 laccase 1 (Lac1...   206   3e-52   
gb:AY464016_1607877 Zea mays genotype W117 laccase 1 (Lac1) gene...   206   3e-52   
gb:ATT5E8_1556131 Arabidopsis thaliana DNA chromosome 5, BAC clo...   206   4e-52   
gb:BT002919_1636509 Arabidopsis thaliana clone RAFL15-04-D21 (R2...   190   2e-47   
pir|T48484|T48484 laccase-like protein - Arabidopsis thaliana>gb...   190   2e-47   Arabidopsis thaliana [mouse-ear cress]
gb:AP003199_1825016 Oryza sativa (japonica cultivar-group) genom...   189   3e-47   
gb:AP003242_1826097 Oryza sativa (japonica cultivar-group) genom...   189   5e-47   
gb:AP003242_1826096 Oryza sativa (japonica cultivar-group) genom...   189   5e-47   
gb:AP003242_1826095 Oryza sativa (japonica cultivar-group) genom...   187   1e-46   
gb:AF465470_1802145 Lolium perenne laccase LAC5-4 mRNA, complete...   187   1e-46   
gb:AB062449_1522121 Rhus vernicifera mRNA for laccase, partial cds.   185   6e-46   
gb:APU12757_1541984 Acer pseudoplatanus laccase mRNA, complete cds.   184   1e-45   
gb:AB083127_1524161 Rhus vernicifera lac2 mRNA for laccase2, par...   184   1e-45   
gb:AP004072_1837291 Oryza sativa (japonica cultivar-group) genom...   179   3e-44   
gb:AP005869_1859329 Oryza sativa (japonica cultivar-group) genom...   176   3e-43   
gb:AY423714_1605485 Gossypium arboreum secretory laccase (Lac1) ...   173   3e-42   
gb:AK117360_1815399 Arabidopsis thaliana At5g01040 mRNA for puta...   172   5e-42   
pir|T45944|T45944 laccase-like protein - Arabidopsis thaliana>gb...   172   5e-42   Arabidopsis thaliana [mouse-ear cress]
pir|T45945|T45945 laccase-like protein - Arabidopsis thaliana>gb...   171   1e-41   Arabidopsis thaliana [mouse-ear cress]
gb:AF465466_1802141 Lolium perenne laccase LAC6-2 mRNA, partial ...   153   2e-36   
gb:AF465469_1802144 Lolium perenne laccase LAC2-1 mRNA, complete...   145   9e-34   
gb:AB017064_1513362 Arabidopsis thaliana genomic DNA, chromosome...   141   1e-32   
gb:AY645934S3_1619833 Ginkgo biloba laccase-like multicopper oxi...   135   5e-31   
gb:AY645907S3_1619823 Pinus taeda laccase-like multicopper oxida...   132   8e-30   
gb:AY645937S3_1619834 Pinus taeda laccase-like multicopper oxida...   131   1e-29   
gb:AF465467_1802142 Lolium perenne laccase LAC6-8 mRNA, partial ...   129   6e-29   
gb:AY645915S3_1619826 Arabis procurrens laccase-like multicopper...   126   3e-28   
gb:AE016959_1022755 Oryza sativa (japonica cultivar-group) chrom...   119   7e-26   
pir|A36962|A36962 laccase (EC 1.10.3.2) precursor - fungus (Filo...   114   2e-24   Cryptococcus neoformans
gb:AE017347_1757755 Cryptococcus neoformans var. neoformans JEC2...   113   3e-24   
gb:AB083032_1524145 Glycine max mRNA for syringolide-induced pro...   112   5e-24   
gb:AY532149_1612046 Phanerochaete chrysosporium strain BKM-1767 ...   110   2e-23   
gb:PTY13770_1702843 Populus trichocarpa mRNA for laccase, lac2 g...   108   9e-23   
gb:AY532152_1612049 Phanerochaete chrysosporium strain BKM-1767 ...   107   2e-22   
gb:AY532150_1612047 Phanerochaete chrysosporium strain BKM-1767 ...   107   2e-22   
gb:AY645929S3_1619831 Brassica napus laccase-like multicopper ox...   106   3e-22   
pir|T05020|T05020 L-ascorbate oxidase (EC 1.10.3.3) - Arabidopsi...   105   1e-21   Arabidopsis thaliana [mouse-ear cress]
gb:AY645940S3_1619835 Arabis procurrens laccase-like multicopper...   104   1e-21   
gb:AY839937_1630505 Trametes sp. AH28-2 laccase C (lacC) gene, p...   104   2e-21   
gb:AF233594_1779470 Cucumis melo ascorbate oxidase AO4 mRNA, com...   103   4e-21   
gb:AY817108_1628701 Cryptococcus neoformans var. grubii LAC2 iso...   102   6e-21   
sp|Q02079|LAC3_THACU|LAC3_THACU Laccase 3 precursor (EC 1.10.3.2) (Benzened...   102   6e-21   Thanatephorus cucumeris [black scurf of potato]
gb:AP005458_1852214 Oryza sativa (japonica cultivar-group) genom...   102   8e-21   
gb:AF206722_1776765 Brassica juncea isolate BJAO2 ascorbate oxid...   102   8e-21   
gb:AB004799_1509184 Oryza sativa mRNA for ascorbate oxidase, par...   102   8e-21   
pir|T04343|T04343 L-ascorbate oxidase (EC 1.10.3.3) - rice (frag...   102   8e-21   Oryza sativa [red rice]
gb:AP005458_1852204 Oryza sativa (japonica cultivar-group) genom...   101   1e-20   
gb:PGU65399_1700032 Basidiomycete CECT 20197 phenoloxidase (pox1...   100   2e-20   
gb:CMAO3_1647984 C.melo ao3 gene.                                     100   2e-20   
gb:AY532141_1612038 Phanerochaete chrysosporium strain RP-78 mul...   100   2e-20   
gb:AY532139_1612036 Phanerochaete chrysosporium strain RP-78 mul...   100   2e-20   
gb:AP005422_1851586 Oryza sativa (japonica cultivar-group) genom...   100   2e-20   
gb:AF206723_1776766 Brassica juncea isolate BJAO3 ascorbate oxid...   100   2e-20   
gb:AF104823_1768268 Aspergillus fumigatus brown 2 (abr2) gene, c...   100   2e-20   
sp|P56193|LAC1_THACU|LAC1_THACU Laccase 1 precursor (EC 1.10.3.2) (Benzened...   100   2e-20   Thanatephorus cucumeris [black scurf of potato]
gb:AF548033_1810718 Trametes sp. I-62 laccase (pox1) mRNA, pox1-...   100   3e-20   
gb:AF548032_1810717 Trametes sp. I-62 laccase (pox1) mRNA, compl...   100   3e-20   
gb:AY846842_1630734 Trametes sp. AH28-2 laccase B (lacB) gene, c...   100   4e-20   
pir|S68118|S68118 laccase (EC 1.10.3.2) 2 precursor [validated] ...   100   4e-20   Thanatephorus cucumeris [black scurf of potato]
sp|Q02075|LAC2_THACU|LAC2_THACU Laccase 2 precursor (EC 1.10.3.2) (Benzened...   100   4e-20   Thanatephorus cucumeris [black scurf of potato]
sp|P14133|ASO_CUCSA|ASO_CUCSA L-ascorbate oxidase precursor (EC 1.10.3.3) ...   100   4e-20   Cucumis sativus [cucumbers]
sp|P37064|ASO_CUCPM|ASO_CUCPM L-ascorbate oxidase (EC 1.10.3.3) (Ascorbase...   100   4e-20   Cucurbita pepo var. melopepo
gb:AF176232_1774555 Polyporus ciliatus laccase (lcc3-3) mRNA, pa...    99   7e-20   
gb:AB004798_1509183 Arabidopsis thaliana mRNA for ascorbate oxid...    99   7e-20   
pir|T44928|T44928 L-ascorbate oxidase (EC 1.10.3.3) [imported] -...    99   7e-20   Arabidopsis thaliana [mouse-ear cress]
sp|Q99055|LAC4_TRAVI|LAC4_TRAVI Laccase 4 precursor (EC 1.10.3.2) (Benzened...    99   7e-20   Trametes villosa
sp|Q12719|LAC4_TRAVE|LAC4_TRAVE Laccase 4 precursor (EC 1.10.3.2) (Benzened...    99   7e-20   Trametes versicolor
sp|P24792|ASO_CUCMA|ASO_CUCMA L-ascorbate oxidase precursor (EC 1.10.3.3) ...    98   1e-19   Cucurbita maxima [Boston marrow]
gb:AF233593_1779469 Cucumis melo ascorbate oxidase AO1 mRNA, com...    98   2e-19   
gb:AY485825_1608502 Ganoderma lucidum laccase gene, complete cds...    98   2e-19   
pir|S11027|S11027 L-ascorbate oxidase (EC 1.10.3.3) precursor - ...    97   2e-19   Cucurbita maxima [Boston marrow]
sp|Q12717|LAC5_TRAVE|LAC5_TRAVE Laccase 5 precursor (EC 1.10.3.2) (Benzened...    97   4e-19   Trametes versicolor
gb:AF414808_1797636 Trametes pubescens laccase 1A (lap1A) gene, ...    96   6e-19   
gb:D84235_1674851 Coriolus versicolor gene for laccase, complete...    96   6e-19   
gb:AY099586_1576612 Arabidopsis thaliana ascorbate oxidase-like ...    96   6e-19   
sp|Q99056|LAC5_TRAVI|LAC5_TRAVI Laccase 5 precursor (EC 1.10.3.2) (Benzened...    96   6e-19   Trametes villosa
gb:AF548035_1810720 Trametes sp. I-62 laccase (pox3) mRNA, compl...    96   8e-19   
gb:AF243855_1780276 Botryotinia fuckeliana laccase 2 (lcc2) gene...    96   8e-19   
gb:AF123571_1769926 Pycnoporus cinnabarinus laccase (lcc3-2) gen...    96   8e-19   
gb:PGU65401_1700034 Basidiomycete CECT 20197 phenoloxidase (pox3...    96   8e-19   
gb:AY458017_1607237 Pycnoporus sanguineus laccase mRNA, complete...    96   8e-19   
gb:AY049725_1562065 Trametes versicolor laccase 1 (lac1) mRNA, c...    95   1e-18   
pir|H86351|H86351 protein T26F17.6 [imported] - Arabidopsis thal...    95   1e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AF206721_1776764 Brassica juncea isolate BJAO1 ascorbate oxid...    95   1e-18   
gb:AF176230_1774553 Polyporus ciliatus laccase (lcc3-1) mRNA, co...    95   1e-18   
gb:MTY15295_1687715 Medicago truncatula mRNA for L-ascorbate oxi...    95   1e-18   
gb:AY676426_1621957 Lentinula edodes laccase 2 VT (LAC2) mRNA, c...    95   1e-18   
gb:AY532147_1612044 Phanerochaete chrysosporium strain BKM-1767 ...    95   1e-18   
gb:AY532142_1612039 Phanerochaete chrysosporium strain BKM-1767 ...    95   1e-18   
gb:AF548034_1810719 Trametes sp. I-62 laccase (pox2) mRNA, compl...    94   2e-18   
gb:PGU65400_1700033 Basidiomycete CECT 20197 phenoloxidase (pox2...    94   2e-18   
gb:AY532148_1612045 Phanerochaete chrysosporium strain BKM-1767 ...    94   2e-18   
gb:AY532146_1612043 Phanerochaete chrysosporium strain BKM-1767 ...    94   2e-18   
gb:AY450406_1606654 Flammulina velutipes laccase mRNA, complete ...    94   2e-18   
gb:AY338484_1600485 Volvariella volvacea laccase 3 (lac3) mRNA, ...    94   2e-18   
pir|S68120|S68120 laccase (EC 1.10.3.2) 4 precursor - Rhizoctoni...    94   2e-18   Thanatephorus cucumeris [black scurf of potato]
sp|Q02081|LAC4_THACU|LAC4_THACU Laccase 4 precursor (EC 1.10.3.2) (Benzened...    94   2e-18   Thanatephorus cucumeris [black scurf of potato]
gb:AY839938_1630506 Trametes sp. AH28-2 laccase D (lacD) gene, p...    94   2e-18   
gb:AE005172_891135 Arabidopsis thaliana chromosome 1, top arm co...    94   2e-18   
sp|Q12718|LAC2_TRAVE|LAC2_TRAVE Laccase 2 precursor (EC 1.10.3.2) (Benzened...    94   2e-18   Trametes versicolor
gb:TVU44430_1726159 Trametes versicolor laccase I (lccI) mRNA, c...    94   3e-18   
gb:AY693776_1623449 Trametes versicolor laccase 1 (lcc1) mRNA, c...    94   3e-18   
gb:AY338487_1600488 Volvariella volvacea laccase 6 (lac6) mRNA, ...    94   3e-18   
gb:AX384796_1466759 Sequence 1 from Patent WO0196543.                  94   3e-18   
gb:POAJ5017_1700933 Pleurotus ostreatus poxA1b gene for laccase....    93   4e-18   
gb:CRILIPHA_1673420 C.hirsutus ligninolytic phenoloxidase gene, ...    93   4e-18   
gb:AY532144_1612041 Phanerochaete chrysosporium strain BKM-1767 ...    93   4e-18   
gb:AY050406_1562183 Arabidopsis thaliana AT5g21100/T10F18_130 mR...    93   4e-18   
gb:AY017340_1558844 Coriolopsis gallica laccase (lcc1) gene, com...    93   4e-18   
gb:AB072704_1523107 Pycnoporus coccineus lcc1 gene for laccase, ...    93   4e-18   
gb:AB072703_1523106 Pycnoporus coccineus lcc1 mRNA for laccase, ...    93   4e-18   
gb:AB035409_1518943 Lentinula edodes LeLcc1 mRNA for laccase 1, ...    93   4e-18   
pir|B35883|B35883 ligninolytic phenoloxidase (EC 1.10.-.-) 2 pre...    93   4e-18   Trametes versicolor
sp|Q02497|LAC1_TRAHI|LAC1_TRAHI Laccase precursor (EC 1.10.3.2) (Benzenedio...    93   4e-18   Trametes hirsuta
gb:AF176231_1774554 Polyporus ciliatus laccase (lcc3-2) mRNA, co...    93   5e-18   
gb:AY081188_1568591 Trametes versicolor laccase III gene, comple...    93   5e-18   
gb:AX741023_1473884 Sequence 1 from Patent EP1300469.                  93   5e-18   
pir|T05545|T05545 pollen-specific protein homolog F24A6.80 - Ara...    93   5e-18   Arabidopsis thaliana [mouse-ear cress]
sp|Q8VXX5|SKS1_ARATH|SKS1_ARATH Monocopper oxidase-like protein SKS1 precur...    93   5e-18   Arabidopsis thaliana [mouse-ear cress]
sp|Q40588|ASO_TOBAC|ASO_TOBAC L-ascorbate oxidase precursor (EC 1.10.3.3) ...    93   5e-18   Nicotiana tabacum [American tobacco]
gb:AF162785_1773540 Basidiomycete C30 polyphenoloxidase (LAC1) g...    92   7e-18   
gb:TTR294820_1726067 Trametes trogii lcc1 gene for laccase, exon...    92   7e-18   
gb:BLACCASEG_1633076 Basidiomycete gene for laccase.                   92   7e-18   
gb:AY839936_1630504 Trametes sp. AH28-2 laccase A (lacA) gene, c...    92   7e-18   
gb:AY081775_1569011 Coriolus hirsutus laccase (072-1) mRNA, comp...    92   7e-18   
gb:D13372_1674465 Coriolus versicolor CVL3 gene for laccase, com...    92   9e-18   
gb:AY645912S3_1619825 Acer pseudoplatanus laccase-like multicopp...    92   9e-18   
sp|Q9SU40|SKU5_ARATH|SKU5_ARATH Putative monocopper oxidase precursor (Skew...    92   9e-18   Arabidopsis thaliana [mouse-ear cress]
sp|Q99046|LAC2_TRAVI|LAC2_TRAVI Laccase 2 precursor (EC 1.10.3.2) (Benzened...    92   9e-18   Trametes villosa
gb:AF414109_1797600 Trametes versicolor laccase B precursor (lac...    92   1e-17   
pir|JC5355|JC5355 laccase (EC 1.10.3.2) 3 precursor - white-rot ...    92   1e-17   Trametes villosa
sp|Q99049|LAC3_TRAVI|LAC3_TRAVI Laccase 3 precursor (EC 1.10.3.2) (Benzened...    92   1e-17   Trametes villosa
sp|Q99044|LAC1_TRAVI|LAC1_TRAVI Laccase 1 precursor (EC 1.10.3.2) (Benzened...    92   1e-17   Trametes villosa
gb:AF414807_1797635 Trametes pubescens laccase 2 (lap2) gene, co...    91   1e-17   
gb:AY532143_1612040 Phanerochaete chrysosporium strain BKM-1767 ...    91   1e-17   
gb:TVE18012_1726126 Trametes versicolor mRNA for laccase.              91   2e-17   
gb:AY338761_1600497 Coprinopsis cinerea strain AmutBmut laccase ...    91   2e-17   
gb:PSA507326_1702004 Pleurotus sajor-caju mRNA for laccase 3 (la...    91   3e-17   
gb:AY817107_1628700 Cryptococcus neoformans var. grubii LAC2 iso...    91   3e-17   
gb:AY225437_1590895 Phanerochaete chrysosporium extracellular mu...    91   3e-17   
gb:AF491760_1804875 Basidiomycete C30 laccase 2 (lac2) gene, com...    90   3e-17   
gb:AY839942_1630510 Trametes sp. 420 laccase D (lacD) gene, comp...    90   3e-17   
gb:AY397783_1605112 Trametes sp. C30 laccase (lac3) mRNA, comple...    90   3e-17   
gb:AY219235_1590357 Ceriporiopsis subvermispora laccase 1 (lcs-1...    90   3e-17   
gb:AY839935_1630503 Panus rudis laccase A (lacA) gene, complete ...    90   4e-17   
pir|S18746|S18746 laccase (EC 1.10.3.2) - basidiomycete (Phlebia...    90   4e-17   Phlebia radiata
sp|Q01679|LAC1_PHLRA|LAC1_PHLRA Laccase precursor (EC 1.10.3.2) (Benzenedio...    90   4e-17   Phlebia radiata
gb:AY532151_1612048 Phanerochaete chrysosporium strain BKM-1767 ...    89   6e-17   
gb:AY439331_1606314 Panus rudis laccase mRNA, partial cds.             89   6e-17   
gb:AY338485_1600486 Volvariella volvacea laccase 5 (lac5) mRNA, ...    89   6e-17   
gb:AP004262_1839337 Oryza sativa (japonica cultivar-group) genom...    89   7e-17   
gb:POS344434_1701040 Pleurotus ostreatus poxa3 gene for laccase.       89   7e-17   
gb:AY875867_1631877 Coriolopsis gallica laccase (lacA) mRNA, par...    89   7e-17   
gb:AY365228_1602878 Rigidoporus microporus laccase (lcc) mRNA, c...    89   7e-17   
gb:AY167042_1586241 Rigidoporus microporus laccase (lcc) gene, c...    89   7e-17   
gb:AY338483_1600484 Volvariella volvacea laccase 2 (lac2) mRNA, ...    89   1e-16   
gb:AB006824_1193048 Trachyderma tsunodae mRNA for Bilirubin Oxid...    89   1e-16   
gb:AP003723_1832421 Oryza sativa (japonica cultivar-group) genom...    88   1e-16   
gb:AF152170_1772728 Pycnoporus cinnabarinus laccase (lac1) mRNA,...    88   1e-16   
gb:CR382127_1660289 Yarrowia lipolytica chromosome A of strain C...    88   1e-16   
gb:AY338764_1600500 Coprinopsis cinerea strain AmutBmut laccase ...    88   1e-16   
gb:AY249052_1592662 Volvariella volvacea laccase 1 (lac1) mRNA, ...    88   1e-16   
gb:AP005185_1849011 Oryza sativa (japonica cultivar-group) genom...    88   2e-16   
gb:ASNDHGO_1542200 Aspergillus terreus DHGO gene for dihydrogeod...    88   2e-16   
gb:AY676427_1621958 Lentinula edodes laccase 3 VT (LAC3) mRNA, c...    87   2e-16   
gb:AY338486_1600487 Volvariella volvacea laccase 4 (lac4) mRNA, ...    87   2e-16   
gb:AE016959_1021990 Oryza sativa (japonica cultivar-group) chrom...    87   2e-16   
gb:AB015758_1512727 Schizophyllum commune mRNA for laccase, comp...    87   4e-16   
sp|Q12542|LAC2_AGABI|LAC2_AGABI Laccase II precursor (EC 1.10.3.2) (Benzene...    87   4e-16   Agaricus bisporus [button mushroom]
gb:AY875863_1631873 Coriolopsis gallica laccase (lacg450) gene, ...    86   5e-16   
gb:AE013599_1130140 Drosophila melanogaster chromosome 2R, compl...    86   5e-16   
gb:AE013599_1130139 Drosophila melanogaster chromosome 2R, compl...    86   5e-16   
gb:AE013599_1130138 Drosophila melanogaster chromosome 2R, compl...    86   5e-16   
pir|A85439|A85439 pectinesterase like protein [imported] - Arabi...    86   5e-16   Arabidopsis thaliana [mouse-ear cress]
gb:PSA507324_1702002 Pleurotus sajor-caju mRNA for laccase 1 (la...    86   6e-16   
gb:AY136404_1581905 Arabidopsis thaliana pectinesterase, putativ...    86   6e-16   
gb:AY057492_1563911 Arabidopsis thaliana At1g76160/T23E18_10 mRN...    86   6e-16   
gb:AB055709_1521604 Colletotrichum lagenarium LAC1 gene for lacc...    86   6e-16   
gb:AY135186_1302954 Manduca sexta laccase 2 mRNA, complete cds.        86   6e-16   
pir|E96789|E96789 protein T23E18.10 [imported] - Arabidopsis tha...    86   6e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AP003411_1829039 Oryza sativa (japonica cultivar-group) genom...    86   8e-16   
gb:AF479568_1803525 Petunia x hybrida 1-ascorbate oxidase (p303)...    86   8e-16   
gb:AY839939_1630507 Trametes sp. 420 laccase A (lacA) gene, comp...    86   8e-16   
gb:AY485828_1608505 Auricularia auricula-judae multicopper oxida...    86   8e-16   
gb:AY586512_1616453 Aspergillus fumigatus ferroxidase (fetC) and...    85   1e-15   
gb:AY072215_1567101 Arabidopsis thaliana putative pectinesterase...    85   1e-15   
gb:AB046713_1520542 Lentinula edodes LeLcc3 mRNA for laccase, co...    85   1e-15   
gb:AB018109_1513736 Arabidopsis thaliana genomic DNA, chromosome...    85   1e-15   
gb:AC093952_1736168 Oryza sativa (japonica cultivar-group) chrom...    85   1e-15   
gb:OSJN00087_1694666 Oryza sativa genomic DNA, chromosome 4, BAC...    85   1e-15   
gb:NCB23B10_1689717 Neurospora crassa DNA linkage group II BAC c...    85   1e-15   
gb:AY147188_1583917 Pycnoporus cinnabarinus laccase (Lcc1) gene,...    85   1e-15   
sp|O59896|LAC1_PYCCI|LAC1_PYCCI Laccase precursor (EC 1.10.3.2) (Benzenedio...    85   1e-15   Trametes cinnabarina
sp|Q12541|LAC1_AGABI|LAC1_AGABI Laccase I precursor (EC 1.10.3.2) (Benzened...    85   1e-15   Agaricus bisporus [button mushroom]
gb:AY875866_1631876 Coriolopsis gallica laccase (lacc333b) mRNA,...    84   2e-15   
gb:AY338763_1600499 Coprinopsis cinerea strain AmutBmut laccase ...    84   2e-15   
gb:CR382134_1667250 Debaryomyces hansenii chromosome B of strain...    84   2e-15   
gb:AY875865_1631875 Coriolopsis gallica laccase (lacc333a) mRNA,...    84   2e-15   
gb:AY676424_1621955 Lentinula edodes laccase 1 CVT (LAC1) mRNA, ...    84   2e-15   
pir|T05670|T05670 pollen-specific protein homolog F22I13.190 - A...    84   2e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AY676425_1621956 Lentinula edodes laccase 1 DVT (LAC1) mRNA, ...    84   3e-15   
gb:BT003483_1356885 Drosophila melanogaster RE55660 full insert ...    83   4e-15   
gb:GGR437319_1680005 Gaeumannomyces graminis var. graminis lac1 ...    83   5e-15   
gb:AY676423_1621954 Lentinula edodes laccase 1 BVT (LAC1) mRNA, ...    83   5e-15   
gb:AY676422_1621953 Lentinula edodes laccase 1 AVT (LAC1) mRNA, ...    83   5e-15   
gb:AB055158_1521430 Lentinula edodes lcc2 gene for laccase, comp...    83   5e-15   
gb:AB035411_1518945 Lentinula edodes LeLcc2' mRNA for laccase 2'...    83   5e-15   
gb:AB035410_1518944 Lentinula edodes LeLcc2 mRNA for laccase 2, ...    83   5e-15   
gb:AY839940_1630508 Trametes sp. 420 laccase B (lacB) gene, comp...    82   7e-15   
gb:PHY427356_1395229 Pimpla hypochondriaca mRNA for laccase.           82   7e-15   
gb:AF297528_1784068 Pleurotus sajor-caju laccase 4 (Lac4) mRNA, ...    82   9e-15   
gb:AY450404_1606652 Pleurotus ostreatus laccase mRNA, complete cds.    82   9e-15   
gb:AB020026_1514501 Pleurotus ostreatus mRNA for bilirubin oxida...    82   9e-15   
sp|Q12739|LAC2_PLEOS|LAC2_PLEOS Laccase 2 precursor (EC 1.10.3.2) (Benzened...    82   9e-15   Pleurotus ostreatus [shimeji]
gb:AJ786026_1814043 Pleurotus sapidus mRNA for laccase precursor...    82   1e-14   
gb:AY839941_1630509 Trametes sp. 420 laccase C (lacC) gene, comp...    82   1e-14   
gb:AAD277833_1508160 Arxula adeninivorans afet3 gene for ferro-O...    82   1e-14   
gb:PSA507327_1702005 Pleurotus sajor-caju mRNA for laccase 4 (la...    81   2e-14   
gb:CR382126_1659520 Kluyveromyces lactis strain NRRL Y-1140 chro...    81   2e-14   
gb:AY094401_1575707 Arabidopsis thaliana AT5g66920/MUD21_18 mRNA...    81   2e-14   
gb:AY084759_1569843 Arabidopsis thaliana clone 116979 mRNA, comp...    81   2e-14   
gb:AB010700_1511269 Arabidopsis thaliana genomic DNA, chromosome...    81   2e-14   
gb:A46243_1449249 Sequence 6 from Patent WO9521929.>gb:NTASCOXRP...    81   2e-14   
gb:AY071323_1295407 Drosophila melanogaster RE34633 full length ...    81   2e-14   
gb:GGR417685_1680002 Gaeumannomyces graminis var. tritici lac1 g...    81   2e-14   
gb:AE014134_1128357 Drosophila melanogaster chromosome 2L, compl...    81   2e-14   
gb:AF480912_514421 Legionella pneumophila clone pA37F putative l...    81   2e-14   
gb:AE017354_459407 Legionella pneumophila subsp. pneumophila str...    81   2e-14   
gb:AE016817_1747516 Ashbya gossypii (= Eremothecium gossypii) AT...    80   3e-14   
gb:PSA507328_1702006 Pleurotus sajor-caju mRNA for laccase 5 (la...    80   3e-14   
gb:LEPE_1684390 L.esculentum mRNA for pectinesterase.                  80   3e-14   
gb:AY686700_1622315 Pleurotus eryngii laccase precursor (pel3) g...    80   3e-14   
gb:AY059814_1564658 Arabidopsis thaliana Unknown protein mRNA, c...    80   3e-14   
pir|C96492|C96492 probable pectinesterase [imported] - Arabidops...    80   3e-14   Arabidopsis thaliana [mouse-ear cress]
pir|T07129|T07129 pollen-specific protein homolog - tomato (frag...    80   3e-14   
gb:CPU428491_1648909 Claviceps purpurea cpmco1 gene for putative...    80   3e-14   
gb:AY532145_1612042 Phanerochaete chrysosporium strain BKM-1767 ...    80   3e-14   
gb:AY366397_1602904 Nicotiana tabacum ntp101 (pntp101) mRNA, com...    80   4e-14   
gb:AY366398_1602905 Nicotiana tabacum ntp201 (pntp201) mRNA, com...    79   6e-14   
gb:AE014298_1126199 Drosophila melanogaster chromosome X, comple...    79   6e-14   
gb:AP003940_1835549 Oryza sativa (japonica cultivar-group) genom...    79   8e-14   
gb:NC80A10_1688752 Neurospora crassa DNA linkage group V Cosmid ...    79   8e-14   
gb:AY088897_1573905 Arabidopsis thaliana clone 99023 mRNA, compl...    79   8e-14   
pir|S24951|S24951 pollen-specific protein Bp10 (clone Bp 1003) -...    79   8e-14   
gb:AF118269_1769620 Coprinus cinereus laccase 3 precursor (lcc3)...    79   1e-13   
gb:AY338759_1600495 Coprinopsis cinerea strain AmutBmut laccase ...    79   1e-13   
gb:CR628336_112462 Legionella pneumophila str. Paris complete ge...    79   1e-13   
pir|S24950|S24950 pollen-specific protein Bp10 (clone Bp 1002) -...    79   1e-13   
gb:AF083740_1766970 Arabidopsis thaliana clone sps458 unknown mRNA.    78   1e-13   
gb:BT003958_1637081 Arabidopsis thaliana clone RAFL15-11-H21 (R2...    78   1e-13   
gb:ATH249211_1552130 Arabidopsis thaliana mRNA for BNH protein (...    78   1e-13   
gb:AB047078_1520570 Candida glabrata gene for multicopper oxidas...    78   1e-13   
pir|T49108|T49108 pectinesterase like protein - Arabidopsis thal...    78   1e-13   
gb:AE016959_1023355 Oryza sativa (japonica cultivar-group) chrom...    78   2e-13   
gb:CR382137_1670091 Debaryomyces hansenii chromosome E of strain...    77   2e-13   
gb:AY463648_1607737 Cryptococcus neoformans A/D strain MAS92-002...    77   2e-13   
gb:AY366400_1602907 Nicotiana tabacum ntp805 (pntp805) mRNA, com...    77   2e-13   
gb:AB020745_1514600 Arabidopsis thaliana genomic DNA, chromosome...    77   2e-13   
sp|Q00624|ASO_BRANA|ASO_BRANA L-ascorbate oxidase homolog precursor (EC 1....    77   2e-13   
gb:AY485827_1608504 Pleurotus ostreatus laccase mRNA, complete cds.    77   3e-13   
gb:AY463658_1607747 Cryptococcus neoformans A/D strain MAS94-001...    77   3e-13   
pir|D96598|D96598 hypothetical protein T5A14.1 [imported] - Arab...    77   3e-13   
sp|Q12729|LAC1_PLEOS|LAC1_PLEOS Laccase 1 precursor (EC 1.10.3.2) (Benzened...    77   3e-13   
gb:AE017343_1755816 Cryptococcus neoformans var. neoformans JEC2...    77   4e-13   
gb:AY338760_1600496 Coprinopsis cinerea strain AmutBmut laccase ...    77   4e-13   
gb:CR382139_1672214 Debaryomyces hansenii chromosome G of strain...    76   5e-13   
gb:AY338756_1600492 Coprinopsis cinerea strain AT8 laccase 1 (lc...    76   5e-13   
gb:AE016782_331632 Pseudomonas putida KT2440 section 9 of 21 of ...    76   5e-13   
gb:CCO542532_1645880 Coprinellus congregatus lac2 gene for acidi...    76   6e-13   
gb:AY464531_1607944 Coprinopsis cinerea strain AmutBmut laccase ...    76   6e-13   
gb:AY338762_1600498 Coprinopsis cinerea strain AmutBmut laccase ...    76   6e-13   
gb:AY338757_1600493 Coprinopsis cinerea strain AmutBmut laccase ...    76   6e-13   
gb:AY513488_624671 Ornithobacterium rhinotracheale plasmid pOR1,...    76   6e-13   
pir|T02910|T02910 pollen-specific protein homolog T13J8.200 - Ar...    76   6e-13   
gb:NCB23H20_1689769 Neurospora crassa DNA linkage group II BAC c...    75   8e-13   
gb:CCO271339_1645873 Coprinus congregatus mRNA for acidic laccas...    75   8e-13   
gb:AF243854_1780275 Botryotinia fuckeliana laccase 1 (lcc1) gene...    75   1e-12   
gb:GGR417687_1680004 Gaeumannomyces graminis var. tritici lac3 g...    75   1e-12   
sp|P29162|NTP3_TOBAC|NTP3_TOBAC Pollen-specific protein NTP303 precursor.>p...    75   1e-12   
gb:AF153611_1772846 Lentinula edodes laccase (lac1) gene, lac1-B...    75   1e-12   
gb:AF153610_1772845 Lentinula edodes laccase (lac1) gene, lac1-A...    75   1e-12   
gb:PSA507325_1702003 Pleurotus sajor-caju mRNA for laccase 2 (la...    75   1e-12   
sp|P38993|FET3_YEAST|FET3_YEAST Iron transport multicopper oxidase FET3 pre...    75   1e-12   
gb:AY338758_1600494 Coprinopsis cinerea strain AmutBmut laccase ...    74   2e-12   
pir|T01152|T01152 probable pectinesterase [imported] - Arabidops...    74   2e-12   
gb:AY463641_1607730 Cryptococcus neoformans A/D strain MAS92-085...    74   2e-12   
gb:AY135185_1302953 Manduca sexta laccase 1 mRNA, complete cds.        74   2e-12   
gb:AY135184_1302952 Anopheles gambiae laccase 1 mRNA, complete cds.    74   2e-12   
sp|P43561|FET5_YEAST|FET5_YEAST Iron transport multicopper oxidase FET5 pre...    74   2e-12   
gb:AY463634_1607723 Cryptococcus neoformans A/D strain MAS92-002...    74   3e-12   
gb:AY463639_1607728 Cryptococcus neoformans A/D strain MAS92-066...    73   4e-12   
gb:AF185275_1775122 Ganoderma lucidum laccase gene, partial cds.       73   5e-12   
gb:AB010110_1511040 Acremonium sp. HI-25 gene for ascorbate oxid...    73   5e-12   
gb:AF116901_1769438 Aspergillus fumigatus brown 1 (abr1) gene, c...    72   7e-12   
gb:AY364842_1602847 Ganoderma sp. BAFC2488 laccase gene, partial...    72   9e-12   
pir|S24949|S24949 pollen-specific protein Bp10 (clone Bp 1001) -...    72   9e-12   
gb:AY056409_1563717 Arabidopsis thaliana AT3g13400/MRP15_3 mRNA,...    71   2e-11   
gb:CR382130_1662603 Yarrowia lipolytica chromosome D of strain C...    71   2e-11   
gb:AF297527_1784067 Pleurotus sajor-caju laccase 3 (Lac3) mRNA, ...    70   3e-11   
gb:AF297525_1784065 Pleurotus sajor-caju laccase 1 (Lac1) mRNA, ...    70   3e-11   
gb:CR380957_1653059 Candida glabrata strain CBS138 chromosome K ...    70   3e-11   
gb:AP001129_1820818 Oryza sativa (japonica cultivar-group) genom...    70   4e-11   
gb:BX321857_772607 Nitrosomonas europaea ATCC 19718, complete ge...    70   4e-11   
gb:AECZCOP5R_466646 Ralstonia metallidurans CH34 plasmid pMOL30.       70   4e-11   
gb:RME278983_164630 Ralstonia metallidurans copper resistance op...    70   4e-11   
gb:AJ609490_1812012 Rigidoporus microporus mRNA for laccase (lcc...    70   5e-11   
gb:AF297526_1784066 Pleurotus sajor-caju laccase 2 (Lac2) mRNA, ...    70   5e-11   
gb:AF140183_1771493 Filobasidiella neoformans isolate CN140.97 d...    70   5e-11   
gb:AY364841_1602846 Ganoderma sp. BS-1 laccase 2 gene, partial cds.    70   5e-11   
gb:AJ746240_1813884 Trametes versicolor partial klc1 gene for la...    69   6e-11   
gb:AF140159_1771469 Filobasidiella neoformans isolate CN110.97 d...    69   6e-11   
gb:AF140158_1771468 Filobasidiella neoformans isolate M0053 diph...    69   6e-11   
gb:AE017340_456997 Idiomarina loihiensis L2TR, complete genome.        69   6e-11   
sp|P78591|FET3_CANAL|FET3_CANAL Iron transport multicopper oxidase precurso...    69   6e-11   
gb:ANI305224_1819471 Aspergillus nidulans tilA gene for laccase,...    69   8e-11   
gb:AF140176_1771486 Filobasidiella neoformans isolate ZG284 diph...    69   8e-11   
gb:AE014297_1141482 Drosophila melanogaster chromosome 3R, compl...    69   8e-11   
gb:AY536748_626414 Xanthomonas axonopodis pv. vesicatoria copper...    69   8e-11   
gb:AF140161_1771471 Filobasidiella neoformans isolate KW5 diphen...    69   1e-10   
gb:CR378666_94371 Photobacterium profundum SS9; segment 4/12.          69   1e-10   
gb:AF140177_1771487 Filobasidiella neoformans isolate CN-B diphe...    68   1e-10   
gb:BAS540288_1632695 Uncultured basidiomycete partial lac gene f...    68   1e-10   
gb:BX640435_812341 Bordetella parapertussis strain 12822, comple...    68   1e-10   
gb:AF455754_512995 Bordetella pertussis multicopper oxidase gene...    68   1e-10   
sp|Q03966|LAC1_CRYPA|LAC1_CRYPA Laccase precursor (EC 1.10.3.2) (Benzenedio...    68   1e-10   
gb:AF312321_1785155 Fusarium proliferatum strain NRRL 31071 clon...    68   2e-10   
gb:AY321492_609257 Pseudomonas putida copABCD operon, complete s...    68   2e-10   
sp|Q09920|YAK8_SCHPO|YAK8_SCHPO Putative multicopper oxidase C1F7.08 precur...    68   2e-10   
gb:AY243865_1592453 Xylaria sp. HKUCC 2880 isolate Lcc13 laccase...    67   2e-10   
gb:AY243862_1592450 Cyathus sp. HKUCC 4069 isolate Lcc10v2 lacca...    67   2e-10   
gb:AY243861_1592449 Panus sp. HKUCC 4062 isolate MLccC laccase g...    67   2e-10   
pir|T21201|T21201 hypothetical protein F21D5.3 - Caenorhabditis ...    67   2e-10   
pir|A36868|A36868 copA homolog - Xanthomonas campestris>gb:XANCU...    67   2e-10   
pir|S10149|KSASL1 laccase (EC 1.10.3.2) I precursor - Emericella...    67   2e-10   
sp|P17489|LAC1_EMENI|LAC1_EMENI Laccase I precursor (EC 1.10.3.2) (Benzened...    67   2e-10   
gb:AF140152_1771462 Filobasidiella neoformans isolate CN-D diphe...    67   3e-10   
gb:BSP420341_1634246 Uncultured Basidiomycete partial lac14 gene...    67   3e-10   
gb:AY616035_1618150 Auricularia polytricha laccase (lac1) gene, ...    67   3e-10   
gb:AY615304_1618126 Auricularia polytricha laccase (lac1) mRNA, ...    67   3e-10   
gb:AY243866_1592454 Hypoxylon sp. HKUCC 3196 isolate Lcc14v2 lac...    67   3e-10   
gb:AY243858_1592446 Ganoderma lucidum isolate Lcc9 laccase gene,...    67   3e-10   
gb:AE012155_279849 Xanthomonas campestris pv. campestris str. AT...    67   3e-10   
gb:AB033419_5205 Pseudomonas syringae plasmid pPaCu1 ORFA, ORFB,...    67   3e-10   
gb:AF140182_1771492 Filobasidiella neoformans isolate CN139.97 d...    67   4e-10   
gb:AF140150_1771460 Filobasidiella neoformans isolate B10 diphen...    67   4e-10   
gb:AB086815_1524564 Candida albicans CaFET96 mRNA for hypothetic...    67   4e-10   
gb:AP003727_1832521 Oryza sativa (japonica cultivar-group) genom...    66   5e-10   
gb:AF140173_1771483 Filobasidiella neoformans isolate MMRL750 di...    66   5e-10   
gb:BX321859_773255 Nitrosomonas europaea ATCC 19718, complete ge...    66   5e-10   
gb:PPA311571_1701206 Pichia pastoris partial mRNA for Fet3 protein.    66   7e-10   
gb:PCO420336_1699272 Pleurotus cornucopiae partial mRNA for lacc...    66   7e-10   
gb:CR382124_1656568 Kluyveromyces lactis strain NRRL Y-1140 chro...    66   7e-10   
gb:BAS540238_1632645 Uncultured basidiomycete partial lac gene f...    66   7e-10   
pir|F83387|F83387 copper resistance protein A precursor PA2065 [...    66   7e-10   
sp|P59571|CPA2_PSESM|CPA2_PSESM Copper resistance protein A homolog precurs...    66   7e-10   
gb:AF140181_1771491 Filobasidiella neoformans isolate CN119.95 d...    65   9e-10   
gb:AF140179_1771489 Filobasidiella neoformans isolate CN-C diphe...    65   9e-10   
gb:GGR417686_1680003 Gaeumannomyces graminis var. tritici lac2 g...    65   9e-10   
gb:AE017353_1760173 Cryptococcus neoformans var. neoformans JEC2...    65   1e-09   
gb:AL646080_549026 Ralstonia solanacearum GMI1000 megaplasmid, c...    65   1e-09   
pir|H87368|H87368 copper-binding protein [imported] - Caulobacte...    65   1e-09   
sp|P78722|LAC2_PODAN|LAC2_PODAN Laccase II precursor (EC 1.10.3.2) (Benzene...    65   1e-09   
gb:AF140157_1771467 Filobasidiella neoformans isolate M0024 diph...    65   1e-09   
gb:MAL542605_1685581 Marasmius alliaceus partial lac gene for la...    65   1e-09   
gb:BAS540255_1632662 Uncultured basidiomycete partial lac gene f...    65   1e-09   
gb:AF455751_512992 Pseudomonas aeruginosa multicopper oxidase ge...    65   1e-09   
gb:UBA580837_1726716 Uncultured basidiomycete partial mRNA for l...    64   2e-09   
gb:GLU420176_1680300 Ganoderma lucidum partial lac gene for lacc...    64   2e-09   
gb:AY243860_1592448 Panus sp. HKUCC 4062 isolate MLccB laccase g...    64   2e-09   
gb:AY243859_1592447 Panus sp. HKUCC 4062 isolate MLccA laccase g...    64   2e-09   
gb:AY243855_1592443 Pycnoporus cinnabarinus isolate Lcc4v2 lacca...    64   2e-09   
gb:PCI420335_1699245 Pycnoporus cinnabarinus partial mRNA for la...    64   3e-09   
gb:CR382130_1662579 Yarrowia lipolytica chromosome D of strain C...    64   3e-09   
gb:BAS540258_1632665 Uncultured basidiomycete partial lac gene f...    64   3e-09   
gb:BAS540239_1632646 Uncultured basidiomycete partial lac gene f...    64   3e-09   
gb:AY875864_1631874 Coriolopsis gallica laccase (lacg201) gene, ...    64   3e-09   
gb:A68087_1450339 Sequence 3 from Patent WO9745549.>gb:NTU45243_...    64   3e-09   
pir|T03788|T03788 laccase (EC 1.10.3.2) - common tobacco (fragment)    64   3e-09   
pir|A28523|KSNCLO laccase (EC 1.10.3.2) precursor - Neurospora c...    64   3e-09   
sp|P06811|LAC1_NEUCR|LAC1_NEUCR Laccase precursor (EC 1.10.3.2) (Benzenedio...    64   3e-09   
gb:AF312323_1785157 Fusarium proliferatum strain NRRL 31071 clon...    64   3e-09   
gb:MAL571698_1685583 Melanocarpus albomyces lac1 gene for laccas...    64   3e-09   
gb:LFL542596_1684830 Lepista flaccida partial lac gene for lacca...    64   3e-09   
gb:GGR437320_1680006 Gaeumannomyces graminis var. graminis lac2 ...    64   3e-09   
gb:AE016794_334759 Pseudomonas putida KT2440 section 21 of 21 of...    64   3e-09   
gb:POS420179_1701054 Pleurotus ostreatus partial lac1 gene for l...    63   4e-09   
gb:AY204503_1589098 Trametes versicolor putative laccase gene, p...    63   4e-09   
gb:AE012553_283547 Xylella fastidiosa Temecula1, section 1 of 9 ...    63   4e-09   
pir|C82845|C82845 copper resistance protein A precursor XF0132 [...    63   4e-09   
gb:AF140180_1771490 Filobasidiella neoformans isolate CN106.97 d...    63   6e-09   
gb:POS420180_1701055 Pleurotus ostreatus partial lac2 gene for l...    63   6e-09   
gb:PCO420337_1699273 Pleurotus cornucopiae partial mRNA for lacc...    63   6e-09   
gb:PCI420182_1699243 Pycnoporus cinnabarinus partial mRNA for la...    63   6e-09   
gb:AE013598_294457 Xanthomonas oryzae pv. oryzae KACC10331, comp...    63   6e-09   
gb:AE017350_1758948 Cryptococcus neoformans var. neoformans JEC2...    62   7e-09   
gb:CQU542634_1648984 Clitocybe quercina partial lac gene for lac...    62   7e-09   
gb:BSP420338_1634243 uncultured basidiomycete partial lac1 gene ...    62   7e-09   
gb:AY248746_602244 Xanthomonas campestris pv. vesicatoria copper...    62   7e-09   
sp|P12374|CPA1_PSESM|CPA1_PSESM Copper resistance protein A precursor.>pir|...    62   7e-09   
gb:AF437509_1799903 Cyathus bulleri laccase gene, partial cds.         62   1e-08   
gb:AE016815_1746465 Ashbya gossypii (= Eremothecium gossypii) AT...    62   1e-08   
gb:MGA542641_1686069 Mycena galopoda partial lac gene for laccas...    62   1e-08   
gb:BSP420347_1634252 Uncultured Basidiomycete partial lac2 gene ...    62   1e-08   
gb:AY243856_1592444 Pycnoporus sanguineus isolate Lcc5 laccase g...    62   1e-08   
gb:AY008437_1558218 Fusarium proliferatum NRRL 31071 clone Lac-1...    62   1e-08   
sp|P10574|LAC2_NEUCR|LAC2_NEUCR Laccase precursor (EC 1.10.3.2) (Benzenedio...    62   1e-08   
gb:AY378100_614700 Klebsiella pneumoniae plasmid pLVPK, complete...    62   1e-08   
sp|Q47452|PCOA_ECOLI|PCOA_ECOLI Copper resistance protein A precursor.>pir|...    62   1e-08   
gb:PCO542619_1699294 Psathyrella corrugis partial lac gene for l...    61   2e-08   
gb:BAS540259_1632666 Uncultured basidiomycete partial lac gene f...    61   2e-08   
gb:BAS540237_1632644 Uncultured basidiomycete partial lac gene f...    61   2e-08   
gb:AY243864_1592452 Xylaria sp. HKUCC 2797 isolate Lcc12v2 lacca...    61   2e-08   
gb:AY243852_1592440 Pycnoporus sanguineus isolate Lcc1 laccase g...    61   2e-08   
gb:BA000037_724035 Vibrio vulnificus YJ016 DNA, chromosome I, co...    61   2e-08   
gb:AE016800_335713 Vibrio vulnificus CMCP6 chromosome I section ...    61   2e-08   
gb:AJ420178_1811238 Hypholoma sp. 1 partial lac2 gene for laccas...    61   2e-08   
gb:UBA580835_1726714 Uncultured basidiomycete partial mRNA for l...    61   2e-08   
gb:RMA542625_1703840 Russula mairei partial lac gene for laccase...    61   2e-08   
gb:PCO420173_1699270 Pleurotus cornucopiae partial lac1 gene for...    61   2e-08   
gb:BX664015_817890 Serratia marcescens plasmid R478.                   61   2e-08   
pir|A98239|A98239 hypothetical protein AGR_L_1722 [imported] - A...    61   2e-08   
pir|C95332|C95332 probable copper-containing oxidase [imported] ...    61   2e-08   
gb:ACI542646_1745360 Amanita citrina partial lac gene for laccas...    60   3e-08   
gb:GFU420169_1679932 Gymnopus fusipes partial lac1 gene for lacc...    60   3e-08   
gb:CFL542638_1646297 Cortinarius flexipes partial lac gene for l...    60   3e-08   
gb:AY243854_1592442 Pycnoporus coccineus isolate Lcc3 laccase ge...    60   3e-08   
gb:AF187849_486561 Aeromonas veronii bv. sobria CopA (copA), Cop...    60   3e-08   
gb:AE016861_350889 Pseudomonas syringae pv. tomato str. DC3000 s...    60   3e-08   
gb:AE012013_278544 Xanthomonas axonopodis pv. citri str. 306, se...    60   3e-08   
gb:AB193030_17333 Corynebacterium glutamicum DNA, strain specifi...    60   3e-08   
gb:PCI420175_1699242 Pycnoporus cinnabarinus partial lac gene fo...    60   4e-08   
gb:MJU542614_1686652 Macrotyphula juncea partial lac gene for la...    60   4e-08   
gb:BSP420350_1634255 Uncultured Basidiomycete partial lac4 gene ...    60   4e-08   
gb:BAS540273_1632680 Uncultured basidiomycete partial lac gene f...    60   4e-08   
gb:BAS540235_1632642 Uncultured basidiomycete partial lac gene f...    60   4e-08   
gb:AY243857_1592445 Trametes versicolor isolate Lcc6v2 laccase g...    60   4e-08   
gb:AY047482_1561643 Botryotinia fuckeliana laccase (LCC3) gene, ...    60   4e-08   
gb:CP000009_862690 Gluconobacter oxydans 621H, complete genome.        60   4e-08   
gb:BA000036_720694 Corynebacterium glutamicum ATCC 13032 DNA, co...    60   4e-08   
gb:AF455753_512994 Corynebacterium diphtheriae potential multico...    60   4e-08   
pir|G83175|G83175 probable metallo-oxidoreductase PA3768 [import...    60   4e-08   
gb:XCH542643_1727795 Xerocomus chrysenteron partial lac gene for...    60   5e-08   
gb:MZE542601_1687812 Mycena zephirus partial lac gene for laccas...    60   5e-08   
gb:GFU420170_1679933 Gymnopus fusipes partial lac2 gene for lacc...    60   5e-08   
gb:BSP420342_1634247 Uncultured Basidiomycete partial lac8 gene ...    60   5e-08   
gb:BAS540298_1632705 Uncultured basidiomycete partial lac gene f...    60   5e-08   
gb:AX771939_1474870 Sequence 151 from Patent WO03040290.               60   5e-08   
gb:AX065823_1459825 Sequence 167 from Patent WO0100842.                60   5e-08   
gb:BA000043_737481 Geobacillus kaustophilus HTA426 DNA, complete...    60   5e-08   
gb:CR543861_102698 Acinetobacter sp. ADP1 complete genome.             60   5e-08   
gb:CP000031_84745 Silicibacter pomeroyi DSS-3, complete genome.        60   5e-08   
gb:AE017355_463049 Bacillus thuringiensis serovar konkukian str....    59   6e-08   
gb:AE017195_401967 Bacillus cereus ATCC 10987 plasmid pBc10987, ...    59   6e-08   
gb:SME591784_184604 Sinorhizobium meliloti 1021 complete chromos...    59   6e-08   
gb:RAT542624_1703280 Russula atropurpurea partial lac gene for l...    59   8e-08   


>gb:LTU73106_1685432 Liriodendron tulipifera high-pI laccase
           (LAC2-4) mRNA, complete cds.
          Length = 585

 Score =  324 bits (831), Expect = 8e-88
 Identities = 142/174 (81%), Positives = 162/174 (93%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TRHY+FN+ +QNVTRLCHTKSIVTVNG++PGP I AREGDR+++KV NHV NNI++HWHG
Sbjct: 36  TRHYKFNIRLQNVTRLCHTKSIVTVNGRFPGPKIFAREGDRVVVKVVNHVQNNITLHWHG 95

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILP 529
           +RQLRSGWADGPAY+TQCPIQTGQ+YVY + I+ QRGTLFWHAHISWLRAT++GPI+ILP
Sbjct: 96  VRQLRSGWADGPAYVTQCPIQTGQTYVYNFRIISQRGTLFWHAHISWLRATIYGPIVILP 155

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           K  V YPF+KPYKEVPIIFGEWFN DTEAII+QALQTGGGPNVSDAYTINGLPG
Sbjct: 156 KHGVPYPFIKPYKEVPIIFGEWFNADTEAIITQALQTGGGPNVSDAYTINGLPG 209



>gb:LTU73104_1685430 Liriodendron tulipifera high-pI laccase
           (LAC2-2) mRNA, complete cds.
          Length = 585

 Score =  321 bits (822), Expect = 9e-87
 Identities = 140/174 (80%), Positives = 164/174 (94%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TRHY+F++ +QNVTRLCHTKSIVTVNG++PGP I+AREGDR+++KV NHV NNI++HWHG
Sbjct: 36  TRHYKFDIRLQNVTRLCHTKSIVTVNGQFPGPKIVAREGDRVVVKVVNHVQNNITLHWHG 95

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILP 529
           +RQLRSGWADGPAY+TQCPIQTGQ+YVY +TI+GQ GTLFWHAHISWLR+TL+GPI+ILP
Sbjct: 96  VRQLRSGWADGPAYVTQCPIQTGQTYVYNFTIIGQTGTLFWHAHISWLRSTLYGPIVILP 155

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           K+ + YPF+KPYKEV IIFGEWFN DTEAII+QALQTGGGPNVSDAYTINGLPG
Sbjct: 156 KRGIPYPFIKPYKEVSIIFGEWFNVDTEAIITQALQTGGGPNVSDAYTINGLPG 209



>gb:LTU73105_1685431 Liriodendron tulipifera high-pI laccase
           (LAC2-3) mRNA, complete cds.
          Length = 586

 Score =  315 bits (808), Expect = 4e-85
 Identities = 137/174 (78%), Positives = 163/174 (93%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TRHY+F++ M+NVTRLCHT++I+TVNG++PGP I+AREGDR+++KV NHVANN+++HWHG
Sbjct: 37  TRHYKFDIQMRNVTRLCHTRNILTVNGQFPGPKIIAREGDRVVVKVVNHVANNVTLHWHG 96

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILP 529
           +RQLRSGWADGPAY+TQCPIQTGQS+VY +TIVGQRGTLFWHAHISWLR+TL+GPI+ILP
Sbjct: 97  VRQLRSGWADGPAYVTQCPIQTGQSFVYNFTIVGQRGTLFWHAHISWLRSTLYGPIVILP 156

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           K+ V YPF KPYK VPIIFGEWFN D EAII+QALQTG GPNVSDA+TINGLPG
Sbjct: 157 KRGVPYPFAKPYKSVPIIFGEWFNVDPEAIITQALQTGAGPNVSDAFTINGLPG 210



>gb:AB015475_1512594 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MMN10.>gb:BT015359_1642187 Arabidopsis thaliana
           At5g60020 gene, complete cds.>gb:BT015890_1642508
           Arabidopsis thaliana At5g60020 gene, complete cds.
          Length = 577

 Score =  311 bits (796), Expect = 9e-84
 Identities = 140/174 (80%), Positives = 159/174 (91%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TRHY   + MQNVTRLCHTKS+V+VNG++PGP ++AREGD++LIKV N V NNIS+HWHG
Sbjct: 24  TRHYTLEIKMQNVTRLCHTKSLVSVNGQFPGPKLIAREGDQVLIKVVNQVPNNISLHWHG 83

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILP 529
           IRQLRSGWADGPAYITQCPIQTGQSYVY YTIVGQRGTL++HAHISWLR+T++GP+IILP
Sbjct: 84  IRQLRSGWADGPAYITQCPIQTGQSYVYNYTIVGQRGTLWYHAHISWLRSTVYGPLIILP 143

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           K+ V YPF KP+KEVP+IFGEWFN DTEAII QA QTGGGPNVSDAYTINGLPG
Sbjct: 144 KRGVPYPFAKPHKEVPMIFGEWFNADTEAIIRQATQTGGGPNVSDAYTINGLPG 197



>gb:PTY13773_1702846 Populus trichocarpa mRNA for laccase, lac110
           gene.
          Length = 580

 Score =  301 bits (772), Expect = 5e-81
 Identities = 132/174 (75%), Positives = 156/174 (89%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TR Y FN+T +N TRLCHT+S+VTVNG++PGP ++AREGD++L+KV NHVA NI+IHWHG
Sbjct: 35  TRQYTFNITHKNFTRLCHTRSLVTVNGQFPGPRLVAREGDQVLVKVVNHVAENITIHWHG 94

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILP 529
           +RQL +GWADGPAY+TQCPIQTGQ+Y Y +TI GQRGTL WHAHISWLR++L+GPIIILP
Sbjct: 95  VRQLTTGWADGPAYVTQCPIQTGQAYTYNFTITGQRGTLLWHAHISWLRSSLYGPIIILP 154

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           K N SYPF KPYKE+PI+FGEWFN D EA+I+QALQTG GPNVSDAYTINGLPG
Sbjct: 155 KLNESYPFKKPYKEIPILFGEWFNVDPEAVIAQALQTGAGPNVSDAYTINGLPG 208



>gb:AF132123_1770857 Pinus taeda laccase (Lac5) mRNA, complete cds.
          Length = 591

 Score =  299 bits (765), Expect = 4e-80
 Identities = 132/174 (75%), Positives = 153/174 (87%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TRHY+FNV   NVTRLC+TK ++TVNG+YPGP I A+EGD+++IK+ NHV +N++IHWHG
Sbjct: 45  TRHYKFNVRQSNVTRLCNTKPLITVNGQYPGPTIFAQEGDQVIIKLVNHVKDNVTIHWHG 104

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILP 529
           IRQLRSGWADGP YITQCP+QTG SYVY +TI GQRGTL+WHAHISWLRA++HG III P
Sbjct: 105 IRQLRSGWADGPGYITQCPLQTGMSYVYNFTITGQRGTLWWHAHISWLRASVHGAIIIYP 164

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           K +V YPF KPYKEVPII GEW+N DTE +I QALQTGGGPNVSDAYTINGLPG
Sbjct: 165 KPHVPYPFPKPYKEVPIILGEWWNADTEKVIQQALQTGGGPNVSDAYTINGLPG 218



>gb:AF132121_1770855 Pinus taeda laccase (Lac3) mRNA, complete cds.
          Length = 574

 Score =  298 bits (763), Expect = 6e-80
 Identities = 126/174 (72%), Positives = 155/174 (89%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TRHY F++ + N+TRLCHTK ++TVNG+YPGP I+AREGDR++I V NHV +N++IHWHG
Sbjct: 30  TRHYHFHIRLNNITRLCHTKPLITVNGEYPGPAIIAREGDRVVINVTNHVKDNVTIHWHG 89

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILP 529
           IRQ+RS WADGPAY+TQCPIQTGQSY+Y +TI GQRGTL+WHAHISWLRATL+GPIII P
Sbjct: 90  IRQIRSAWADGPAYVTQCPIQTGQSYIYNFTITGQRGTLWWHAHISWLRATLYGPIIIHP 149

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           KK  +YPF KP++E PI+FGEW+N +TE +I++A+Q GGGPNVSDAYTINGLPG
Sbjct: 150 KKQATYPFTKPHQESPILFGEWWNANTENVINEAMQNGGGPNVSDAYTINGLPG 203



>gb:AP003240_1826031 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0406G08.
          Length = 579

 Score =  298 bits (762), Expect = 8e-80
 Identities = 129/174 (74%), Positives = 158/174 (90%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TRHYEFNV M N TRLC+TKS+VTVNG+ PGP ++AREGDR++I+V N+VA+NIS+HWHG
Sbjct: 30  TRHYEFNVQMANATRLCNTKSMVTVNGQCPGPELVAREGDRVVIRVTNNVAHNISLHWHG 89

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILP 529
           +RQ+R+GWADGPAYITQCPIQTGQSYVY +T+ GQRGTL+WHAHISWLRAT++G ++ILP
Sbjct: 90  VRQVRTGWADGPAYITQCPIQTGQSYVYNFTVAGQRGTLWWHAHISWLRATVYGALVILP 149

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           K  V YPF  P+KEVP+IFGEW+N DTE +++QA+QTGGGPNVSDA+TINGLPG
Sbjct: 150 KLGVPYPFPAPHKEVPVIFGEWWNADTEEVVNQAVQTGGGPNVSDAFTINGLPG 203



>pir|T02743|T02743 laccase (EC 1.10.3.2) At2g29130 - Arabidopsis
           thaliana>gb:AC005315_1532605 Arabidopsis thaliana
           chromosome 2 clone T9I4 map mi54, complete sequence.
          Length = 573

 Score =  294 bits (752), Expect = 1e-78
 Identities = 126/174 (72%), Positives = 153/174 (87%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TRHY+F++ ++N+TRLC TK+IVTVNGK+PGP + AREGD L IKV NHV+NNISIHWHG
Sbjct: 29  TRHYQFDIQLKNITRLCKTKTIVTVNGKFPGPRVTAREGDNLQIKVVNHVSNNISIHWHG 88

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILP 529
           IRQLRSGWADGP+Y+TQCPI+ GQSYVY +T+ GQRGTL+WHAHI W+RAT++GP+IILP
Sbjct: 89  IRQLRSGWADGPSYVTQCPIRMGQSYVYNFTVTGQRGTLWWHAHIQWMRATVYGPLIILP 148

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           K +  YPF KPYK+VPI+FGEWFN D +A++ QALQTG GPN SDA+T NGLPG
Sbjct: 149 KLHQPYPFPKPYKQVPILFGEWFNADPQAVVQQALQTGAGPNASDAHTFNGLPG 202



>gb:AF548614_1810733 Lolium perenne laccase LAC11 mRNA, partial cds.
          Length = 211

 Score =  292 bits (748), Expect = 3e-78
 Identities = 127/174 (72%), Positives = 154/174 (88%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TRHY FNV M NVTRLC TKSIVTVNG+YPGP ++AR+G R+L++V NHVA+N+++HWHG
Sbjct: 31  TRHYNFNVQMANVTRLCATKSIVTVNGEYPGPALVARKGHRVLVRVTNHVAHNMTLHWHG 90

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILP 529
           IRQLRSGWADGPAYITQCP+QTGQSY+Y +TI GQRGTL+WHAHISWLRAT++G II+LP
Sbjct: 91  IRQLRSGWADGPAYITQCPMQTGQSYLYNFTITGQRGTLWWHAHISWLRATVYGAIIVLP 150

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           K  V YPF  P+KEVP+IFGEW+  DTE ++ QA++TGG PN+SDA+TINGLPG
Sbjct: 151 KHGVPYPFTAPHKEVPMIFGEWWRADTEKLVRQAIKTGGAPNISDAFTINGLPG 204



>gb:AF465468_1802143 Lolium perenne laccase LAC5-6 mRNA, complete
           cds.
          Length = 578

 Score =  290 bits (743), Expect = 1e-77
 Identities = 127/174 (72%), Positives = 154/174 (88%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TRHY+FNV M NVTRLC TKSIVTVNG++PGP ++AREGDR+ ++V NHVA+N+SIHWHG
Sbjct: 30  TRHYDFNVQMANVTRLCGTKSIVTVNGQFPGPELIAREGDRVHVRVTNHVAHNMSIHWHG 89

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILP 529
           IRQL +GWADGPAY+TQCPIQTGQ+YVYK+T+ GQRGTL+WHAHISW RAT++G I+ILP
Sbjct: 90  IRQLTTGWADGPAYVTQCPIQTGQTYVYKFTVTGQRGTLWWHAHISWFRATVYGAIVILP 149

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           K  V YPF  P++EVP+IFGEW+  DTE I+S+AL+ GG PN+SDAYTINGLPG
Sbjct: 150 KLGVPYPFPAPHEEVPVIFGEWWAADTEDIMSKALKVGGAPNISDAYTINGLPG 203



>gb:AF132124_1770858 Pinus taeda laccase (Lac6) mRNA, complete cds.
          Length = 578

 Score =  290 bits (741), Expect = 2e-77
 Identities = 127/174 (72%), Positives = 153/174 (87%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TRHY+FNV ++NVTRLCH+K +VTVNG+YPGP I AR GDR++IK+ NHV +N++IHWHG
Sbjct: 35  TRHYKFNVRLKNVTRLCHSKPLVTVNGRYPGPTIFAR-GDRVIIKLVNHVKDNVTIHWHG 93

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILP 529
           +RQLRSGWADGP Y+TQCPIQTG+SYVY +TI GQRGTL+WHAHISWLR ++HG III P
Sbjct: 94  VRQLRSGWADGPGYVTQCPIQTGKSYVYNFTITGQRGTLWWHAHISWLRVSVHGAIIIYP 153

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
             ++ YPF KP+KEVP+I GEW+N +TE +I QALQTGGGPNVSDAYTINGLPG
Sbjct: 154 NLHLPYPFPKPHKEVPVILGEWWNANTEKVIQQALQTGGGPNVSDAYTINGLPG 207



>gb:LTU73103_1685429 Liriodendron tulipifera high-pI laccase
           (LAC2-1) mRNA, complete cds.
          Length = 570

 Score =  289 bits (739), Expect = 4e-77
 Identities = 124/174 (71%), Positives = 159/174 (91%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           T HY+F+V +++V RLC+ KSI+TVNG++PGP ++AREGDR++++V N+V NN+++HWHG
Sbjct: 26  TWHYKFDVQLKSVKRLCNRKSILTVNGRFPGPKLVAREGDRVVVEVVNNVQNNVTVHWHG 85

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILP 529
           IRQL++GWADGP+YITQCPIQTGQ+YVY +TIVGQRGTLFWHAH SWLRATL+GP+I+LP
Sbjct: 86  IRQLQNGWADGPSYITQCPIQTGQTYVYNFTIVGQRGTLFWHAHFSWLRATLYGPLIVLP 145

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
            +N +YPF KP KEVPIIFGEW+N +TEA+I+Q+LQTG GPNVSDAYTING+PG
Sbjct: 146 MQNATYPFGKPDKEVPIIFGEWWNANTEAVINQSLQTGAGPNVSDAYTINGMPG 199



>gb:AF132119_1770853 Pinus taeda laccase (Lac1) mRNA, complete cds.
          Length = 586

 Score =  287 bits (735), Expect = 1e-76
 Identities = 125/174 (71%), Positives = 150/174 (86%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TRHY F+V M+NVTRLCHTK ++TVNGK PGP I+ RE DR++IKV+NHV +N+SIHWHG
Sbjct: 33  TRHYSFHVRMKNVTRLCHTKPLITVNGKSPGPKIVVREDDRVIIKVHNHVKDNVSIHWHG 92

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILP 529
           IRQLRSGWADGPAYITQCPIQTGQ+Y Y +T+ GQRGTL+WHAHISWLRA++HG  II P
Sbjct: 93  IRQLRSGWADGPAYITQCPIQTGQTYTYNFTVTGQRGTLWWHAHISWLRASVHGAFIIYP 152

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           K+NV YPF KPYKEV ++ GEW+N DTE +I+Q++ TG GPNVSD Y+ING PG
Sbjct: 153 KRNVPYPFPKPYKEVTMVLGEWWNTDTEKVINQSMITGAGPNVSDCYSINGHPG 206



>gb:AP003240_1826033 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0406G08.
          Length = 577

 Score =  287 bits (734), Expect = 1e-76
 Identities = 131/173 (75%), Positives = 149/173 (86%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGI 352
           R Y+F+V   NVTRLC +KSIVTVNG++PGP + AREGD ++I+V NH   N+SIHWHGI
Sbjct: 30  REYQFDVKTTNVTRLCSSKSIVTVNGQFPGPTVFAREGDLVVIRVINHSPYNMSIHWHGI 89

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPK 532
           RQLRSGWADGPAYITQCPIQ G SYVYKYTI GQRGTL+WHAHISWLRAT++GPIIILPK
Sbjct: 90  RQLRSGWADGPAYITQCPIQPGGSYVYKYTITGQRGTLWWHAHISWLRATVYGPIIILPK 149

Query: 533 KNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
             V YPF  P KEVP++FGEW+  DTEA+ISQA QTGGGPNVSDA+TINGLPG
Sbjct: 150 AGVPYPFPAPDKEVPVVFGEWWKADTEAVISQATQTGGGPNVSDAFTINGLPG 202



>gb:AF047697_1763911 Oryza sativa putative high-pI laccase mRNA,
           partial cds.
          Length = 551

 Score =  284 bits (726), Expect = 1e-75
 Identities = 123/168 (73%), Positives = 152/168 (90%)
 Frame = +2

Query: 188 NVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQLRS 367
           NV M N TRLC+TKS+VTVNG+ PGP ++AREGDR++I+V N+VA+NIS+HWHG+RQ+R+
Sbjct: 8   NVQMANATRLCNTKSMVTVNGQCPGPELVAREGDRVVIRVTNNVAHNISLHWHGVRQVRT 67

Query: 368 GWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPKKNVSY 547
           GWADGPAYITQCPIQTGQSYVY +T+ GQRGTL+WHAHISWLRAT++G ++ILPK  V Y
Sbjct: 68  GWADGPAYITQCPIQTGQSYVYNFTVAGQRGTLWWHAHISWLRATVYGALVILPKLGVPY 127

Query: 548 PFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           PF  P+KEVP+IFGEW+N DTE +++QA+QTGGGPNVSDA+TINGLPG
Sbjct: 128 PFPAPHKEVPVIFGEWWNADTEEVVNQAVQTGGGPNVSDAFTINGLPG 175



>pir|T02752|T02752 probable laccase (EC 1.10.3.2) - rice (fragment)
          Length = 551

 Score =  284 bits (726), Expect = 1e-75
 Identities = 123/168 (73%), Positives = 152/168 (90%)
 Frame = +2

Query: 188 NVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQLRS 367
           NV M N TRLC+TKS+VTVNG+ PGP ++AREGDR++I+V N+VA+NIS+HWHG+RQ+R+
Sbjct: 8   NVQMANATRLCNTKSMVTVNGQCPGPELVAREGDRVVIRVTNNVAHNISLHWHGVRQVRT 67

Query: 368 GWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPKKNVSY 547
           GWADGPAYITQCPIQTGQSYVY +T+ GQRGTL+WHAHISWLRAT++G ++ILPK  V Y
Sbjct: 68  GWADGPAYITQCPIQTGQSYVYNFTVAGQRGTLWWHAHISWLRATVYGALVILPKLGVPY 127

Query: 548 PFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           PF  P+KEVP+IFGEW+N DTE +++QA+QTGGGPNVSDA+TINGLPG
Sbjct: 128 PFPAPHKEVPVIFGEWWNADTEEVVNQAVQTGGGPNVSDAFTINGLPG 175



>gb:AP003240_1826045 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0406G08.
          Length = 547

 Score =  281 bits (720), Expect = 6e-75
 Identities = 124/175 (70%), Positives = 149/175 (85%), Gaps = 1/175 (0%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TRHY FNV M NVTRLC TKSI TVNG++PGP ++ REGDRL++KV+NH+  N+S HWHG
Sbjct: 37  TRHYTFNVQMTNVTRLCVTKSIPTVNGQFPGPKLVVREGDRLVVKVHNHMNYNVSFHWHG 96

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILP 529
           I QLR+GWADGP+YITQCPIQ G SYVY +T+ GQRGTL+WHAH SWLR  L+GP++ILP
Sbjct: 97  ILQLRNGWADGPSYITQCPIQGGGSYVYDFTVTGQRGTLWWHAHFSWLRVHLYGPLVILP 156

Query: 530 KKNVSYPFVKPYKEV-PIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           K+   +PF +PYKE+ PI+FGEWFN DTEA+I+QALQTG GPN+SDAYT NGLPG
Sbjct: 157 KRGEGFPFPRPYKELPPIMFGEWFNADTEAVINQALQTGAGPNISDAYTFNGLPG 211



>gb:AF132126_1770860 Pinus taeda laccase (Lac8) mRNA, complete cds.
          Length = 577

 Score =  281 bits (719), Expect = 8e-75
 Identities = 124/175 (70%), Positives = 150/175 (85%), Gaps = 1/175 (0%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TRHY+FN+ ++NVTR+C TK IVTVNG++PGP I AREGD LLIKV NHV  N+SIHWHG
Sbjct: 40  TRHYKFNIQLKNVTRICRTKPIVTVNGEFPGPTIEAREGDTLLIKVTNHVKYNVSIHWHG 99

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILP 529
           +RQLR+GWADGPAYITQCPIQTGQ+YVY +T+ GQRGTL+WHAHI WLRATL+G I+ILP
Sbjct: 100 VRQLRTGWADGPAYITQCPIQTGQTYVYNFTVTGQRGTLWWHAHILWLRATLYGAIVILP 159

Query: 530 KKNVSYPF-VKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
             NV YPF  KP+KE+ ++ GEW+N D EA+I++ALQTG  PN+SDA+TING PG
Sbjct: 160 PPNVPYPFEPKPHKEITLVLGEWWNADVEAVINEALQTGAAPNISDAHTINGKPG 214



>gb:AF132125_1770859 Pinus taeda laccase (Lac7) mRNA, complete cds.
          Length = 555

 Score =  270 bits (690), Expect = 2e-71
 Identities = 121/174 (69%), Positives = 145/174 (83%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TRHY+F++  +NVTRLCHT+ IVT NGK+PGP I AREGD + +KV NHV  N+SIHWHG
Sbjct: 26  TRHYKFDIKFKNVTRLCHTEPIVTANGKFPGPTIHAREGDTVTVKVTNHVTYNVSIHWHG 85

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILP 529
           IRQLR+GWADGPAYITQCPIQTGQ++VY +TI GQRGTLFWHAHI WLRATL+GPI+ILP
Sbjct: 86  IRQLRTGWADGPAYITQCPIQTGQTFVYNFTITGQRGTLFWHAHILWLRATLYGPIVILP 145

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
            K   YPF KP+KEV +I GEW+N DTE +I+QA+ +G  PN SD++TING  G
Sbjct: 146 PKG-PYPFPKPHKEVILILGEWWNSDTETVINQAMNSGLAPNSSDSHTINGKAG 198



>pir|JC5229|JC5229 laccase (EC 1.10.3.2) precursor - common
           tobacco>gb:A68085_1450338 Sequence 1 from Patent
           WO9745549.>gb:NTU43542_1691831 Nicotiana tabacum
           diphenol oxidase mRNA, complete cds.
          Length = 557

 Score =  269 bits (687), Expect = 4e-71
 Identities = 121/173 (69%), Positives = 142/173 (82%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGI 352
           RHY+FNV M+N TRLC +K IVTVNGK+PGP I AREGD +L+KV NHV  N+SIHWHGI
Sbjct: 25  RHYKFNVVMKNTTRLCSSKPIVTVNGKFPGPTIYAREGDTVLVKVVNHVKYNLSIHWHGI 84

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPK 532
           RQLR+GWADGPAYITQCPIQ GQ+YVY +TI GQRGTLFWHAHI WLRAT+HG I+ILP 
Sbjct: 85  RQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTLFWHAHILWLRATVHGAIVILPN 144

Query: 533 KNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
             V YPF KP  E  +I  EW+  DTEA+I++A+++G  PNVSDA+TING PG
Sbjct: 145 LGVPYPFPKPNHEAVVILAEWWKSDTEAVINEAIKSGLAPNVSDAHTINGHPG 197



>gb:AC003028_1530965 Arabidopsis thaliana chromosome 2 clone F16M14
           map ve018, complete sequence.>gb:AY052669_1562829
           Arabidopsis thaliana At2g38080/T8P21. mRNA, complete
           cds.>gb:AY063730_1565722 Arabidopsis thaliana
           At2g38080/T8P21. mRNA, complete cds.>gb:AY065187_1566341
           Arabidopsis thaliana putative diphenol oxidase
           (At2g38080; F16M14.1) mRNA, complete
           cds.>gb:AY114636_1578678 Arabidopsis thaliana putative
           diphenol oxidase (At2g38080) mRNA, complete cds.
          Length = 558

 Score =  260 bits (664), Expect = 2e-68
 Identities = 117/173 (67%), Positives = 140/173 (80%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGI 352
           RHY+FNV M+NVTRLC +K  VTVNG+YPGP I ARE D LLIKV NHV  N+SIHWHG+
Sbjct: 27  RHYKFNVVMKNVTRLCSSKPTVTVNGRYPGPTIYAREDDTLLIKVVNHVKYNVSIHWHGV 86

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPK 532
           RQ+R+GWADGPAYITQCPIQ GQ Y Y YT+ GQRGTL+WHAHI WLRAT++G ++ILPK
Sbjct: 87  RQVRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLWWHAHILWLRATVYGALVILPK 146

Query: 533 KNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           + V YPF KP  E  I+ GEW+  DTE II++AL++G  PNVSD++ ING PG
Sbjct: 147 RGVPYPFPKPDNEKVIVLGEWWKSDTENIINEALKSGLAPNVSDSHMINGHPG 199



>pir|T01240|T01240 laccase (EC 1.10.3.2) F16M14.1 - Arabidopsis
           thaliana
          Length = 554

 Score =  260 bits (664), Expect = 2e-68
 Identities = 117/173 (67%), Positives = 140/173 (80%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGI 352
           RHY+FNV M+NVTRLC +K  VTVNG+YPGP I ARE D LLIKV NHV  N+SIHWHG+
Sbjct: 23  RHYKFNVVMKNVTRLCSSKPTVTVNGRYPGPTIYAREDDTLLIKVVNHVKYNVSIHWHGV 82

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPK 532
           RQ+R+GWADGPAYITQCPIQ GQ Y Y YT+ GQRGTL+WHAHI WLRAT++G ++ILPK
Sbjct: 83  RQVRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLWWHAHILWLRATVYGALVILPK 142

Query: 533 KNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           + V YPF KP  E  I+ GEW+  DTE II++AL++G  PNVSD++ ING PG
Sbjct: 143 RGVPYPFPKPDNEKVIVLGEWWKSDTENIINEALKSGLAPNVSDSHMINGHPG 195



>gb:BT014855_1641845 Arabidopsis thaliana At5g01190 gene, complete
           cds.
          Length = 558

 Score =  251 bits (642), Expect = 7e-66
 Identities = 111/173 (64%), Positives = 137/173 (79%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGI 352
           R Y FNV  + VTR+C TK IVTVNGK+PGP I A E D +L+ V N+V  N+SIHWHGI
Sbjct: 25  RKYTFNVVTKQVTRICSTKQIVTVNGKFPGPTIYANEDDTILVNVVNNVKYNVSIHWHGI 84

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPK 532
           RQLR+GWADGPAYITQCPI+ G SYVY +T+ GQRGTL+WHAH+ WLRAT+HG I+ILPK
Sbjct: 85  RQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWHAHVLWLRATVHGAIVILPK 144

Query: 533 KNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
             + YPF KP++E  II GEW+  DTE ++++AL++G  PNVSDA+ ING PG
Sbjct: 145 LGLPYPFPKPHREEVIILGEWWKSDTETVVNEALKSGLAPNVSDAHVINGHPG 197



>pir|T45959|T45959 laccase-like protein - Arabidopsis
           thaliana>gb:ATF7J8_1550998 Arabidopsis thaliana DNA
           chromosome 5, BAC clone F7J8 (ESSA project).
          Length = 553

 Score =  251 bits (642), Expect = 7e-66
 Identities = 111/173 (64%), Positives = 137/173 (79%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGI 352
           R Y FNV  + VTR+C TK IVTVNGK+PGP I A E D +L+ V N+V  N+SIHWHGI
Sbjct: 25  RKYTFNVVTKQVTRICSTKQIVTVNGKFPGPTIYANEDDTILVNVVNNVKYNVSIHWHGI 84

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPK 532
           RQLR+GWADGPAYITQCPI+ G SYVY +T+ GQRGTL+WHAH+ WLRAT+HG I+ILPK
Sbjct: 85  RQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWHAHVLWLRATVHGAIVILPK 144

Query: 533 KNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
             + YPF KP++E  II GEW+  DTE ++++AL++G  PNVSDA+ ING PG
Sbjct: 145 LGLPYPFPKPHREEVIILGEWWKSDTETVVNEALKSGLAPNVSDAHVINGHPG 197



>gb:AY065128_1566282 Arabidopsis thaliana laccase (diphenol
           oxidase)-like protein (MOK16.17) mRNA, complete
           cds.>gb:AY081592_1568852 Arabidopsis thaliana laccase
           (diphenol oxidase)-like protein (MOK16.17) mRNA,
           complete cds.
          Length = 557

 Score =  245 bits (625), Expect = 6e-64
 Identities = 106/173 (61%), Positives = 137/173 (79%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGI 352
           + Y+F+V ++N++R+C+ K IVTVNG +PGP + AREGDR++I V NHV  N+SIHWHG+
Sbjct: 26  KKYQFDVQVKNISRICNAKPIVTVNGMFPGPTVYAREGDRVIINVTNHVQYNMSIHWHGL 85

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPK 532
           +Q R+GWADGPAYITQCPIQTGQSY+Y + + GQRGTL+WHAHI WLRAT++G I+ILP 
Sbjct: 86  KQYRNGWADGPAYITQCPIQTGQSYLYDFNVTGQRGTLWWHAHILWLRATVYGAIVILPA 145

Query: 533 KNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
               YPF +PY+E  II GEW+N D E  ++QA Q G  P +SDA+TING PG
Sbjct: 146 PGKPYPFPQPYQESNIILGEWWNKDVETAVNQANQLGAPPPMSDAHTINGKPG 198



>pir|T48347|T48347 laccase-like protein F15A17.290 [similarity] -
           Arabidopsis thaliana>gb:AB005240_1509474 Arabidopsis
           thaliana genomic DNA, chromosome 5, P1
           clone:MOK16.>gb:ATF15A17_1548662 Arabidopsis thaliana
           DNA chromosome 5, BAC clone F15A17 (ESSA project).
          Length = 555

 Score =  245 bits (625), Expect = 6e-64
 Identities = 106/173 (61%), Positives = 137/173 (79%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGI 352
           + Y+F+V ++N++R+C+ K IVTVNG +PGP + AREGDR++I V NHV  N+SIHWHG+
Sbjct: 24  KKYQFDVQVKNISRICNAKPIVTVNGMFPGPTVYAREGDRVIINVTNHVQYNMSIHWHGL 83

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPK 532
           +Q R+GWADGPAYITQCPIQTGQSY+Y + + GQRGTL+WHAHI WLRAT++G I+ILP 
Sbjct: 84  KQYRNGWADGPAYITQCPIQTGQSYLYDFNVTGQRGTLWWHAHILWLRATVYGAIVILPA 143

Query: 533 KNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
               YPF +PY+E  II GEW+N D E  ++QA Q G  P +SDA+TING PG
Sbjct: 144 PGKPYPFPQPYQESNIILGEWWNKDVETAVNQANQLGAPPPMSDAHTINGKPG 196



>gb:AP004317_1840132 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0663E10.
          Length = 562

 Score =  241 bits (616), Expect = 7e-63
 Identities = 102/173 (58%), Positives = 133/173 (76%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGI 352
           + Y+F++ M NV+RLCH K++VTVNG YPGP I AREGDR+++ V NHV +N++IHWHG+
Sbjct: 29  KRYQFDIVMSNVSRLCHEKAMVTVNGSYPGPTIYAREGDRVIVNVTNHVKHNMTIHWHGL 88

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPK 532
           +Q R+GWADGPAY+TQCPI +G SYVY + +  QRGTL+WHAHI+W+RAT+HG I+ILP 
Sbjct: 89  KQRRNGWADGPAYVTQCPIGSGGSYVYDFNVTRQRGTLWWHAHIAWMRATVHGAIVILPA 148

Query: 533 KNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
             V YPF KP  E  I+ GEW++ D E +  Q    G  PN+SDA+TING PG
Sbjct: 149 AGVPYPFPKPDDEAEIVLGEWWHADVETVERQGSMLGMAPNMSDAHTINGKPG 201



>gb:PTY13771_1702844 Populus trichocarpa mRNA for laccase, lac3
           gene.
          Length = 555

 Score =  239 bits (610), Expect = 3e-62
 Identities = 105/173 (60%), Positives = 130/173 (75%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGI 352
           R Y F V + N T+LC +KSI T+NGK+PGP I AREGD + I++ N V  N+++HWHG+
Sbjct: 25  RLYNFRVVLTNTTKLCSSKSIPTINGKFPGPTIYAREGDNVNIRLTNQVQYNVTVHWHGV 84

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPK 532
               +GWADGPAYITQCPIQ GQSY+Y +T+ GQRGTL WHAHISWLRAT+HG I+I PK
Sbjct: 85  SSCFTGWADGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHAHISWLRATIHGAIVIFPK 144

Query: 533 KNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           K V YPF KP KE  II  EW+  D EA+++QA  TG  PN+SDA+T+NG  G
Sbjct: 145 KGVPYPFPKPDKEKIIILSEWWKADVEAVVNQATMTGLPPNISDAHTVNGHTG 197



>gb:PTR18218_1702693 Populus trichocarpa GLac3 gene.
          Length = 555

 Score =  239 bits (610), Expect = 3e-62
 Identities = 105/173 (60%), Positives = 130/173 (75%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGI 352
           R Y F V + N T+LC +KSI T+NGK+PGP I AREGD + I++ N V  N+++HWHG+
Sbjct: 25  RLYNFRVVLTNTTKLCSSKSIPTINGKFPGPTIYAREGDNVNIRLTNQVQYNVTVHWHGV 84

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPK 532
               +GWADGPAYITQCPIQ GQSY+Y +T+ GQRGTL WHAHISWLRAT+HG I+I PK
Sbjct: 85  SSCFTGWADGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHAHISWLRATIHGAIVIFPK 144

Query: 533 KNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           K V YPF KP KE  II  EW+  D EA+++QA  TG  PN+SDA+T+NG  G
Sbjct: 145 KGVPYPFPKPDKEKIIILSEWWKADVEAVVNQATMTGLPPNISDAHTVNGHTG 197



>gb:AP003734_1832581 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1088C09.
          Length = 567

 Score =  230 bits (587), Expect = 2e-59
 Identities = 100/172 (58%), Positives = 131/172 (76%)
 Frame = +2

Query: 176 HYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIR 355
           H+EF V    V RLC T +++TVNG+ PGP +  REGD ++I V NH   N++IHWHGIR
Sbjct: 28  HHEFIVQETPVKRLCKTHNVITVNGQLPGPTLEVREGDTVVINVVNHAQYNVTIHWHGIR 87

Query: 356 QLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPKK 535
           Q R+GWADGP ++TQCPI+ G SY Y++TI GQ GTL+WHAH SWLRAT++G +II P++
Sbjct: 88  QFRTGWADGPEFVTQCPIKPGGSYKYRFTIEGQEGTLWWHAHSSWLRATVYGALIIRPRE 147

Query: 536 NVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           N +YPF KP +EVP+I GEW++ D   +I +A +TG  PN+SDAYTING PG
Sbjct: 148 NKTYPFEKPAREVPLILGEWWDADPIQVIREAQRTGAAPNISDAYTINGQPG 199



>pir|F84828|F84828 probable laccase (diphenol oxidase) [imported] -
           Arabidopsis thaliana>gb:AC007020_1535043 Arabidopsis
           thaliana chromosome 2 clone T3G21 map g4514, complete
           sequence.>gb:AF506030_1806859 Arabidopsis thaliana
           laccase (lac1) mRNA, complete cds.
          Length = 580

 Score =  223 bits (569), Expect = 2e-57
 Identities = 91/172 (52%), Positives = 128/172 (74%)
 Frame = +2

Query: 176 HYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIR 355
           H+EF +    V RLC T + +TVNG +PGP ++   GD L++KV N    NI+IHWHG+R
Sbjct: 30  HHEFIIQATKVKRLCETHNSITVNGMFPGPMLVVNNGDTLVVKVINRARYNITIHWHGVR 89

Query: 356 QLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPKK 535
           Q+R+GWADGP ++TQCPI+ G SY Y++TI GQ GTL+WHAH SWLRAT++G +++ P  
Sbjct: 90  QMRTGWADGPEFVTQCPIRPGSSYTYRFTIQGQEGTLWWHAHSSWLRATVYGSLLVFPPA 149

Query: 536 NVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
             SYPF KP++ VP++ GEW++ +   ++ ++++TGG PN SDAYTING PG
Sbjct: 150 GSSYPFTKPHRNVPLLLGEWWDANPVDVLRESIRTGGAPNNSDAYTINGQPG 201



>gb:AF132120_1770854 Pinus taeda laccase (Lac2) mRNA, complete cds.
          Length = 576

 Score =  222 bits (566), Expect = 4e-57
 Identities = 94/164 (57%), Positives = 129/164 (78%), Gaps = 2/164 (1%)
 Frame = +2

Query: 206 VTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQLRSGWADGP 385
           V RLC T +I+TVNG++PGP +  R GD+L +KV+N    N +IHWHG+RQ R+GW+DGP
Sbjct: 47  VKRLCGTHNIITVNGQFPGPTLHVRNGDKLKVKVHNQAQYNATIHWHGVRQFRTGWSDGP 106

Query: 386 AYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPKKNVSYP--FVK 559
            +ITQCPI+ G+SY YK+TI GQ GTL+WHAH SWLRAT++G +IILP+ + +YP  F +
Sbjct: 107 EFITQCPIRPGRSYTYKFTITGQEGTLWWHAHSSWLRATVYGALIILPRLDTTYPFTFTR 166

Query: 560 PYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           P++++PI+ GEW+N +   +++QA QTG  PNVSDA+TING PG
Sbjct: 167 PHRQIPILLGEWWNRNPMDVVNQATQTGAAPNVSDAFTINGQPG 210



>gb:T10F20_1723317 Sequence of BAC T10F20 from Arabidopsis thaliana
           chromosome 1, complete sequence.
          Length = 581

 Score =  221 bits (563), Expect = 9e-57
 Identities = 99/176 (56%), Positives = 129/176 (73%), Gaps = 2/176 (1%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TR + FNV  + VTRLCHTK ++TVNG+YPGP +   EGD + IKV N +A+N +IHWHG
Sbjct: 28  TRRFHFNVEWKKVTRLCHTKQLLTVNGQYPGPTVAVHEGDIVEIKVTNRIAHNTTIHWHG 87

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILP 529
           +RQ R+GWADGPAYITQCPI++ QSY Y++ +  QRGTL WHAH SW RA+++G  II P
Sbjct: 88  LRQYRTGWADGPAYITQCPIRSKQSYTYRFKVEDQRGTLLWHAHHSWQRASVYGAFIIYP 147

Query: 530 KKNVSYPFVKPY--KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           ++   YPF   +   E+PII GEW+N D + +    ++TG G  VSDAYT+NGLPG
Sbjct: 148 RQ--PYPFSGSHIQSEIPIILGEWWNDDVDNVEKAMMKTGAGAKVSDAYTLNGLPG 201



>gb:AC105770_1738222 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1362_D02, complete
           sequence.>gb:AC105770_1738223 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OJ1362_D02, complete
           sequence.
          Length = 493

 Score =  219 bits (559), Expect = 3e-56
 Identities = 95/121 (78%), Positives = 110/121 (90%)
 Frame = +2

Query: 329 ISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLH 508
           +SIHWHGIRQL SGWADGP+YITQCPIQ G SYVY++TI GQRGTL+WHAHISWLRAT+H
Sbjct: 1   MSIHWHGIRQLLSGWADGPSYITQCPIQPGGSYVYRFTITGQRGTLWWHAHISWLRATVH 60

Query: 509 GPIIILPKKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLP 688
           GP++ILP   V YPF  P++EVPI+FGEW+N DTEA+ISQALQTGGGPN+SDAYT+NGLP
Sbjct: 61  GPMVILPPAGVGYPFPAPHEEVPIMFGEWWNNDTEAVISQALQTGGGPNISDAYTLNGLP 120

Query: 689 G 691
           G
Sbjct: 121 G 121



>gb:AB010692_1511112 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K18I23.
          Length = 565

 Score =  218 bits (555), Expect = 8e-56
 Identities = 92/173 (53%), Positives = 128/173 (73%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGI 352
           +H++F +    V RLC T++ +TVNG +PGP +    GD L +KV+N    NI+IHWHG+
Sbjct: 27  QHHDFVIQETPVKRLCKTRNAITVNGMFPGPTLEVNNGDTLEVKVHNRARYNITIHWHGV 86

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPK 532
           RQ+R+GWADGP ++TQCPI+ G+SY Y++TI GQ GTL+WHAH SWLRAT++G +II P 
Sbjct: 87  RQIRTGWADGPEFVTQCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIHPT 146

Query: 533 KNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
              S+PF KP ++  ++ GEW+N +   +I+QA +TG  PN+SDAYTING PG
Sbjct: 147 PGSSFPFPKPDRQTALMLGEWWNANPVDVINQATRTGAAPNISDAYTINGQPG 199



>gb:AF132122_1770856 Pinus taeda laccase (Lac4) mRNA, complete cds.
          Length = 570

 Score =  218 bits (554), Expect = 1e-55
 Identities = 92/169 (54%), Positives = 126/169 (74%)
 Frame = +2

Query: 185 FNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQLR 364
           F +   +V RLC T +I+TVNG++PGP +  R GD L++KV N+   N +IHWHG+RQ R
Sbjct: 35  FVLQSTSVKRLCGTHNIITVNGQFPGPTLHVRNGDTLVVKVYNNAQYNATIHWHGVRQFR 94

Query: 365 SGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPKKNVS 544
           +GW+DGP YITQCPI+ G SY Y++TI GQ GTL+WHAH SWLRAT++G ++I P    +
Sbjct: 95  TGWSDGPEYITQCPIRPGGSYTYRFTITGQEGTLWWHAHSSWLRATVYGALVISPSPGAT 154

Query: 545 YPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           YPF +P+ +VPI+ GEW++ +   ++ QA +TG  PNVSDA+TING PG
Sbjct: 155 YPFTRPHGQVPILLGEWWSRNPIDVVDQATRTGAAPNVSDAFTINGQPG 203



>gb:PTR18219_1702694 Populus trichocarpa GLac90
           gene.>gb:PTY13772_1702845 Populus trichocarpa mRNA for
           laccase, lac90 gene.
          Length = 574

 Score =  213 bits (542), Expect = 3e-54
 Identities = 93/175 (53%), Positives = 127/175 (72%), Gaps = 1/175 (0%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           T H++F V    V RLC T + +TVNG +PGP +  + GD L++KV N    N++IHWHG
Sbjct: 32  THHHDFTVQATKVKRLCKTHNSITVNGMFPGPTLEVKNGDTLVVKVVNRARYNVTIHWHG 91

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVG-QRGTLFWHAHISWLRATLHGPIIIL 526
           IRQ+R+GWADGP ++TQCPI+ G SY Y++TI G +R TL WHAH SWLRAT++G +II 
Sbjct: 92  IRQMRTGWADGPEFVTQCPIRPGGSYTYRFTIEGTRRNTLGWHAHSSWLRATVYGALIIH 151

Query: 527 PKKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           P++  SY F KP +E PI+ GEW++ +   ++ +A +TG  PN+SDAYTING PG
Sbjct: 152 PREGSSYSFSKPKRETPILLGEWWDTNPIDVVREATRTGAAPNISDAYTINGQPG 206



>gb:AY113187_1578253 Glycine max diphenol oxidase laccase mRNA,
           complete cds.>gb:AF527604_1808397 Glycine max diphenol
           oxidase laccase gene, complete cds.
          Length = 589

 Score =  213 bits (541), Expect = 3e-54
 Identities = 92/171 (53%), Positives = 123/171 (71%)
 Frame = +2

Query: 179 YEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQ 358
           +EF V    V RLC T + +TVNG+YPGP +    GD L++KV N    N++IHWHG+RQ
Sbjct: 39  HEFVVEATPVKRLCKTHNSITVNGQYPGPTLEINNGDTLVVKVTNKARYNVTIHWHGVRQ 98

Query: 359 LRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPKKN 538
           +R+GWADGP ++T  P   G SY Y++T+ GQ GTL+WHAH SWLRAT++G +II P++ 
Sbjct: 99  MRTGWADGPEFVTSVPDCPGGSYTYRFTVQGQEGTLWWHAHSSWLRATVYGALIIRPREG 158

Query: 539 VSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
             YPF KP +E PI+ GEW++ +   ++ QA +TGG PNVSDAYTING PG
Sbjct: 159 EPYPFPKPKRETPILLGEWWDANPIDVVRQATRTGGAPNVSDAYTINGQPG 209



>pir|E86316|E86316 protein T10O22.11 [imported] - Arabidopsis
           thaliana>gb:AE005172_890778 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC069551_1540952 Genomic sequence for
           Arabidopsis thaliana BAC T10O22 from chromosome I,
           complete sequence.
          Length = 576

 Score =  212 bits (540), Expect = 4e-54
 Identities = 98/177 (55%), Positives = 128/177 (72%), Gaps = 3/177 (1%)
 Frame = +2

Query: 170 TRHYEFN-VTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWH 346
           T  Y+ N V  + VTRLCHTK ++TVNG+YPGP +   EGD + IKV N +A+N +IHWH
Sbjct: 22  TLTYQSNYVEWKKVTRLCHTKQLLTVNGQYPGPTVAVHEGDIVEIKVTNRIAHNTTIHWH 81

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIIL 526
           G+RQ R+GWADGPAYITQCPI++ QSY Y++ +  QRGTL WHAH SW RA+++G  II 
Sbjct: 82  GLRQYRTGWADGPAYITQCPIRSKQSYTYRFKVEDQRGTLLWHAHHSWQRASVYGAFIIY 141

Query: 527 PKKNVSYPFVKPY--KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           P++   YPF   +   E+PII GEW+N D + +    ++TG G  VSDAYT+NGLPG
Sbjct: 142 PRQ--PYPFSGSHIQSEIPIILGEWWNDDVDNVEKAMMKTGAGAKVSDAYTLNGLPG 196



>gb:ATAC011436_1543241 Arabidopsis thaliana chromosome III BAC F3L24
           genomic sequence, complete sequence.>gb:BT004971_1637917
           Arabidopsis thaliana clone U50490 putative laccase
           (diphenol oxidase) (At3g09220) mRNA, complete
           cds.>gb:AK117639_1815664 Arabidopsis thaliana At3g09220
           mRNA for putative laccase, complete cds, clone:
           RAFL17-29-M06.
          Length = 567

 Score =  212 bits (539), Expect = 6e-54
 Identities = 99/171 (57%), Positives = 121/171 (70%)
 Frame = +2

Query: 179 YEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQ 358
           + FNV    V+RLC  + I  VNG  PGP I  +EGD L+I V NH  +NI+IHWHGI  
Sbjct: 28  HTFNVQNLTVSRLCKRQVITVVNGSLPGPTIRVKEGDSLVIHVLNHSPHNITIHWHGIFH 87

Query: 359 LRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPKKN 538
             + WADGP+ ITQCPIQ GQ Y Y++ I GQ GTL+WHAH S+LRAT++G ++I PK  
Sbjct: 88  KLTVWADGPSMITQCPIQPGQRYAYRFNITGQEGTLWWHAHASFLRATVYGALVIRPKSG 147

Query: 539 VSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
            SYPF KP+KEVPI+FGEW+N D  A+   A+ TG  PN SDAYTING PG
Sbjct: 148 HSYPFPKPHKEVPILFGEWWNTDVVALEEAAIATGVPPNNSDAYTINGRPG 198



>pir|T00579|T00579 probable laccase [imported] - Arabidopsis
           thaliana>gb:AC002338_1530477 Arabidopsis thaliana
           chromosome 2 clone T9D9 map m283, complete
           sequence.>gb:AC004165_1531505 Arabidopsis thaliana
           chromosome 2 clone T27E13 map m283, complete sequence.
          Length = 570

 Score =  209 bits (532), Expect = 4e-53
 Identities = 94/171 (54%), Positives = 120/171 (70%)
 Frame = +2

Query: 179 YEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQ 358
           ++F +T   V RLC T   +TVNG+YPGP ++ R GD L I V N    NISIHWHGIRQ
Sbjct: 30  HQFVITPTPVKRLCRTHQSITVNGQYPGPTLVVRNGDSLAITVINRARYNISIHWHGIRQ 89

Query: 359 LRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPKKN 538
           LR+ WADGP YITQCPI+ GQ+Y Y++ I  Q GTL+WHAH  WLRAT++G +II P+  
Sbjct: 90  LRNPWADGPEYITQCPIRPGQTYTYRFKIEDQEGTLWWHAHSRWLRATVYGALIIYPRLG 149

Query: 539 VSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
             YPF  P +++PI+ GEW++ +   ++ QA  TG   NVSDAYTING PG
Sbjct: 150 SPYPFSMPKRDIPILLGEWWDRNPMDVLKQAQFTGAAANVSDAYTINGQPG 200



>pir|E84904|E84904 probable laccase (diphenol oxidase) [imported] -
           Arabidopsis thaliana>gb:AC006418_1534132 Arabidopsis
           thaliana chromosome 2 clone F13A10 map CIC06C03,
           complete sequence.
          Length = 569

 Score =  209 bits (532), Expect = 4e-53
 Identities = 97/205 (47%), Positives = 133/205 (64%)
 Frame = +2

Query: 77  MAATYLPQMFSMAIIXXXXXXXXXXXXXXXXTRHYEFNVTMQNVTRLCHTKSIVTVNGKY 256
           M ++ +P +F ++ +                TR Y+F V    +TRLC T  IVTVN K+
Sbjct: 1   MTSSAVPSLFRLSFLLFTLQVMNIGRIGAA-TRFYQFKVQTIRLTRLCQTNEIVTVNKKF 59

Query: 257 PGPPILAREGDRLLIKVNNHVANNISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYK 436
           PGP I A+E DR++IKV N    N +IHWHGI+Q RS W DGP+YITQCPIQ+GQS+ Y 
Sbjct: 60  PGPAISAQEDDRIVIKVINMTPYNTTIHWHGIKQKRSCWYDGPSYITQCPIQSGQSFTYN 119

Query: 437 YTIVGQRGTLFWHAHISWLRATLHGPIIILPKKNVSYPFVKPYKEVPIIFGEWFNGDTEA 616
           + +  Q+GT  WHAH SWLRAT++GP+I+ PK +V YPF KP+ E  I+ GE++  +   
Sbjct: 120 FKVAQQKGTFLWHAHFSWLRATVYGPLIVYPKASVPYPFKKPFNEHTILLGEYWLKNVVE 179

Query: 617 IISQALQTGGGPNVSDAYTINGLPG 691
           +    L++GG P  +DA+TING PG
Sbjct: 180 LEQHVLESGGPPPPADAFTINGQPG 204



>gb:AP004774_1844827 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0431B06.
          Length = 579

 Score =  206 bits (525), Expect = 2e-52
 Identities = 90/174 (51%), Positives = 127/174 (72%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TRHY+F +T  N TRLCH KSI+TVNG++PGP I AR+GD +++ V+N+   NI+IHWHG
Sbjct: 30  TRHYDFFITETNYTRLCHEKSILTVNGQFPGPTIYARKGDLVIVNVHNNGNKNITIHWHG 89

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILP 529
           + Q R+ W+DGP +ITQCPI+ G ++ Y+  +  + GTL+WHAH  + RAT+HG I+I P
Sbjct: 90  VDQPRNPWSDGPEFITQCPIRPGGNFTYQVILSEEEGTLWWHAHSDFDRATVHGAIVIHP 149

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           K+  ++PF KP KE+P+I GEW+N D E ++ +A   GG  + S+A TIN  PG
Sbjct: 150 KRGTTFPFKKPDKEIPVILGEWWNDDIEHVLDKAQLLGGDVDPSNANTINAQPG 203



>gb:AY464022_1607883 Zea mays genotype B73 laccase 1 (Lac1) gene,
           partial cds.
          Length = 150

 Score =  206 bits (525), Expect = 2e-52
 Identities = 87/128 (67%), Positives = 110/128 (85%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TR Y FNVTM  VTRLC TKS+ TVNG++PGP ++ REGDRL+++V+N++ +N++ HWHG
Sbjct: 22  TRRYTFNVTMATVTRLCVTKSVPTVNGRFPGPRLVVREGDRLVVQVHNNINSNVTFHWHG 81

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILP 529
           +RQLRSGWADGP+YITQCPI+ GQSY Y + IVGQRGTL+WHAH SWLRATL+GP++ILP
Sbjct: 82  VRQLRSGWADGPSYITQCPIRPGQSYAYDFRIVGQRGTLWWHAHFSWLRATLYGPLVILP 141

Query: 530 KKNVSYPF 553
            + V YPF
Sbjct: 142 PRGVPYPF 149



>gb:AY464017_1607878 Zea mays genotype Wis93-3520 laccase 1 (Lac1)
           gene, partial cds.>gb:AY464026_1607887 Zea mays genotype
           F7012 laccase 1 (Lac1) gene, partial
           cds.>gb:AY464030_1607891 Zea mays genotype Mo17 laccase
           1 (Lac1) gene, partial cds.>gb:AY464033_1607894 Zea mays
           genotype PolarDent laccase 1 (Lac1) gene, partial
           cds.>gb:AY464038_1607899 Zea mays genotype EP1 laccase 1
           (Lac1) gene, partial cds.>gb:AY464042_1607903 Zea mays
           genotype F227 laccase 1 (Lac1) gene, partial
           cds.>gb:AY464051_1607912 Zea mays genotype Wis94-443
           laccase 1 (Lac1) gene, partial cds.
          Length = 150

 Score =  206 bits (524), Expect = 3e-52
 Identities = 87/128 (67%), Positives = 110/128 (85%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TR Y FNVTM  VTRLC TKS+ TVNG++PGP ++ REGDRL+++V+N++ +N++ HWHG
Sbjct: 22  TRSYTFNVTMATVTRLCVTKSVPTVNGRFPGPRLVVREGDRLVVQVHNNINSNVTFHWHG 81

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILP 529
           +RQLRSGWADGP+YITQCPI+ GQSY Y + IVGQRGTL+WHAH SWLRATL+GP++ILP
Sbjct: 82  VRQLRSGWADGPSYITQCPIRPGQSYAYDFRIVGQRGTLWWHAHFSWLRATLYGPLVILP 141

Query: 530 KKNVSYPF 553
            + V YPF
Sbjct: 142 PRGVPYPF 149



>gb:AY464016_1607877 Zea mays genotype W117 laccase 1 (Lac1) gene,
           partial cds.>gb:AY464018_1607879 Zea mays genotype F113
           laccase 1 (Lac1) gene, partial cds.>gb:AY464019_1607880
           Zea mays genotype F7 laccase 1 (Lac1) gene, partial
           cds.>gb:AY464020_1607881 Zea mays genotype line16
           laccase 1 (Lac1) gene, partial cds.>gb:AY464021_1607882
           Zea mays genotype Du101 laccase 1 (Lac1) gene, partial
           cds.>gb:AY464023_1607884 Zea mays genotype F2 laccase 1
           (Lac1) gene, partial cds.>gb:AY464024_1607885 Zea mays
           genotype F324 laccase 1 (Lac1) gene, partial
           cds.>gb:AY464025_1607886 Zea mays genotype F4 laccase 1
           (Lac1) gene, partial cds.>gb:AY464027_1607888 Zea mays
           genotype F7025 laccase 1 (Lac1) gene, partial
           cds.>gb:AY464028_1607889 Zea mays genotype Lan496
           laccase 1 (Lac1) gene, partial cds.>gb:AY464029_1607890
           Zea mays genotype MBS847 laccase 1 (Lac1) gene, partial
           cds.>gb:AY464031_1607892 Zea mays genotype Sibiriacka
           laccase 1 (Lac1) gene, partial cds.>gb:AY464032_1607893
           Zea mays genotype Quebec28 laccase 1 (Lac1) gene,
           partial cds.>gb:AY464034_1607895 Zea mays genotype
           Noordlander laccase 1 (Lac1) gene, partial
           cds.>gb:AY464035_1607896 Zea mays genotype Rainbowflint
           laccase 1 (Lac1) gene, partial cds.>gb:AY464036_1607897
           Zea mays genotype B14 laccase 1 (Lac1) gene, partial
           cds.>gb:AY464037_1607898 Zea mays genotype DE811 laccase
           1 (Lac1) gene, partial cds.>gb:AY464039_1607900 Zea mays
           genotype F120 laccase 1 (Lac1) gene, partial
           cds.>gb:AY464040_1607901 Zea mays genotype F1 laccase 1
           (Lac1) gene, partial cds.>gb:AY464041_1607902 Zea mays
           genotype F226 laccase 1 (Lac1) gene, partial
           cds.>gb:AY464043_1607904 Zea mays genotype F271 laccase
           1 (Lac1) gene, partial cds.>gb:AY464044_1607905 Zea mays
           genotype F286 laccase 1 (Lac1) gene, partial
           cds.>gb:AY464045_1607906 Zea mays genotype F288 laccase
           1 (Lac1) gene, partial cds.>gb:AY464046_1607907 Zea mays
           genotype F564 laccase 1 (Lac1) gene, partial
           cds.>gb:AY464047_1607908 Zea mays genotype F64 laccase 1
           (Lac1) gene, partial cds.>gb:AY464048_1607909 Zea mays
           genotype F66 laccase 1 (Lac1) gene, partial
           cds.>gb:AY464049_1607910 Zea mays genotype line212
           laccase 1 (Lac1) gene, partial cds.>gb:AY464050_1607911
           Zea mays genotype W64A laccase 1 (Lac1) gene, partial
           cds.
          Length = 150

 Score =  206 bits (524), Expect = 3e-52
 Identities = 87/128 (67%), Positives = 110/128 (85%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TR Y FNVTM  VTRLC TKS+ TVNG++PGP ++ REGDRL+++V+N++ +N++ HWHG
Sbjct: 22  TRRYTFNVTMATVTRLCVTKSVPTVNGQFPGPRLVVREGDRLVVQVHNNINSNVTFHWHG 81

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILP 529
           +RQLRSGWADGP+YITQCPI+ GQSY Y + IVGQRGTL+WHAH SWLRATL+GP++ILP
Sbjct: 82  VRQLRSGWADGPSYITQCPIRPGQSYAYDFRIVGQRGTLWWHAHFSWLRATLYGPLVILP 141

Query: 530 KKNVSYPF 553
            + V YPF
Sbjct: 142 PRGVPYPF 149



>gb:ATT5E8_1556131 Arabidopsis thaliana DNA chromosome 5, BAC clone
           T5E8 (ESSA project).
          Length = 569

 Score =  206 bits (523), Expect = 4e-52
 Identities = 87/173 (50%), Positives = 125/173 (72%), Gaps = 1/173 (0%)
 Frame = +2

Query: 176 HYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIR 355
           H+ F +  +  TRLC+T  I+TVNG++PGP + A  GD+L++ V N+   NI++HWHG R
Sbjct: 37  HHTFKIKSKAYTRLCNTNKILTVNGEFPGPTLKAYRGDKLIVNVINNANYNITLHWHGAR 96

Query: 356 QLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPKK 535
           Q+R+ W+DGP Y+TQCPI+ G+SYVY+  +  + GT++WHAH  W RAT+HG  I+ PK+
Sbjct: 97  QIRNPWSDGPEYVTQCPIRPGESYVYRIDLKVEEGTIWWHAHSQWARATVHGAFIVYPKR 156

Query: 536 NVSYPFVKPYKEVPIIFGEWFNGDT-EAIISQALQTGGGPNVSDAYTINGLPG 691
             SYPF KP++E+P+I GEW+  +    I  +A +TGG P +SD+YTING PG
Sbjct: 157 GSSYPFPKPHREIPLILGEWWKKENIMHIPGKANKTGGEPAISDSYTINGQPG 209



>gb:BT002919_1636509 Arabidopsis thaliana clone RAFL15-04-D21
           (R20177) putative laccase (diphenol oxidase) family
           protein (At5g48100) mRNA, complete
           cds.>gb:BT005152_1638098 Arabidopsis thaliana clone
           U20177 putative laccase (diphenol oxidase) family
           protein (At5g48100) mRNA, complete cds.
          Length = 565

 Score =  190 bits (483), Expect = 2e-47
 Identities = 84/172 (48%), Positives = 113/172 (65%)
 Frame = +2

Query: 176 HYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIR 355
           HY F V     T+LC TK+I+TVN ++PGP I   +GD + + V N  + NI++HWHG+ 
Sbjct: 23  HYTFTVREVPYTKLCSTKAILTVNSQFPGPIIKVHKGDTIYVNVQNRASENITMHWHGVE 82

Query: 356 QLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPKK 535
           Q R+ W+DGP YITQCPI+ G  ++YK     +  T++WHAH SW RAT+HG I + P+ 
Sbjct: 83  QPRNPWSDGPEYITQCPIRPGSDFLYKVIFSIEDTTVWWHAHSSWTRATVHGLIFVYPRP 142

Query: 536 NVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
               PF K   EVPII GEW+  D   ++ + ++TGG PNVSDA TING PG
Sbjct: 143 PQILPFPKADHEVPIILGEWWKRDVREVVEEFVRTGGAPNVSDALTINGHPG 194



>pir|T48484|T48484 laccase-like protein - Arabidopsis
           thaliana>gb:ATT28J14_1555594 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T28J14 (ESSA project).
          Length = 569

 Score =  190 bits (482), Expect = 2e-47
 Identities = 88/173 (50%), Positives = 119/173 (68%), Gaps = 2/173 (1%)
 Frame = +2

Query: 179 YEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQ 358
           +EF +    V RLC   + +TVNG++PGP +  R GD L+I   N    NIS+HWHGIRQ
Sbjct: 26  HEFVIQETPVKRLCRVHNSITVNGQFPGPTLEVRNGDSLVITAINKARYNISLHWHGIRQ 85

Query: 359 LRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPK-K 535
           +R+ WADGP YITQCPIQ G SY Y++T+  Q GTL+WHAH  WLRAT++G +II P   
Sbjct: 86  MRNPWADGPEYITQCPIQPGGSYTYRFTMEDQEGTLWWHAHSRWLRATVYGALIIRPPLS 145

Query: 536 NVSYPF-VKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           +  YPF V P +E+ ++ GEW++ +   +++ A  TG  PN+SDA+TING PG
Sbjct: 146 SPHYPFPVIPKREITLLLGEWWDRNPMDVLNLAQFTGAAPNISDAFTINGQPG 198



>gb:AP003199_1825016 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1045D11.
          Length = 577

 Score =  189 bits (481), Expect = 3e-47
 Identities = 86/174 (49%), Positives = 121/174 (69%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TRHY+F +T  N TRLCH KSI+TVNG++PGP I AR+GD +++ V+N+   NI+IHWHG
Sbjct: 31  TRHYDFFITETNYTRLCHEKSILTVNGQFPGPTIYARKGDFIIVNVHNNGNKNITIHWHG 90

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILP 529
           + Q R+ W+DGP +ITQCPI+ G ++ Y+  +  + GTL+WHAH  + RAT+HG I+I P
Sbjct: 91  VDQPRNPWSDGPEFITQCPIRPGGNFTYQVILFEEEGTLWWHAHSDFDRATVHGAIVIHP 150

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           K+  ++ F K  KE+P     W+N D E ++ +A + GG    SD  TING PG
Sbjct: 151 KRGTTFLFRKLDKEIP-----WWNDDVEHVLDKAKRIGGDVEPSDTNTINGQPG 199



>gb:AP003242_1826097 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0414E03.>gb:AP004072_1837290 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0529H11.
          Length = 516

 Score =  189 bits (479), Expect = 5e-47
 Identities = 85/174 (48%), Positives = 118/174 (67%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           T +Y F V    V+RLC++  I+ VNG  PGP I   EGD + ++V N    N++IHWHG
Sbjct: 30  TANYTFTVESMRVSRLCNSTDIIAVNGLLPGPMIEVNEGDAVAVEVINGSPYNLTIHWHG 89

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILP 529
           I QL + WADGP+ +TQCPIQ   SY Y++ + GQ GTL+WHAH S+LRAT++G +II P
Sbjct: 90  ILQLLTPWADGPSMVTQCPIQPNSSYTYRFNVTGQEGTLWWHAHSSFLRATVYGALIIRP 149

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           +   +YPF  P +EVPI+ GEW++ +   I S A+ +G  P  SDA+T+NG+ G
Sbjct: 150 RNGSAYPFPAPDQEVPIVLGEWWSRNVVDIESDAVSSGQLPRESDAFTVNGVTG 203



>gb:AP003242_1826096 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0414E03.>gb:AP004072_1837289 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0529H11.
          Length = 559

 Score =  189 bits (479), Expect = 5e-47
 Identities = 85/174 (48%), Positives = 118/174 (67%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           T +Y F V    V+RLC++  I+ VNG  PGP I   EGD + ++V N    N++IHWHG
Sbjct: 30  TANYTFTVESMRVSRLCNSTDIIAVNGLLPGPMIEVNEGDAVAVEVINGSPYNLTIHWHG 89

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILP 529
           I QL + WADGP+ +TQCPIQ   SY Y++ + GQ GTL+WHAH S+LRAT++G +II P
Sbjct: 90  ILQLLTPWADGPSMVTQCPIQPNSSYTYRFNVTGQEGTLWWHAHSSFLRATVYGALIIRP 149

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           +   +YPF  P +EVPI+ GEW++ +   I S A+ +G  P  SDA+T+NG+ G
Sbjct: 150 RNGSAYPFPAPDQEVPIVLGEWWSRNVVDIESDAVSSGQLPRESDAFTVNGVTG 203



>gb:AP003242_1826095 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0414E03.>gb:AP004072_1837288 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0529H11.
          Length = 580

 Score =  187 bits (476), Expect = 1e-46
 Identities = 82/173 (47%), Positives = 118/173 (68%), Gaps = 2/173 (1%)
 Frame = +2

Query: 179 YEFNVTMQNVTRLCH--TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGI 352
           + FNV   ++ R+C     S+  VNG+ PGP + AREGD ++I V N    N+++HWHG+
Sbjct: 27  HTFNVATLSLPRICQPGNTSVTAVNGRVPGPQVEAREGDTVVIHVINDSPYNVTVHWHGV 86

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPK 532
            Q  + WADGPA +TQCPI+ G  Y Y++ + GQ GTL+WHAH S++RAT++G ++I P+
Sbjct: 87  FQRGTPWADGPAMVTQCPIRPGHRYTYRFAVAGQEGTLWWHAHSSYMRATVYGALVIRPR 146

Query: 533 KNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           +   YPF  PY+E  ++ GEW+NGD  A+ SQ+  TG     +DAYTING+PG
Sbjct: 147 RAGGYPFPTPYEEKTVLLGEWWNGDPVALESQSFSTGIPAPNADAYTINGMPG 199



>gb:AF465470_1802145 Lolium perenne laccase LAC5-4 mRNA, complete
           cds.
          Length = 610

 Score =  187 bits (476), Expect = 1e-46
 Identities = 82/169 (48%), Positives = 117/169 (69%)
 Frame = +2

Query: 185 FNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQLR 364
           + V    + +LC++  I+ VNG+ PGP I   EGD +++ V N    N++IHWHGI QLR
Sbjct: 44  YQVQSMRINQLCNSTDIIAVNGQLPGPTIDVFEGDEVVVDVINSSPYNLTIHWHGIMQLR 103

Query: 365 SGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPKKNVS 544
           + WADGP+ +TQCPIQ   SY+Y++ + GQ GTL+WHAH S+LRAT++G  II P+K  +
Sbjct: 104 TPWADGPSMVTQCPIQPNSSYIYRFNVTGQEGTLWWHAHSSFLRATVYGAFIIRPRKGNA 163

Query: 545 YPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           YPF  P +EVPI+ GEW++ +   + + A+ +G  P  SDAYT+NGL G
Sbjct: 164 YPFPMPDQEVPIVLGEWWSQNVVDVENDAVMSGQRPIQSDAYTVNGLTG 212



>gb:AB062449_1522121 Rhus vernicifera mRNA for laccase, partial cds.
          Length = 533

 Score =  185 bits (470), Expect = 6e-46
 Identities = 77/169 (45%), Positives = 113/169 (66%)
 Frame = +2

Query: 176 HYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIR 355
           +Y F +  +N T+ C TKS++ VNG +PGP I AR+GD + + V N     ++IHWHG++
Sbjct: 5   NYTFVLQEKNFTKWCSTKSMLVVNGSFPGPTITARKGDTIFVNVINQGKYGLTIHWHGVK 64

Query: 356 QLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPKK 535
           Q R+ W+DGP YITQCPI+ G +++Y+  +  + GTL+WHAH  W RAT+HG ++ILP  
Sbjct: 65  QPRNPWSDGPEYITQCPIKPGTNFIYEVILSTEEGTLWWHAHSDWTRATVHGALVILPAN 124

Query: 536 NVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
             +YPF  PY+E  I+   WF GD   +I+ + +TG  P  +D +TING
Sbjct: 125 GTTYPFPPPYQEQTIVLASWFKGDVMEVITSSEETGVFPAAADGFTING 173



>gb:APU12757_1541984 Acer pseudoplatanus laccase mRNA, complete cds.
          Length = 565

 Score =  184 bits (468), Expect = 1e-45
 Identities = 79/173 (45%), Positives = 109/173 (63%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGI 352
           RHY+F V   N +RLC TKS++TVN  +PGP I   +GD + + V+N     I+IHWHG+
Sbjct: 26  RHYDFVVKESNFSRLCSTKSMLTVNDSFPGPEIHVHKGDTVFVNVHNQGTYGITIHWHGV 85

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPK 532
           +  R+ W+DGP Y+TQCPI  G ++  +     + GTL+WHAH  W RAT+HG III P 
Sbjct: 86  KMPRNPWSDGPEYVTQCPIPAGTNFTQEINFSTEEGTLWWHAHSDWSRATVHGAIIIYPA 145

Query: 533 KNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
              +YP+ KPY E  I+   W+  D   +  +A+ +G   N SDA+TING PG
Sbjct: 146 HGTTYPYPKPYGEQTIVLASWYKADVMEVYEEAVASGAEFNTSDAFTINGQPG 198



>gb:AB083127_1524161 Rhus vernicifera lac2 mRNA for laccase2,
           partial cds.
          Length = 530

 Score =  184 bits (467), Expect = 1e-45
 Identities = 77/169 (45%), Positives = 112/169 (66%)
 Frame = +2

Query: 176 HYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIR 355
           +Y F +  +N T+ C TKS++ VNG +PGP I AR+GD + + V N     I+IHWHG++
Sbjct: 5   NYTFVLQEKNFTKWCSTKSMLVVNGSFPGPTITARKGDTIFVNVINQGKYGITIHWHGVK 64

Query: 356 QLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPKK 535
           Q R+ W+DGP YITQCPI+ G +++Y+  +  + GT++WHAH  W RAT+HG ++ILP  
Sbjct: 65  QPRNPWSDGPEYITQCPIKPGTNFIYEVILSTEEGTIWWHAHSDWTRATVHGALVILPAN 124

Query: 536 NVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
             +YPF  PY+E  I+   WF GD   +I  + +TG  P  +D +TING
Sbjct: 125 GTTYPFPPPYQEQTIVLASWFKGDVMEVIISSEETGVFPAAADGFTING 173



>gb:AP004072_1837291 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0529H11.
          Length = 520

 Score =  179 bits (455), Expect = 3e-44
 Identities = 83/172 (48%), Positives = 112/172 (65%), Gaps = 1/172 (0%)
 Frame = +2

Query: 179 YEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQ 358
           + F V    +T+LC    I T N + PGP I   EGD L++   N     +S+HWHG+ Q
Sbjct: 26  HTFKVGGTKITQLCMNSVIYTANQQLPGPTIEVTEGDTLVVHAVNDSPYPLSLHWHGVYQ 85

Query: 359 LRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPKKN 538
           LRSGW DG   ITQCPIQ   ++ Y++ I GQ GTL+WHAH S LRAT++G +II P+  
Sbjct: 86  LRSGWNDGANKITQCPIQPSGNFTYRFNITGQEGTLWWHAHSSLLRATIYGALIIKPRNG 145

Query: 539 VS-YPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
            S YPF +PY+E+PI+ GEW+N + + + +    TG GP +SDA TING+PG
Sbjct: 146 PSGYPFPEPYEEIPILLGEWWNRNVDDVENDGYLTGLGPQISDALTINGMPG 197



>gb:AP005869_1859329 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:B1026C12.
          Length = 583

 Score =  176 bits (447), Expect = 3e-43
 Identities = 85/177 (48%), Positives = 114/177 (64%), Gaps = 6/177 (3%)
 Frame = +2

Query: 179 YEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQ 358
           + F+V    V RL   + I  VNG++PGP + AR GD LL++V N+   NI+IHWHG+ Q
Sbjct: 35  HTFHVGNLTVERLGQRQVITAVNGQFPGPKVEARNGDTLLVRVVNNSPYNITIHWHGVLQ 94

Query: 359 LRSGWADGPAYITQCPI----QTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIIL 526
             S WADGPA +TQCPI      G SY Y++ + GQ GTL+WHAH+S+LRAT++G ++I 
Sbjct: 95  RLSAWADGPAMVTQCPILPGSGAGSSYTYRFNVTGQEGTLWWHAHVSFLRATVYGALLIR 154

Query: 527 PKKNVSYPFVKPYKEVPIIFGEWFNGDTEA--IISQALQTGGGPNVSDAYTINGLPG 691
           P+  V YPF  P+ E  ++ GEW+N       +  QA  TGG P  S A TING+PG
Sbjct: 155 PRPGVPYPFPAPHAEHTLLLGEWWNASATLVDVERQAFLTGGQPANSVALTINGMPG 211



>gb:AY423714_1605485 Gossypium arboreum secretory laccase (Lac1)
           mRNA, complete cds.
          Length = 566

 Score =  173 bits (438), Expect = 3e-42
 Identities = 75/172 (43%), Positives = 105/172 (61%)
 Frame = +2

Query: 176 HYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIR 355
           HYEF V   N T+LC+T +++ VN  YPGP I    GD + + V+N      +IHWHG++
Sbjct: 29  HYEFFVRESNFTKLCNTTTLLVVNDSYPGPEIRVHRGDTVFVNVHNQGNYGFTIHWHGVK 88

Query: 356 QLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPKK 535
           Q R+ W+DGP ++TQCPIQ G ++ Y+  +  + GTL+WHAH  W R ++HG  +ILP K
Sbjct: 89  QPRNPWSDGPEFVTQCPIQPGTNFTYEIVLSDEIGTLWWHAHSDWTRGSVHGAFVILPAK 148

Query: 536 NVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
             +YPF  P  +  II   W++GD + II  AL  G  P    AY I+G  G
Sbjct: 149 KETYPFPTPDADQTIILESWYDGDYKQIIDDALAAGVSPRQPSAYAISGHVG 200



>gb:AK117360_1815399 Arabidopsis thaliana At5g01040 mRNA for
           putative laccase, complete cds, clone: RAFL16-93-C12.
          Length = 234

 Score =  172 bits (436), Expect = 5e-42
 Identities = 84/162 (51%), Positives = 105/162 (64%)
 Frame = +2

Query: 206 VTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQLRSGWADGP 385
           V  LC  + I   NG  PGP I  REGD L++ V N+   N++IHWHG+ QL+S W DG 
Sbjct: 39  VKPLCKEQIIPAANGSLPGPTINVREGDTLVVNVINNSTYNVTIHWHGVFQLKSVWMDGA 98

Query: 386 AYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPKKNVSYPFVKPY 565
             ITQCPIQ G ++ Y++ I GQ GTL WHAH+  LRATLHG ++I P+    YPF KPY
Sbjct: 99  NMITQCPIQPGYNFTYQFDITGQEGTLLWHAHVVNLRATLHGALVIRPRSGRPYPFPKPY 158

Query: 566 KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           KEVPI+F +W++ D      + LQ    P VSDAY INGL G
Sbjct: 159 KEVPIVFQQWWDTDV-----RLLQLRPAP-VSDAYLINGLAG 194



>pir|T45944|T45944 laccase-like protein - Arabidopsis
           thaliana>gb:ATF7J8_1550983 Arabidopsis thaliana DNA
           chromosome 5, BAC clone F7J8 (ESSA project).
          Length = 584

 Score =  172 bits (436), Expect = 5e-42
 Identities = 84/162 (51%), Positives = 105/162 (64%)
 Frame = +2

Query: 206 VTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQLRSGWADGP 385
           V  LC  + I   NG  PGP I  REGD L++ V N+   N++IHWHG+ QL+S W DG 
Sbjct: 39  VKPLCKEQIIPAANGSLPGPTINVREGDTLVVNVINNSTYNVTIHWHGVFQLKSVWMDGA 98

Query: 386 AYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPKKNVSYPFVKPY 565
             ITQCPIQ G ++ Y++ I GQ GTL WHAH+  LRATLHG ++I P+    YPF KPY
Sbjct: 99  NMITQCPIQPGYNFTYQFDITGQEGTLLWHAHVVNLRATLHGALVIRPRSGRPYPFPKPY 158

Query: 566 KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           KEVPI+F +W++ D      + LQ    P VSDAY INGL G
Sbjct: 159 KEVPIVFQQWWDTDV-----RLLQLRPAP-VSDAYLINGLAG 194



>pir|T45945|T45945 laccase-like protein - Arabidopsis
           thaliana>gb:ATF7J8_1550984 Arabidopsis thaliana DNA
           chromosome 5, BAC clone F7J8 (ESSA project).
          Length = 586

 Score =  171 bits (433), Expect = 1e-41
 Identities = 84/162 (51%), Positives = 105/162 (64%)
 Frame = +2

Query: 206 VTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQLRSGWADGP 385
           VT LC  + I  VNG  PGP I  REGD L++ V N    N++IHWHG+ QL+S W DG 
Sbjct: 39  VTPLCKEQMIPIVNGSLPGPTINVREGDTLVVHVINKSTYNVTIHWHGVFQLKSVWMDGA 98

Query: 386 AYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPKKNVSYPFVKPY 565
             ITQCPIQ   ++ Y++ I GQ GTL WHAH+  LRAT+HG +II P+    YPF KPY
Sbjct: 99  NMITQCPIQPSNNFTYQFDITGQEGTLLWHAHVVNLRATIHGALIIRPRSGRPYPFPKPY 158

Query: 566 KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           KEVP+IF +W++ D      + L+    P VSDAY INGL G
Sbjct: 159 KEVPLIFQQWWDTDV-----RLLELRPAP-VSDAYLINGLAG 194



>gb:AF465466_1802141 Lolium perenne laccase LAC6-2 mRNA, partial
           cds.
          Length = 335

 Score =  153 bits (387), Expect = 2e-36
 Identities = 64/118 (54%), Positives = 88/118 (74%)
 Frame = +2

Query: 338 HWHGIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPI 517
           HWHGIRQLR+GW+DGP ++TQCPI+ G+SY Y++T+  Q GTL+WHAH SWLRAT++G +
Sbjct: 1   HWHGIRQLRTGWSDGPEFVTQCPIRPGKSYTYRFTVAAQEGTLWWHAHSSWLRATVYGAL 60

Query: 518 IILPKKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           +I P+  V YPF    +  PI+ GEW++ +   +I  A +TG  PN+SDA T+NG PG
Sbjct: 61  VIRPRDAVPYPFDFHGEIAPIMLGEWWDMNPTDVIRIATRTGAAPNISDALTMNGQPG 118



>gb:AF465469_1802144 Lolium perenne laccase LAC2-1 mRNA, complete
           cds.
          Length = 579

 Score =  145 bits (365), Expect = 9e-34
 Identities = 72/175 (41%), Positives = 103/175 (58%), Gaps = 4/175 (2%)
 Frame = +2

Query: 179 YEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQ 358
           + F V+   +  LC       VNG+ PGP +   EGD +++ V N     ++IHWHG++Q
Sbjct: 27  HTFLVSEVTLRHLCRDTVATVVNGQLPGPALEVTEGDSVVVHVVNQSPFGVTIHWHGVKQ 86

Query: 359 LRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPKKN 538
             + WADG   +TQCPI    ++ Y++ +VGQ GTL+WHAHIS LRAT+HG III PK  
Sbjct: 87  RLTCWADGAGMVTQCPIAPNTTFTYRFDVVGQEGTLWWHAHISTLRATMHGAIIIRPKSG 146

Query: 539 VSYPFVKPYKEVPIIFGEWFNGDTEAIISQ-ALQTGGGPNVSD---AYTINGLPG 691
            SYPF KP+++VPI+  +++  D   +     L    G +  D   + TING  G
Sbjct: 147 -SYPFPKPHQDVPIVIADFWQNDLRQVQKDLELWIADGDHSKDGPASATINGKIG 200



>gb:AB017064_1513362 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MDN11.
          Length = 490

 Score =  141 bits (356), Expect = 1e-32
 Identities = 61/119 (51%), Positives = 80/119 (67%)
 Frame = +2

Query: 335 IHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGP 514
           +HWHG+ Q R+ W+DGP YITQCPI+ G  ++YK     +  T++WHAH SW RAT+HG 
Sbjct: 1   MHWHGVEQPRNPWSDGPEYITQCPIRPGSDFLYKVIFSIEDTTVWWHAHSSWTRATVHGL 60

Query: 515 IIILPKKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           I + P+     PF K   EVPII GEW+  D   ++ + ++TGG PNVSDA TING PG
Sbjct: 61  IFVYPRPPQILPFPKADHEVPIILGEWWKRDVREVVEEFVRTGGAPNVSDALTINGHPG 119



>gb:AY645934S3_1619833 Ginkgo biloba laccase-like multicopper
           oxidase 130 gene, exon 5 and partial cds.
          Length = 352

 Score =  135 bits (341), Expect = 5e-31
 Identities = 54/98 (55%), Positives = 77/98 (78%)
 Frame = +2

Query: 398 QCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPKKNVSYPFVKPYKEVP 577
           QCPI +G+SY Y++TI GQ GTL+WHAH SWLRA+++G +II P+   +YPF +P++E P
Sbjct: 1   QCPISSGESYTYRFTITGQEGTLWWHAHSSWLRASVYGALIIYPRAGTTYPFTRPHRETP 60

Query: 578 IIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           ++ GEW+N +   +++QA +TG  PNVSDA+TING PG
Sbjct: 61  LLLGEWWNRNPIDVVNQATRTGAAPNVSDAFTINGQPG 98



>gb:AY645907S3_1619823 Pinus taeda laccase-like multicopper oxidase
           90 gene, exon 5 and partial cds.
          Length = 377

 Score =  132 bits (331), Expect = 8e-30
 Identities = 56/98 (57%), Positives = 74/98 (75%)
 Frame = +2

Query: 398 QCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPKKNVSYPFVKPYKEVP 577
           QCPI+ G SY Y++TI GQ GTL+WHAH SWLRAT++G +II P    +YPF +P+ +VP
Sbjct: 1   QCPIRPGGSYTYRFTITGQEGTLWWHAHSSWLRATVYGALIISPSPGATYPFTRPHGQVP 60

Query: 578 IIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           I+ GEW+N +   +++QA +TG  PNVSDA TING PG
Sbjct: 61  ILLGEWWNRNPIDVVNQATRTGAAPNVSDASTINGQPG 98



>gb:AY645937S3_1619834 Pinus taeda laccase-like multicopper oxidase
           100 gene, exon 5 and partial cds.
          Length = 376

 Score =  131 bits (330), Expect = 1e-29
 Identities = 55/98 (56%), Positives = 78/98 (79%), Gaps = 2/98 (2%)
 Frame = +2

Query: 404 PIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPKKNVSYPF--VKPYKEVP 577
           PI+ G+SY YK+TI GQ GTL+WHAH SWLRAT++G +IILP+ + +YPF   +P++++P
Sbjct: 2   PIRPGRSYTYKFTITGQEGTLWWHAHSSWLRATVYGALIILPRLDTTYPFTLTRPHRQIP 61

Query: 578 IIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           ++ GEW+N +   +++QA QTG  PNVSDA+TING PG
Sbjct: 62  VLLGEWWNRNPMDVVNQATQTGAAPNVSDAFTINGQPG 99



>gb:AF465467_1802142 Lolium perenne laccase LAC6-8 mRNA, partial
           cds.
          Length = 381

 Score =  129 bits (323), Expect = 6e-29
 Identities = 61/116 (52%), Positives = 79/116 (68%), Gaps = 1/116 (0%)
 Frame = +2

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIIL 526
           GIRQL +GWADG   IT C IQ   ++ Y++ I GQ GTL+WHAH S LRAT++G +II 
Sbjct: 1   GIRQL-NGWADGAYLITDCSIQPSGNFTYQFNITGQEGTLWWHAHSSLLRATIYGALIIK 59

Query: 527 PKKNVS-YPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           P+   + YPF  PY E+PI+FGEW+N +   +      TG GP +SDA TING+PG
Sbjct: 60  PRNGTAGYPFTAPYGEIPIVFGEWWNKNVNDVEIDGHLTGLGPAISDALTINGMPG 115



>gb:AY645915S3_1619826 Arabis procurrens laccase-like multicopper
           oxidase 61 gene, exon 5 and partial cds.
          Length = 224

 Score =  126 bits (317), Expect = 3e-28
 Identities = 54/98 (55%), Positives = 73/98 (74%)
 Frame = +2

Query: 398 QCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPKKNVSYPFVKPYKEVP 577
           QCPI+ G+SY Y++TI GQ GTL+WHAH SWLRAT++G +II P    S+PF KP ++  
Sbjct: 1   QCPIRPGKSYTYRFTIQGQEGTLWWHAHSSWLRATVYGALIIHPTIGSSFPFPKPDRQTA 60

Query: 578 IIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
           I+ GEW+N +   ++ +A +TG  PN+SDAYTING PG
Sbjct: 61  IMLGEWWNANPVDVMKEATRTGAAPNISDAYTINGQPG 98



>gb:AE016959_1022755 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017098_1752574
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 52 of 77 of the complete sequence.
          Length = 467

 Score =  119 bits (297), Expect = 7e-26
 Identities = 50/103 (48%), Positives = 72/103 (69%)
 Frame = +2

Query: 338 HWHGIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPI 517
           H HG+ Q R+ W+DGP +ITQCPI+   ++ Y+  +  + GTL+WHAH  + RAT+HG I
Sbjct: 22  HRHGVDQPRNPWSDGPEFITQCPIRPCGNFTYQVILFEEEGTLWWHAHSDFDRATVHGAI 81

Query: 518 IILPKKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGG 646
           +I PK   ++PF KP KE+PII  EW+N D E ++ +A +TGG
Sbjct: 82  VIHPKHGTTFPFNKPDKEIPIILSEWWNDDVENVLDEAKRTGG 124



>pir|A36962|A36962 laccase (EC 1.10.3.2) precursor - fungus
           (Filobasidium floriforme) (ATCC 34873)
          Length = 624

 Score =  114 bits (284), Expect = 2e-24
 Identities = 67/179 (37%), Positives = 97/179 (54%), Gaps = 8/179 (4%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TR Y F++     +   + + +  VN  +PGP I A  GD +++ VNNH+    S+HWHG
Sbjct: 61  TREYTFDIAKAFASPDGYEREVYVVNNMFPGPVIEANTGDTIIVHVNNHLDEGQSLHWHG 120

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL 526
           +RQL + + DG   ITQCPI  G S+ Y +T+  Q GT +WH+H S   A  + GP+I+ 
Sbjct: 121 LRQLGTAFMDGVPGITQCPIPPGGSFTYNFTVSHQSGTYWWHSHYSNSMADGIWGPLIV- 179

Query: 527 PKKNVSYPFVKPYKEVPIIF-GEWFNGDTEAIISQALQTGGG------PNVSDAYTING 682
              N      + Y E  I+F  +W + ++E II+ AL T  G      P   DA  ING
Sbjct: 180 HSPNEPLQRGRDYDEDRIVFITDWMHDNSEIIIA-ALATPEGYKGNIAPPQGDAILING 237



>gb:AE017347_1757755 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 624

 Score =  113 bits (283), Expect = 3e-24
 Identities = 67/179 (37%), Positives = 97/179 (54%), Gaps = 8/179 (4%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TR Y F++     +   + + +  VN  +PGP I A  GD +++ VNNH+    S+HWHG
Sbjct: 61  TREYTFDIANAFASPDGYEREVYVVNNMFPGPVIEANTGDTIIVHVNNHLDEGQSLHWHG 120

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL 526
           +RQL + + DG   ITQCPI  G S+ Y +T+  Q GT +WH+H S   A  + GP+I+ 
Sbjct: 121 LRQLGTAFMDGVPGITQCPIPPGGSFTYNFTVSHQSGTYWWHSHYSNSMADGIWGPLIV- 179

Query: 527 PKKNVSYPFVKPYKEVPIIF-GEWFNGDTEAIISQALQTGGG------PNVSDAYTING 682
              N      + Y E  I+F  +W + ++E II+ AL T  G      P   DA  ING
Sbjct: 180 HSPNEPLQRGRDYDEDRIVFITDWMHDNSEIIIA-ALATPEGYKGNIAPPQGDAILING 237



>gb:AB083032_1524145 Glycine max mRNA for syringolide-induced
           protein B13-1-1, partial cds.
          Length = 567

 Score =  112 bits (281), Expect = 5e-24
 Identities = 57/148 (38%), Positives = 91/148 (61%), Gaps = 2/148 (1%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNH-VANNISIHWHG 349
           RH+++ V  +  +  C  K ++T+NGK PGP I A+EGD ++++VNN  V  N+SIHWHG
Sbjct: 26  RHHKWEVKYEFRSPDCFKKLVITINGKTPGPTIQAQEGDTIVVQVNNSLVTENLSIHWHG 85

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLR-ATLHGPIIIL 526
           IRQ+ + W DG   +TQCPI  G +++Y++ +V + GT  +HAH    R A L+G I + 
Sbjct: 86  IRQIGTPWFDGTEGVTQCPILPGDTFIYQF-VVDRPGTYLYHAHYGMQREAGLYGMIRVA 144

Query: 527 PKKNVSYPFVKPYKEVPIIFGEWFNGDT 610
           P+    + +     +  II  +W++  T
Sbjct: 145 PRDPEPFAY---DLDRSIILNDWYHKST 169



>gb:AY532149_1612046 Phanerochaete chrysosporium strain BKM-1767
           multicopper oxidase 4A (mco4) mRNA, complete cds.
          Length = 591

 Score =  110 bits (275), Expect = 2e-23
 Identities = 62/181 (34%), Positives = 101/181 (55%), Gaps = 9/181 (4%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TRH+ F V+  N +    +K ++ VNG +PGP I A +GDR+++ V N ++   +IHWHG
Sbjct: 87  TRHFNFVVSQMNGSPDGFSKPMLVVNGLFPGPTIEANQGDRIVVHVTNTLSTRTTIHWHG 146

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHI-SWLRATLHGPIIIL 526
           + Q  + + DG A +T+C I  GQS  Y +T+    GT +WHAH  +     + G +I+ 
Sbjct: 147 LYQNSTNYYDGTAGVTECGIPPGQSLTYNFTVDDFSGTTWWHAHYDTQYTDGVTGALIVH 206

Query: 527 PKKNVSYP--FVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGP------NVSDAYTING 682
           P+K   YP  F    +++ +   + ++  +E I+S+ L  GGGP         D+  ING
Sbjct: 207 PRK---YPRGFPTWDEDIVVELTDIYHAFSETILSEYLGGGGGPLTGLQLETPDSGAING 263

Query: 683 L 685
           +
Sbjct: 264 I 264



>gb:PTY13770_1702843 Populus trichocarpa mRNA for laccase, lac2
           gene, partial.
          Length = 437

 Score =  108 bits (270), Expect = 9e-23
 Identities = 48/76 (63%), Positives = 58/76 (76%)
 Frame = +2

Query: 464 LFWHAHISWLRATLHGPIIILPKKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTG 643
           L WHAHISWLRAT+HG I+ILP+K V YPF KP KE  II GEW+  D EA+++QA QTG
Sbjct: 4   LLWHAHISWLRATIHGAIVILPQKGVPYPFPKPDKEKIIILGEWWKADVEAVVNQATQTG 63

Query: 644 GGPNVSDAYTINGLPG 691
             PN+SDA+ +NG  G
Sbjct: 64  LPPNISDAHIVNGQTG 79



>gb:AY532152_1612049 Phanerochaete chrysosporium strain BKM-1767
           multicopper oxidase 4B-I13 splice variant (mco4) mRNA,
           complete cds, alternatively spliced.
          Length = 444

 Score =  107 bits (268), Expect = 2e-22
 Identities = 61/181 (33%), Positives = 100/181 (55%), Gaps = 9/181 (4%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TRH+ F V+  N +    +K ++ VNG +PGP I A +GDR+++ V N ++   +IHWHG
Sbjct: 87  TRHFNFVVSQMNGSPDGFSKPMLVVNGLFPGPTIEANQGDRIVVHVTNTLSTRTTIHWHG 146

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHI-SWLRATLHGPIIIL 526
           + Q  + + DG A +T+C I  GQS  Y +T+    GT +WHAH  +     + G +I+ 
Sbjct: 147 LYQNGTNYYDGTAGVTECGIPPGQSLTYNFTVDDFSGTTWWHAHYDTQYTDGVTGALIVH 206

Query: 527 PKKNVSYP--FVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGP------NVSDAYTING 682
           P+K   YP  F    +++ +   + ++  +  I+S+ L  GGGP         D+  ING
Sbjct: 207 PRK---YPRGFPTWDEDIVVELTDIYHAFSATILSEYLGGGGGPLTGLQLETPDSGAING 263

Query: 683 L 685
           +
Sbjct: 264 I 264



>gb:AY532150_1612047 Phanerochaete chrysosporium strain BKM-1767
           multicopper oxidase 4B (mco4) mRNA, complete cds.
          Length = 591

 Score =  107 bits (268), Expect = 2e-22
 Identities = 61/181 (33%), Positives = 100/181 (55%), Gaps = 9/181 (4%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TRH+ F V+  N +    +K ++ VNG +PGP I A +GDR+++ V N ++   +IHWHG
Sbjct: 87  TRHFNFVVSQMNGSPDGFSKPMLVVNGLFPGPTIEANQGDRIVVHVTNTLSTRTTIHWHG 146

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHI-SWLRATLHGPIIIL 526
           + Q  + + DG A +T+C I  GQS  Y +T+    GT +WHAH  +     + G +I+ 
Sbjct: 147 LYQNGTNYYDGTAGVTECGIPPGQSLTYNFTVDDFSGTTWWHAHYDTQYTDGVTGALIVH 206

Query: 527 PKKNVSYP--FVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGP------NVSDAYTING 682
           P+K   YP  F    +++ +   + ++  +  I+S+ L  GGGP         D+  ING
Sbjct: 207 PRK---YPRGFPTWDEDIVVELTDIYHAFSATILSEYLGGGGGPLTGLQLETPDSGAING 263

Query: 683 L 685
           +
Sbjct: 264 I 264



>gb:AY645929S3_1619831 Brassica napus laccase-like multicopper
           oxidase 76 gene, exon 5 and partial cds.
          Length = 212

 Score =  106 bits (265), Expect = 3e-22
 Identities = 51/100 (51%), Positives = 68/100 (68%), Gaps = 2/100 (2%)
 Frame = +2

Query: 398 QCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPK-KNVSYPF-VKPYKE 571
           QCPI+ G SY Y++ I  Q GTL+WHAH  WLRAT++G +II P   N  YPF V P +E
Sbjct: 1   QCPIRPGGSYTYRFNIEEQDGTLWWHAHSRWLRATVYGALIIRPPLSNPHYPFPVLPKRE 60

Query: 572 VPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
             ++ GEW++ +   +++ A  TG  PNVSDA+TING PG
Sbjct: 61  FTLLLGEWWDRNPMDVLNMAQFTGAAPNVSDAFTINGQPG 100



>pir|T05020|T05020 L-ascorbate oxidase (EC 1.10.3.3) - Arabidopsis
           thaliana>gb:ATCHRIV92_1547967 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           92.>gb:ATT19P19_1554870 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T19P19 (ESSA
           project).>gb:BT015360_1642188 Arabidopsis thaliana
           At4g39830 gene, complete cds.>gb:BT015885_1642503
           Arabidopsis thaliana At4g39830 gene, complete cds.
          Length = 582

 Score =  105 bits (261), Expect = 1e-21
 Identities = 55/187 (29%), Positives = 100/187 (53%), Gaps = 2/187 (1%)
 Frame = +2

Query: 47  SSPTTHYYIVMAATYLPQMFSMAIIXXXXXXXXXXXXXXXXTRHYEFNVTMQNVTRLCHT 226
           SS T H + +M   ++   FS  +                  R +++ V  +  +  C  
Sbjct: 7   SSDTVHVFNLMVLCFIALFFSSVLCQGKI-------------RRFKWEVKYEFKSPDCFE 53

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKV-NNHVANNISIHWHGIRQLRSGWADGPAYITQC 403
           K ++T+NGK+PGP I A++GD +++++ N+ +  N+++HWHGIRQ+ + W DG   +TQC
Sbjct: 54  KLVITINGKFPGPTIKAQQGDTIVVELKNSFMTENVAVHWHGIRQIGTPWFDGVEGVTQC 113

Query: 404 PIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPYKEVPI 580
           PI  G+ ++Y++ +V + GT  +H+H    R + L G I + P      PF   Y +   
Sbjct: 114 PILPGEVFIYQF-VVDRPGTYMYHSHYGMQRESGLIGMIQVSPPATEPEPFTYDY-DRNF 171

Query: 581 IFGEWFN 601
           +  +W++
Sbjct: 172 LLTDWYH 178



>gb:AY645940S3_1619835 Arabis procurrens laccase-like multicopper
           oxidase 151 gene, exon 5 and partial cds.
          Length = 383

 Score =  104 bits (260), Expect = 1e-21
 Identities = 50/100 (50%), Positives = 68/100 (68%), Gaps = 2/100 (2%)
 Frame = +2

Query: 398 QCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRATLHGPIIILPK-KNVSYPF-VKPYKE 571
           QCPI+ G SY Y++ I  Q GTL+WHAH  WLRAT++G +II P   +  YPF V P +E
Sbjct: 1   QCPIRPGGSYTYRFNIEEQEGTLWWHAHSRWLRATVYGALIIRPPLSSPHYPFPVLPKRE 60

Query: 572 VPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
             ++ G+W++ +   +++QA  TG  PNVSDA TING PG
Sbjct: 61  FTLLLGQWWDRNPMDVLNQAQFTGAAPNVSDALTINGQPG 100



>gb:AY839937_1630505 Trametes sp. AH28-2 laccase C (lacC) gene,
           partial cds.
          Length = 501

 Score =  104 bits (259), Expect = 2e-21
 Identities = 61/175 (34%), Positives = 93/175 (53%), Gaps = 7/175 (4%)
 Frame = +2

Query: 182 EFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWH 346
           +  ++ +NV+    T++ V  NGK PGP I  ++GDR  I V N ++N+      SIHWH
Sbjct: 32  DLTISNENVSPDGFTRAAVVANGKAPGPLITGQKGDRFQINVVNKLSNHTMLKSTSIHWH 91

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           G  Q  + WADGPA++ QCPI TG S++Y + +  Q GT ++H+H+S      L GP ++
Sbjct: 92  GFFQKGTNWADGPAFVNQCPIATGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVV 151

Query: 524 L-PKKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
             P    +  +     +  I   +W++    A +  A      P  SDA  INGL
Sbjct: 152 YDPNDPNASLYDVDNDDTVITLADWYH--VAAKLGPAF-----PPRSDATLINGL 199



>gb:AF233594_1779470 Cucumis melo ascorbate oxidase AO4 mRNA,
           complete cds.
          Length = 587

 Score =  103 bits (256), Expect = 4e-21
 Identities = 50/145 (34%), Positives = 88/145 (60%), Gaps = 2/145 (1%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHV-ANNISIHWHG 349
           RHY++ V     +  C    ++ +NG++PGP I A  GD +++++ N +    + IHWHG
Sbjct: 39  RHYKWEVEYMFWSPDCVENIVMGINGQFPGPTIRANAGDMVVVELTNKLHTEGVVIHWHG 98

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLR-ATLHGPIIIL 526
           I Q  + WADG A I+QC I  G+++ Y++ +V + GT F+H H+   R A L+G +I+ 
Sbjct: 99  ILQRGTPWADGTASISQCAINPGETFTYRF-VVDKAGTYFYHGHLGMQRSAGLYGSLIVD 157

Query: 527 PKKNVSYPFVKPYKEVPIIFGEWFN 601
           P++  S PF    +E+ ++  +W++
Sbjct: 158 PQEGTSEPFHYD-EEINLLLSDWWH 181



>gb:AY817108_1628701 Cryptococcus neoformans var. grubii LAC2
           isoform 1 mRNA, complete cds, alternatively spliced.
          Length = 594

 Score =  102 bits (254), Expect = 6e-21
 Identities = 61/178 (34%), Positives = 91/178 (51%), Gaps = 7/178 (3%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TR Y FN+T    +   + + +  VN   PGP I A  GD +++ VNN++     IHWHG
Sbjct: 61  TREYTFNLTEALASPDGYERLVYAVNNMLPGPVIEANTGDTVIVHVNNYLHEGQGIHWHG 120

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL 526
           +RQ  +   DG   ITQC I  G S+ Y++T+  Q GT +WH+H S   A  + GP+I+ 
Sbjct: 121 LRQNGTALMDGVPGITQCSIPPGGSFTYQFTVSHQSGTFWWHSHYSNSMADGIWGPLIV- 179

Query: 527 PKKNVSYPFVKPYKEVPII-FGEWFNGDTEAIISQALQTGG-----GPNVSDAYTING 682
              N      + Y E  I+   +W + ++E I+   + + G      P   DA  ING
Sbjct: 180 HSPNEPLQRGRDYDEDRIVAVTDWMHDESETIVEALISSEGYRGRPFPPQGDAILING 237



>sp|Q02079|LAC3_THACU Laccase 3 precursor (EC 1.10.3.2)
           (Benzenediol:oxygen oxidoreductase) (Urishiol oxidase)
           (Diphenol oxidase).>pir|S68119|S68119 laccase (EC
           1.10.3.2) 3 precursor - Rhizoctonia
           solani>gb:RSLAC3_1704027 R.solani gene for laccase (3641
           BP).
          Length = 572

 Score =  102 bits (254), Expect = 6e-21
 Identities = 61/157 (38%), Positives = 88/157 (56%), Gaps = 10/157 (6%)
 Frame = +2

Query: 242 VNGKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWHGIRQLRSGWADGPAYITQCP 406
           VNG YPGP I A +GD L +KV N + N       SIHWHG+ Q R+   DGPA++TQCP
Sbjct: 45  VNGGYPGPLIFANKGDTLKVKVQNKLTNPDMYRTTSIHWHGLLQHRNADDDGPAFVTQCP 104

Query: 407 IQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPY----KE 571
           I    SY Y   +  Q GT ++H+H+S      L GP++I   K+   P  + Y    ++
Sbjct: 105 IVPQASYTYTMPLGDQTGTYWYHSHLSSQYVDGLRGPLVIYDPKD---PHRRLYDIDDEK 161

Query: 572 VPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
             +I G+W++  ++AI++    T   P   D+ TING
Sbjct: 162 TVLIIGDWYHTSSKAILATGNITLQQP---DSATING 195



>gb:AP005458_1852214 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0567G03.>gb:AP005471_1852447 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBa0062E01.
          Length = 633

 Score =  102 bits (253), Expect = 8e-21
 Identities = 51/139 (36%), Positives = 82/139 (58%), Gaps = 6/139 (4%)
 Frame = +2

Query: 218 CHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHV-ANNISIHWHGIRQLRSGWADGPAYI 394
           C  + ++ +NG++PGP I AR GD + + +NN +    + IHWHGIRQ  + WADG A I
Sbjct: 46  CQQRVMIGINGRFPGPNITARAGDVISVTMNNKMHTEGVVIHWHGIRQFGTPWADGTASI 105

Query: 395 TQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPYK- 568
           +QC +  G+++VYK+ +  + GT F+H H    RA  L+G +I+L       PF   Y  
Sbjct: 106 SQCAVNPGETFVYKF-VADKPGTYFYHGHFGMQRAAGLYGSLIVLDSPEQPEPFRHQYDD 164

Query: 569 --EVP-IIFGEWFNGDTEA 616
             E+P ++  +W++ +  A
Sbjct: 165 GGELPMMLLSDWWHQNVYA 183



>gb:AF206722_1776765 Brassica juncea isolate BJAO2 ascorbate oxidase
           mRNA, partial cds.
          Length = 574

 Score =  102 bits (253), Expect = 8e-21
 Identities = 60/162 (37%), Positives = 91/162 (56%), Gaps = 2/162 (1%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANN-ISIHWHG 349
           R Y + V  +     C    ++ +NGK+PGP I A  GD +++ + N +A   + IHWHG
Sbjct: 18  REYHWEVEYKFGFPDCKEGMVMAINGKFPGPTIHALAGDTIVVHLTNKLATEGLVIHWHG 77

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLR-ATLHGPIIIL 526
           IRQL S WADG A +TQC I  G+++ Y++T V + GT F+H H    R A L+G +II 
Sbjct: 78  IRQLGSPWADGAAGVTQCAITPGETFTYRFT-VEKPGTHFYHGHYGMQRSAGLYGSLIID 136

Query: 527 PKKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGP 652
             K    P ++   E  ++  +W++   E+I+SQ L     P
Sbjct: 137 AAKGKREP-LRYDGEFNLLLSDWWH---ESILSQELGLSAKP 174



>gb:AB004799_1509184 Oryza sativa mRNA for ascorbate oxidase,
           partial cds.
          Length = 380

 Score =  102 bits (253), Expect = 8e-21
 Identities = 51/139 (36%), Positives = 82/139 (58%), Gaps = 6/139 (4%)
 Frame = +2

Query: 218 CHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHV-ANNISIHWHGIRQLRSGWADGPAYI 394
           C  + ++ +NG++PGP I AR GD + + +NN +    + IHWHGIRQ  + WADG A I
Sbjct: 21  CQQRVMIGINGRFPGPNITARAGDVISVTMNNKMHTEGVVIHWHGIRQFGTPWADGTASI 80

Query: 395 TQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPYK- 568
           +QC +  G+++VYK+ +  + GT F+H H    RA  L+G +I+L       PF   Y  
Sbjct: 81  SQCAVNPGETFVYKF-VADKPGTYFYHGHFGMQRAAGLYGSLIVLDSPEQPEPFRHQYDD 139

Query: 569 --EVP-IIFGEWFNGDTEA 616
             E+P ++  +W++ +  A
Sbjct: 140 GGELPMMLLSDWWHQNVYA 158



>pir|T04343|T04343 L-ascorbate oxidase (EC 1.10.3.3) - rice
           (fragment)
          Length = 380

 Score =  102 bits (253), Expect = 8e-21
 Identities = 51/139 (36%), Positives = 82/139 (58%), Gaps = 6/139 (4%)
 Frame = +2

Query: 218 CHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHV-ANNISIHWHGIRQLRSGWADGPAYI 394
           C  + ++ +NG++PGP I AR GD + + +NN +    + IHWHGIRQ  + WADG A I
Sbjct: 21  CQQRVMIGINGRFPGPNITARAGDVISVTMNNKMHTEGVVIHWHGIRQFGTPWADGTASI 80

Query: 395 TQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPYK- 568
           +QC +  G+++VYK+ +  + GT F+H H    RA  L+G +I+L       PF   Y  
Sbjct: 81  SQCAVNPGETFVYKF-VADKPGTYFYHGHFGMQRAAGLYGSLIVLDSPEQPEPFRHQYDD 139

Query: 569 --EVP-IIFGEWFNGDTEA 616
             E+P ++  +W++ +  A
Sbjct: 140 GGELPMMLLSDWWHQNVYA 158



>gb:AP005458_1852204 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0567G03.
          Length = 581

 Score =  101 bits (252), Expect = 1e-20
 Identities = 53/162 (32%), Positives = 92/162 (56%), Gaps = 2/162 (1%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHV-ANNISIHWHG 349
           RH+ + V+    +  C  K ++ +NG++PGP I A+ GD +++ + N +    + IHWHG
Sbjct: 27  RHFRWEVSNMFWSPDCEEKVVIGINGQFPGPTIRAKAGDTIVVHLKNGLHTEGVVIHWHG 86

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL 526
           IRQ+ + WADG A I+QC I   +++ Y++ +V + GT F+H H    RA  L+G +I+ 
Sbjct: 87  IRQIGTPWADGTASISQCAINPEETFTYRF-VVDKPGTYFYHGHYGMQRAAGLYGSLIVD 145

Query: 527 PKKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGP 652
                  PF K   E+ ++  +W++   E+I +Q +     P
Sbjct: 146 VADGDEEPF-KYDGEINLLLSDWYH---ESIYTQMVGLSSNP 183



>gb:PGU65399_1700032 Basidiomycete CECT 20197 phenoloxidase (pox1)
           gene, complete cds.
          Length = 519

 Score =  100 bits (250), Expect = 2e-20
 Identities = 55/161 (34%), Positives = 89/161 (55%), Gaps = 7/161 (4%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPA 388
           ++  V VNG +PGP I  ++GDR  + V +++ N+      SIHWHG  Q  + WADGPA
Sbjct: 41  SRDAVVVNGVFPGPLITGKKGDRFQLNVIDNLTNHTMLKSTSIHWHGFFQAGTNWADGPA 100

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKP 562
           ++ QCPI TG +++Y + +  Q GT ++H+H+S      L GPI++  P    ++ +   
Sbjct: 101 FVNQCPISTGHAFLYDFHVPDQAGTFWYHSHLSTQYCDGLRGPIVVYDPLDPHAFRYDVD 160

Query: 563 YKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
            +   I   +W++  T A +    + G     +DA  INGL
Sbjct: 161 DESTVITLSDWYH--TAATLGLGSRLG-----ADATLINGL 194



>gb:CMAO3_1647984 C.melo ao3 gene.
          Length = 687

 Score =  100 bits (250), Expect = 2e-20
 Identities = 52/146 (35%), Positives = 86/146 (58%), Gaps = 2/146 (1%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKV-NNHVANNISIHWH 346
           TR+Y+F V     +  C    ++ +NG +PGPPI A   D ++++V NN     + IHWH
Sbjct: 37  TRYYKFEVDYMFWSPDCVENIVLGINGTFPGPPIRANVNDTVVVEVINNLSTEGVVIHWH 96

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           GI Q  + WADG A I+QCPI  G+++ Y++  V + GT F+H H    RA  L+G +I+
Sbjct: 97  GILQRGTPWADGTASISQCPINPGENFTYEFK-VDKPGTYFYHGHFGMQRAAGLYGSLIV 155

Query: 524 LPKKNVSYPFVKPYKEVPIIFGEWFN 601
             ++    PF +  +E+ ++  +W++
Sbjct: 156 DLEEGKKEPF-QYDEEINLLLSDWWH 180



>gb:AY532141_1612038 Phanerochaete chrysosporium strain RP-78
           multicopper oxidase 2A-I8 splice variant (mco2) mRNA,
           complete cds, alternatively spliced.
          Length = 304

 Score =  100 bits (250), Expect = 2e-20
 Identities = 59/179 (32%), Positives = 92/179 (51%), Gaps = 7/179 (3%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TR Y+F ++         +K ++ VNG YPGP I   +GDR+++ V N + N  +IHWHG
Sbjct: 99  TRSYDFVISQVLGAPDGVSKPMLVVNGMYPGPTIEVNQGDRIVVNVTNLLENRTTIHWHG 158

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL 526
           + Q ++ + DG A IT+C I  GQS VY +T+    GT +WHAH S      + G +I+ 
Sbjct: 159 LFQNQTNYYDGTAGITECGIPPGQSLVYNFTLGDFSGTTWWHAHYSTQYTDGITGALIVH 218

Query: 527 PKKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQ------TGGGPNVSDAYTINGL 685
           P       F     E+ +   + ++  +  +++  L       T G   V DA  +NGL
Sbjct: 219 PASPPPVKFPSWDHELVVQVADLYHTFSSILLASYLSPWGIDGTAGDEPVPDAGVLNGL 277



>gb:AY532139_1612036 Phanerochaete chrysosporium strain RP-78
           multicopper oxidase 2A (mco2) mRNA, complete cds.
          Length = 617

 Score =  100 bits (250), Expect = 2e-20
 Identities = 59/179 (32%), Positives = 92/179 (51%), Gaps = 7/179 (3%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TR Y+F ++         +K ++ VNG YPGP I   +GDR+++ V N + N  +IHWHG
Sbjct: 99  TRSYDFVISQVLGAPDGVSKPMLVVNGMYPGPTIEVNQGDRIVVNVTNLLENRTTIHWHG 158

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL 526
           + Q ++ + DG A IT+C I  GQS VY +T+    GT +WHAH S      + G +I+ 
Sbjct: 159 LFQNQTNYYDGTAGITECGIPPGQSLVYNFTLGDFSGTTWWHAHYSTQYTDGITGALIVH 218

Query: 527 PKKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQ------TGGGPNVSDAYTINGL 685
           P       F     E+ +   + ++  +  +++  L       T G   V DA  +NGL
Sbjct: 219 PASPPPVKFPSWDHELVVQVADLYHTFSSILLASYLSPWGIDGTAGDEPVPDAGVLNGL 277



>gb:AP005422_1851586 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0441A12.
          Length = 576

 Score =  100 bits (249), Expect = 2e-20
 Identities = 49/120 (40%), Positives = 76/120 (63%), Gaps = 2/120 (1%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHV-ANNISIHWH 346
           TR ++++++ Q  +  C  K  VT+NG  PGP I A +GD +++ V N +   N++IHWH
Sbjct: 25  TRRHDWDISYQFTSPDCVRKLAVTINGHTPGPTIRAVQGDTIVVNVKNSLLTENVAIHWH 84

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLR-ATLHGPIII 523
           GIRQ+ + WADG   +TQCPI  G ++ Y + +V + GT  +HAH    R A L+G I++
Sbjct: 85  GIRQIGTPWADGTEGVTQCPILPGDTFAYTF-VVDRPGTYMYHAHYGMQRSAGLNGMIVV 143



>gb:AF206723_1776766 Brassica juncea isolate BJAO3 ascorbate oxidase
           mRNA, partial cds.
          Length = 573

 Score =  100 bits (249), Expect = 2e-20
 Identities = 59/162 (36%), Positives = 90/162 (55%), Gaps = 2/162 (1%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANN-ISIHWHG 349
           R Y + V  +     C    ++ +NGK+PGP I A  GD +++ + N +    + IHWHG
Sbjct: 17  REYHWEVEYKFGFPDCKEGMVMAINGKFPGPTIHALAGDTIVVHLTNKLTTEGLVIHWHG 76

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLR-ATLHGPIIIL 526
           IRQL S WADG A +TQC I  G+++ Y++T V + GT F+H H    R A L+G +II 
Sbjct: 77  IRQLGSPWADGAAGVTQCAITPGETFTYRFT-VEKPGTHFYHGHYGMQRSAGLYGSLIID 135

Query: 527 PKKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGP 652
             K    P ++   E  ++  +W++   E+I+SQ L     P
Sbjct: 136 AAKGKREP-LRYDGEFNLLLSDWWH---ESILSQELGLSAKP 173



>gb:AF104823_1768268 Aspergillus fumigatus brown 2 (abr2) gene,
           complete cds.
          Length = 587

 Score =  100 bits (249), Expect = 2e-20
 Identities = 60/186 (32%), Positives = 97/186 (52%), Gaps = 15/186 (8%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           T HY  ++T +  +    ++ ++ VNG++PGP I+  EGD  +I V NH+  N SIH+HG
Sbjct: 19  TVHYSLDLTWETGSPNGVSREMIFVNGQFPGPAIILNEGDEAIIDVTNHLPFNTSIHFHG 78

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAH-ISWLRATLHGPIIIL 526
           I Q  + WADG   ++Q  IQ GQSY Y++      GT ++HAH  + +   L+GP+ I 
Sbjct: 79  IEQKNTPWADGVVGLSQWAIQPGQSYTYQWR-ADTYGTYWYHAHDKAEIMDGLYGPVHIR 137

Query: 527 PKKNVSYPF---------VKPYKEVP-----IIFGEWFNGDTEAIISQALQTGGGPNVSD 664
           P+ N   PF         ++  K+       ++  +W +   +  +    +TG     SD
Sbjct: 138 PRPNRDSPFSMISDDPADIRAMKQAERNGKLVMLSDWDHLTGQEYMKAMEETGYDIFCSD 197

Query: 665 AYTING 682
           +  ING
Sbjct: 198 SVLING 203



>sp|P56193|LAC1_THACU Laccase 1 precursor (EC 1.10.3.2)
           (Benzenediol:oxygen oxidoreductase) (Urishiol oxidase)
           (Diphenol oxidase).>pir|S68117|S68117 laccase (EC
           1.10.3.2) 1 precursor - Rhizoctonia solani
          Length = 576

 Score =  100 bits (249), Expect = 2e-20
 Identities = 59/162 (36%), Positives = 90/162 (55%), Gaps = 10/162 (6%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWHGIRQLRSGWADGPAY 391
           ++   VNG YPGP I A +GD L +KV N + N       SIHWHG+ Q R+   DGP++
Sbjct: 40  RNATLVNGGYPGPLIFANKGDTLKVKVQNKLTNPEMYRTTSIHWHGLLQHRNADDDGPSF 99

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPY- 565
           +TQCPI   +SY Y   +  Q GT ++H+H+S      L GP++I   K+   P  + Y 
Sbjct: 100 VTQCPIVPRESYTYTIPLDDQTGTYWYHSHLSSQYVDGLRGPLVIYDPKD---PHRRLYD 156

Query: 566 ---KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
              ++  +I G+W++  ++AI++    T   P    + TING
Sbjct: 157 VDDEKTVLIIGDWYHESSKAILASGNITRQRP---VSATING 195



>gb:AF548033_1810718 Trametes sp. I-62 laccase (pox1) mRNA,
           pox1-lcc1A allele, complete cds.
          Length = 520

 Score =  100 bits (248), Expect = 3e-20
 Identities = 55/161 (34%), Positives = 88/161 (54%), Gaps = 7/161 (4%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPA 388
           ++  V VNG +PGP I  ++GDR  + V +++ N+      SIHWHG  Q  + WADGPA
Sbjct: 42  SRDAVVVNGVFPGPLITGKKGDRFQLNVIDNLTNHTMLKSTSIHWHGFFQAGTNWADGPA 101

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKP 562
           ++ QCPI TG +++Y + +  Q GT ++H+H+S      L GPI++  P    ++ +   
Sbjct: 102 FVNQCPISTGHAFLYDFHVPDQAGTFWYHSHLSTQYCDGLRGPIVVYDPLDPHAFRYDVD 161

Query: 563 YKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
            +   I   +W++  T A +      G     +DA  INGL
Sbjct: 162 DESTVITLSDWYH--TAARLGPRFPLG-----ADATLINGL 195



>gb:AF548032_1810717 Trametes sp. I-62 laccase (pox1) mRNA, complete
           cds.
          Length = 520

 Score =  100 bits (248), Expect = 3e-20
 Identities = 55/161 (34%), Positives = 88/161 (54%), Gaps = 7/161 (4%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPA 388
           ++  V VNG +PGP I  ++GDR  + V +++ N+      SIHWHG  Q  + WADGPA
Sbjct: 42  SRDAVVVNGVFPGPLITGKKGDRFQLNVIDNLTNHTMLKSTSIHWHGFFQAGTNWADGPA 101

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKP 562
           ++ QCPI TG +++Y + +  Q GT ++H+H+S      L GPI++  P    ++ +   
Sbjct: 102 FVNQCPISTGHAFLYDFHVPDQAGTFWYHSHLSTQYCDGLRGPIVVYDPLDPHAFRYDVD 161

Query: 563 YKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
            +   I   +W++  T A +      G     +DA  INGL
Sbjct: 162 DESTVITLSDWYH--TAARLGPRFPLG-----ADATLINGL 195



>gb:AY846842_1630734 Trametes sp. AH28-2 laccase B (lacB) gene,
           complete cds.
          Length = 525

 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 58/178 (32%), Positives = 94/178 (52%), Gaps = 10/178 (5%)
 Frame = +2

Query: 182 EFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWH 346
           +  ++  +VT    T++ V  NG +PGP I   +GD   I V +++ N       +IHWH
Sbjct: 30  DLTISNADVTPDGFTRAAVVANGVFPGPLITGNKGDNFQINVIDNLTNATMLKTTTIHWH 89

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           G+ Q  + WADGPA++ QCPI +G S++Y +T+  Q GT ++H+H+S      L GP+++
Sbjct: 90  GLFQHGTNWADGPAFVNQCPIASGNSFLYDFTVPDQAGTFWYHSHLSTQYCDGLRGPLVV 149

Query: 524 LPKKNVSYPFVKPY----KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
               + S P+   Y        I   +W++  T A +  A      P  +D+  INGL
Sbjct: 150 Y---DPSDPYASMYDVDDDTTVITLSDWYH--TAAKLGPAF-----PPNADSVLINGL 197



>pir|S68118|S68118 laccase (EC 1.10.3.2) 2 precursor [validated] -
           Rhizoctonia solani
          Length = 599

 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 64/180 (35%), Positives = 97/180 (53%), Gaps = 12/180 (6%)
 Frame = +2

Query: 179 YEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-----NISIHW 343
           Y F+V    V     T++ V VNG++PGP I A +GD L I V N +++     + +IHW
Sbjct: 24  YGFDVANGAVAPDGVTRNAVLVNGRFPGPLITANKGDTLKITVRNKLSDPTMRRSTTIHW 83

Query: 344 HGIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPII 520
           HG+ Q R+   DGPA++TQCPI   +SY Y   +  Q GT ++H+H+S      L GPI+
Sbjct: 84  HGLLQHRTAEEDGPAFVTQCPIPPQESYTYTMPLGEQTGTYWYHSHLSSQYVDGLRGPIV 143

Query: 521 ILPKKNVSYPFVKPY----KEVPIIFGEWFNGDTEAIIS--QALQTGGGPNVSDAYTING 682
           I    +   P+   Y    +       +W++  +EAII+    L+T     + D+ TING
Sbjct: 144 IYDPHD---PYRNYYDVDDERTVFTLADWYHTPSEAIIATHDVLKT-----IPDSGTING 195



>sp|Q02075|LAC2_THACU Laccase 2 precursor (EC 1.10.3.2)
           (Benzenediol:oxygen oxidoreductase) (Urishiol oxidase)
           (Diphenol oxidase).>gb:RSLAC2_1704026 R.solani gene for
           laccase (3117 BP).
          Length = 599

 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 64/180 (35%), Positives = 97/180 (53%), Gaps = 12/180 (6%)
 Frame = +2

Query: 179 YEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-----NISIHW 343
           Y F+V    V     T++ V VNG++PGP I A +GD L I V N +++     + +IHW
Sbjct: 24  YGFDVANGAVAPDGVTRNAVLVNGRFPGPLITANKGDTLKITVRNKLSDPTMRRSTTIHW 83

Query: 344 HGIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPII 520
           HG+ Q R+   DGPA++TQCPI   +SY Y   +  Q GT ++H+H+S      L GPI+
Sbjct: 84  HGLLQHRTAEEDGPAFVTQCPIPPQESYTYTMPLGEQTGTYWYHSHLSSQYVDGLRGPIV 143

Query: 521 ILPKKNVSYPFVKPY----KEVPIIFGEWFNGDTEAIIS--QALQTGGGPNVSDAYTING 682
           I    +   P+   Y    +       +W++  +EAII+    L+T     + D+ TING
Sbjct: 144 IYDPHD---PYRNYYDVDDERTVFTLADWYHTPSEAIIATHDVLKT-----IPDSGTING 195



>sp|P14133|ASO_CUCSA L-ascorbate oxidase precursor (EC 1.10.3.3)
           (Ascorbase) (ASO).>pir|A30094|KSKVAO L-ascorbate oxidase
           (EC 1.10.3.3) precursor - cucumber>gb:CUSASCO_1674324
           Cucumber ascorbate oxidase (aso) mRNA, complete cds.
          Length = 587

 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 49/145 (33%), Positives = 88/145 (60%), Gaps = 2/145 (1%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHV-ANNISIHWHG 349
           +HY+++V     +  C    ++ +NG++PGP I A  GD +++++ N +    + IHWHG
Sbjct: 39  KHYKWDVEYMFWSPDCVENIVMGINGEFPGPTIRANAGDIVVVELTNKLHTEGVVIHWHG 98

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLR-ATLHGPIIIL 526
           I Q  + WADG A I+QC I  G+++ Y++ +V + GT F+H H+   R A L+G +I+ 
Sbjct: 99  ILQRGTPWADGTASISQCAINPGETFTYRF-VVDKAGTYFYHGHLGMQRSAGLYGSLIVD 157

Query: 527 PKKNVSYPFVKPYKEVPIIFGEWFN 601
           P +  S PF    +E+ ++  +W++
Sbjct: 158 PPEGRSEPFHYD-EEINLLLSDWWH 181



>sp|P37064|ASO_CUCPM L-ascorbate oxidase (EC 1.10.3.3) (Ascorbase)
           (ASO).>pir|A51027|A51027 L-ascorbate oxidase (EC
           1.10.3.3) [validated] - zucchini
          Length = 552

 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 50/145 (34%), Positives = 83/145 (57%), Gaps = 2/145 (1%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHV-ANNISIHWHG 349
           RHY++ V        C+   ++ +NG++PGP I A  GD +++++ N +    + IHWHG
Sbjct: 4   RHYKWEVEYMFWAPNCNENIVMGINGQFPGPTIRANAGDSVVVELTNKLHTEGVVIHWHG 63

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLR-ATLHGPIIIL 526
           I Q  + WADG A I+QC I  G+++ Y +T V   GT F+H H+   R A L+G +I+ 
Sbjct: 64  ILQRGTPWADGTASISQCAINPGETFFYNFT-VDNPGTFFYHGHLGMQRSAGLYGSLIVD 122

Query: 527 PKKNVSYPFVKPYKEVPIIFGEWFN 601
           P +    PF     E+ ++  +W++
Sbjct: 123 PPQGKKEPFHYD-GEINLLLSDWWH 146



>gb:AF176232_1774555 Polyporus ciliatus laccase (lcc3-3) mRNA,
           partial cds.
          Length = 477

 Score = 99.0 bits (245), Expect = 7e-20
 Identities = 55/160 (34%), Positives = 83/160 (51%), Gaps = 10/160 (6%)
 Frame = +2

Query: 236 VTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPAYITQ 400
           V VNG++PGP +   +GD   I V + + NN      ++HWHG  Q  + WADGPA++ Q
Sbjct: 2   VVVNGQFPGPLVTGNKGDNFQINVIDQLTNNTMLKSTTVHWHGFFQKGTNWADGPAFVNQ 61

Query: 401 CPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPY---- 565
           CPI TG S++Y +T   Q GT ++H+H+S      L GP+++    +   P    Y    
Sbjct: 62  CPISTGNSFLYDFTAADQAGTFWYHSHLSTQYCDGLRGPMVVYDPND---PHASLYDVDD 118

Query: 566 KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
           +   I   +W++  T A +  A   G      D+  INGL
Sbjct: 119 ESTVITLSDWYH--TAAKLGPAFPLG-----PDSVLINGL 151



>gb:AB004798_1509183 Arabidopsis thaliana mRNA for ascorbate
           oxidase, partial cds.
          Length = 567

 Score = 99.0 bits (245), Expect = 7e-20
 Identities = 59/162 (36%), Positives = 90/162 (55%), Gaps = 2/162 (1%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANN-ISIHWHG 349
           R Y + V  +  +  C   +++TVNG++PGP I A  GD +++ + N +    + IHWHG
Sbjct: 17  REYHWEVEYKYWSPDCKEGAVMTVNGEFPGPTIKAFAGDTIVVNLTNKLTTEGLVIHWHG 76

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLR-ATLHGPIIIL 526
           IRQ  S WADG A +TQC I  G+++ Y +T V + GT F+H H    R A L+G +I+ 
Sbjct: 77  IRQFGSPWADGAAGVTQCAINPGETFTYNFT-VEKPGTHFYHGHYGMQRSAGLYGSLIVD 135

Query: 527 PKKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGP 652
             K  S   ++   E  ++  +W++   EAI SQ L     P
Sbjct: 136 VAKGKS-ERLRYDGEFNLLLSDWWH---EAIPSQELGLSSKP 173



>pir|T44928|T44928 L-ascorbate oxidase (EC 1.10.3.3) [imported] -
           Arabidopsis thaliana (fragment)
          Length = 567

 Score = 99.0 bits (245), Expect = 7e-20
 Identities = 59/162 (36%), Positives = 90/162 (55%), Gaps = 2/162 (1%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANN-ISIHWHG 349
           R Y + V  +  +  C   +++TVNG++PGP I A  GD +++ + N +    + IHWHG
Sbjct: 17  REYHWEVEYKYWSPDCKEGAVMTVNGEFPGPTIKAFAGDTIVVNLTNKLTTEGLVIHWHG 76

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLR-ATLHGPIIIL 526
           IRQ  S WADG A +TQC I  G+++ Y +T V + GT F+H H    R A L+G +I+ 
Sbjct: 77  IRQFGSPWADGAAGVTQCAINPGETFTYNFT-VEKPGTHFYHGHYGMQRSAGLYGSLIVD 135

Query: 527 PKKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGP 652
             K  S   ++   E  ++  +W++   EAI SQ L     P
Sbjct: 136 VAKGKS-ERLRYDGEFNLLLSDWWH---EAIPSQELGLSSKP 173



>sp|Q99055|LAC4_TRAVI Laccase 4 precursor (EC 1.10.3.2)
           (Benzenediol:oxygen oxidoreductase) (Urishiol oxidase)
           (Diphenol oxidase).>pir|JC5356|JC5356 laccase (EC
           1.10.3.2) 4 precursor - white-rot fungus  (Trametes
           villosa)>gb:TMTLCCD_1725317 Trametes villosa laccase
           (lcc4) gene, complete cds.
          Length = 520

 Score = 99.0 bits (245), Expect = 7e-20
 Identities = 57/161 (35%), Positives = 85/161 (52%), Gaps = 7/161 (4%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWHGIRQLRSGWADGPA 388
           T++ V  NG +PGP I   +GD   I V ++++N     + SIHWHG  Q  + WADG A
Sbjct: 43  TRAAVLANGVFPGPLITGNKGDNFQINVIDNLSNETMLKSTSIHWHGFFQKGTNWADGAA 102

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPY 565
           ++ QCPI TG S++Y +T   Q GT ++H+H+S      L GP+++    +         
Sbjct: 103 FVNQCPIATGNSFLYDFTATDQAGTFWYHSHLSTQYCDGLRGPMVVYDPSDPHADLYDVD 162

Query: 566 KEVPII-FGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
            E  II   +W++  T A +  A   G     SD+  INGL
Sbjct: 163 DETTIITLSDWYH--TAASLGAAFPIG-----SDSTLINGL 196



>sp|Q12719|LAC4_TRAVE Laccase 4 precursor (EC 1.10.3.2)
           (Benzenediol:oxygen oxidoreductase) (Urishiol oxidase)
           (Diphenol oxidase).>pir|S59533|S59533 laccase (EC
           1.10.3.2) precursor - white-rot fungus (Trametes
           versicolor)>gb:TVLCC1_1726146 T.versicolor lcc1 gene.
          Length = 520

 Score = 99.0 bits (245), Expect = 7e-20
 Identities = 57/161 (35%), Positives = 85/161 (52%), Gaps = 7/161 (4%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWHGIRQLRSGWADGPA 388
           T++ V  NG +PGP I   +GD   I V ++++N     + SIHWHG  Q  + WADG A
Sbjct: 43  TRAAVLANGVFPGPLITGNKGDNFQINVIDNLSNETMLKSTSIHWHGFFQKGTNWADGAA 102

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPY 565
           ++ QCPI TG S++Y +T   Q GT ++H+H+S      L GP+++    +         
Sbjct: 103 FVNQCPIATGNSFLYDFTATDQAGTFWYHSHLSTQYCDGLRGPMVVYDPSDPHADLYDVD 162

Query: 566 KEVPII-FGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
            E  II   +W++  T A +  A   G     SD+  INGL
Sbjct: 163 DETTIITLSDWYH--TAASLGAAFPIG-----SDSTLINGL 196



>sp|P24792|ASO_CUCMA L-ascorbate oxidase precursor (EC 1.10.3.3)
           (Ascorbase) (ASO).>gb:CUCAAO_1674278 Cucurbita maxima
           AAO gene for ascorbate oxidase, complete cds.
          Length = 579

 Score = 98.2 bits (243), Expect = 1e-19
 Identities = 50/145 (34%), Positives = 83/145 (57%), Gaps = 2/145 (1%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHV-ANNISIHWHG 349
           RHY++ V        C+   ++ +NG++PGP I A  GD +++++ N +    + IHWHG
Sbjct: 34  RHYKWEVEYMFWAPDCNENIVMGINGQFPGPTIRANAGDTVVVELINKLHTEGVVIHWHG 93

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLR-ATLHGPIIIL 526
           I Q  + WADG A I+QC I  G+++ Y +T V   GT F+H H+   R A L+G +I+ 
Sbjct: 94  ILQRGTPWADGTASISQCAINPGETFFYNFT-VDNPGTFFYHGHLGMQRSAGLYGSLIVD 152

Query: 527 PKKNVSYPFVKPYKEVPIIFGEWFN 601
           P +    PF     E+ ++  +W++
Sbjct: 153 PPQGKKEPFHYD-GEINLLLSDWWH 176



>gb:AF233593_1779469 Cucumis melo ascorbate oxidase AO1 mRNA,
           complete cds.
          Length = 591

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 51/163 (31%), Positives = 95/163 (58%), Gaps = 2/163 (1%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-NISIHWH 346
           TRH+++ V     +  C    ++ +N ++PGP I A  GD +++++ N ++  ++ IHWH
Sbjct: 39  TRHFKWEVEYMFRSPDCKENLVMGINHQFPGPTIRANVGDTVVVELINKLSTEDVVIHWH 98

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           GI Q  + WADG A I+QC I  G+S+ Y++ +V + GT F+H H+   RA  L+G +I+
Sbjct: 99  GILQKGTPWADGTASISQCAINPGESFTYQF-VVDKPGTYFYHGHLGMQRAAGLYGSLIV 157

Query: 524 LPKKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGP 652
             ++    PF    +E+ ++  +W++   E+++ Q +     P
Sbjct: 158 DLEEGKKEPFHYD-EEINLLLSDWWH---ESVLKQEVGLSSSP 196



>gb:AY485825_1608502 Ganoderma lucidum laccase gene, complete
           cds.>gb:AY485829_1608506 Ganoderma lucidum laccase mRNA,
           complete cds.
          Length = 521

 Score = 97.8 bits (242), Expect = 2e-19
 Identities = 49/132 (37%), Positives = 75/132 (56%), Gaps = 7/132 (5%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPA 388
           T++ V VNG  PGP I   +GD   I V N + N+      SIHWHG+ Q  + WADGPA
Sbjct: 42  TRAAVVVNGVSPGPLITGNKGDNFQINVINQMTNHTMNKTTSIHWHGLFQEGTNWADGPA 101

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKP 562
           ++TQCPI +G S++Y + +  Q GT ++H+H+S      L GP+++  P   +++ +   
Sbjct: 102 FVTQCPIVSGNSFLYNFHVPDQAGTFWYHSHLSTQYCDGLRGPLVVYDPHDPLAHMYDVD 161

Query: 563 YKEVPIIFGEWF 598
                I   EW+
Sbjct: 162 DDSTVITLTEWY 173



>pir|S11027|S11027 L-ascorbate oxidase (EC 1.10.3.3) precursor -
           Cucurbita cv. Ebisu Nankin>gb:CSASOX_1673868 Pumpkin
           mRNA for ascorbate oxidase.
          Length = 579

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 50/143 (34%), Positives = 81/143 (56%), Gaps = 2/143 (1%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHV-ANNISIHWHG 349
           RHY++ V        C+   ++ +NG++PGP I A  GD +++++ N +    + IHWHG
Sbjct: 34  RHYKWEVEYMFWAPDCNENIVMGINGQFPGPTIRANAGDTVVVELINKLHTEGVVIHWHG 93

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLR-ATLHGPIIIL 526
           I Q  + WADG A I+QC I  G+++ Y +T V   GT F+H H+   R A L+G +I+ 
Sbjct: 94  ILQRGTPWADGTASISQCAINPGETFFYNFT-VDNPGTFFYHGHLGMQRSAGLYGSLIVD 152

Query: 527 PKKNVSYPFVKPYKEVPIIFGEW 595
           P +    PF     E+ ++  +W
Sbjct: 153 PPQGKKEPFHYD-GEINLLLSDW 174



>sp|Q12717|LAC5_TRAVE Laccase 5 precursor (EC 1.10.3.2)
           (Benzenediol:oxygen oxidoreductase) (Urishiol oxidase)
           (Diphenol oxidase) (Laccase IV).>gb:TVU44431_1726160
           Trametes versicolor laccase IV (lccIV) mRNA, complete
           cds.
          Length = 527

 Score = 96.7 bits (239), Expect = 4e-19
 Identities = 55/175 (31%), Positives = 91/175 (52%), Gaps = 7/175 (4%)
 Frame = +2

Query: 182 EFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWH 346
           +  ++  +VT    T++ V   G +PGP I   +GD   I V +++ N     + +IHWH
Sbjct: 30  DLTISNADVTPDGITRAAVLAGGVFPGPLITGNKGDEFQINVIDNLTNETMLKSTTIHWH 89

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           GI Q  + WADG A++ QCPI TG S++Y +T+  Q GT ++H+H+S      L GP+++
Sbjct: 90  GIFQAGTNWADGAAFVNQCPIATGNSFLYDFTVPDQAGTFWYHSHLSTQYCDGLRGPLVV 149

Query: 524 LPKKNVSYPFVKPYKEVPII-FGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
               + +        +  +I   +W++  T A +  A   G      D+  INGL
Sbjct: 150 YDPDDANASLYDVDDDTTVITLADWYH--TAAKLGPAFPAG-----PDSVLINGL 197



>gb:AF414808_1797636 Trametes pubescens laccase 1A (lap1A) gene,
           complete cds.
          Length = 526

 Score = 95.9 bits (237), Expect = 6e-19
 Identities = 55/175 (31%), Positives = 91/175 (52%), Gaps = 7/175 (4%)
 Frame = +2

Query: 182 EFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWH 346
           +  ++  +VT    T++ V  N  +PGP I   +GD   I V +++ N     + +IHWH
Sbjct: 29  DLTISNADVTPDGITRAAVLANSVFPGPLITGNKGDEFQINVIDNLTNETMLKSTTIHWH 88

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           GI Q  + WADG A++ QCPI TG S++Y +T+  Q GT ++H+H+S      L GP+++
Sbjct: 89  GIFQAGTNWADGAAFVNQCPIATGNSFLYDFTVPDQAGTFWYHSHLSTQYCDGLRGPLVV 148

Query: 524 LPKKNVSYPFVKPYKEVPII-FGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
               + +        +  +I   +W++  T A +  A   G      D+  INGL
Sbjct: 149 YDPDDPNASLYDVDDDTTVITLADWYH--TAAKLGPAFPAG-----PDSVLINGL 196



>gb:D84235_1674851 Coriolus versicolor gene for laccase, complete
           cds.
          Length = 526

 Score = 95.9 bits (237), Expect = 6e-19
 Identities = 55/175 (31%), Positives = 91/175 (52%), Gaps = 7/175 (4%)
 Frame = +2

Query: 182 EFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWH 346
           +  ++  +VT    T++ V   G +PGP I   +GD   I V +++ N     + +IHWH
Sbjct: 30  DLTISNADVTPDGITRAAVLAGGVFPGPLITGNKGDEFQINVIDNLTNETMLKSTTIHWH 89

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           GI Q  + WADG A++ QCPI TG S++Y +T+  Q GT ++H+H+S      L GP+++
Sbjct: 90  GIFQAGTNWADGAAFVNQCPIATGNSFLYDFTVPDQAGTFWYHSHLSTQYCDGLRGPLVV 149

Query: 524 LPKKNVSYPFVKPYKEVPII-FGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
               + +        +  +I   +W++  T A +  A   G      D+  INGL
Sbjct: 150 YDPDDPNASLYDVDDDTTVITLADWYH--TAAKLGPAFPAG-----PDSVLINGL 197



>gb:AY099586_1576612 Arabidopsis thaliana ascorbate oxidase-like
           protein (At5g21100) mRNA, complete
           cds.>gb:BT003407_1636830 Arabidopsis thaliana ascorbate
           oxidase-like protein (At5g21100) mRNA, complete
           cds.>gb:AC140977_1744081 Arabidopsis thaliana chromosome
           5 BAC F13M11 genomic sequence, complete sequence.
          Length = 573

 Score = 95.9 bits (237), Expect = 6e-19
 Identities = 54/148 (36%), Positives = 87/148 (58%), Gaps = 3/148 (2%)
 Frame = +2

Query: 218 CHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANN-ISIHWHGIRQLRSGWADGPAYI 394
           C    ++ +NG++PGP I A  GD ++I V N ++   + IHWHGIRQ  + WADG A +
Sbjct: 39  CKEGIVMAINGQFPGPTIDAVAGDTVIIHVVNKLSTEGVVIHWHGIRQKGTPWADGAAGV 98

Query: 395 TQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII-LPKKNVSYPFVKPYK 568
           TQCPI  G+++ YK+ IV + GT F+H H    R++ L+G +I+  PK+ + Y       
Sbjct: 99  TQCPINPGETFTYKF-IVDKAGTHFYHGHYGMQRSSGLYGMLIVRSPKERLIYD-----G 152

Query: 569 EVPIIFGEWFNGDTEAIISQALQTGGGP 652
           E  ++  +W++   ++I +Q L     P
Sbjct: 153 EFNLLLSDWWH---QSIHAQELALSSRP 177



>sp|Q99056|LAC5_TRAVI Laccase 5 precursor (EC 1.10.3.2)
           (Benzenediol:oxygen oxidoreductase) (Urishiol
           oxidase).>pir|JC5357|JC5357 laccase (EC 1.10.3.2) 5
           precursor - white-rot fungus  (Trametes
           villosa)>gb:TMTLCCE_1725318 Trametes villosa laccase
           (lcc5) gene, complete cds.
          Length = 527

 Score = 95.9 bits (237), Expect = 6e-19
 Identities = 55/175 (31%), Positives = 91/175 (52%), Gaps = 7/175 (4%)
 Frame = +2

Query: 182 EFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWH 346
           +  ++  +VT    T++ V   G +PGP I   +GD   I V +++ N     + +IHWH
Sbjct: 30  DLTISNADVTPDGITRAAVLAGGVFPGPLITGNKGDEFQINVIDNLTNETMLKSTTIHWH 89

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           GI Q  + WADG A++ QCPI TG S++Y +T+  Q GT ++H+H+S      L GP+++
Sbjct: 90  GIFQAGTNWADGAAFVNQCPIATGNSFLYDFTVPDQAGTFWYHSHLSTQYCDGLRGPLVV 149

Query: 524 LPKKNVSYPFVKPYKEVPII-FGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
               + +        +  +I   +W++  T A +  A   G      D+  INGL
Sbjct: 150 YDPDDPNASLYDVDDDTTVITLADWYH--TAAKLGPAFPAG-----PDSVLINGL 197



>gb:AF548035_1810720 Trametes sp. I-62 laccase (pox3) mRNA, complete
           cds.
          Length = 524

 Score = 95.5 bits (236), Expect = 8e-19
 Identities = 57/175 (32%), Positives = 89/175 (50%), Gaps = 7/175 (4%)
 Frame = +2

Query: 182 EFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWH 346
           +  ++  NV+     ++ V  NG  PGP I  ++GD   I V N + N+      SIHWH
Sbjct: 32  DLTISNANVSPDGFQRAAVVANGGVPGPLINGQKGDHFQINVVNQLTNHTMLKSTSIHWH 91

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           G  Q  + WADGPA++ QCPI TG S++Y + +  Q GT ++H+H+S      L GP ++
Sbjct: 92  GFFQKGTNWADGPAFVNQCPIATGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVV 151

Query: 524 L-PKKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
             P    +  +    ++  I   +W++    A +  A      P  +DA  INGL
Sbjct: 152 YDPNDPHASLYDVDNEDTVITLADWYH--VAAKLGPAF-----PPRADATLINGL 199



>gb:AF243855_1780276 Botryotinia fuckeliana laccase 2 (lcc2) gene,
           complete cds.
          Length = 581

 Score = 95.5 bits (236), Expect = 8e-19
 Identities = 67/174 (38%), Positives = 89/174 (51%), Gaps = 3/174 (1%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANN-ISIHWH 346
           TR Y  +V    +T   +T+S +T NG  PGP I A  GD L+I V N++ +N  SIHWH
Sbjct: 68  TREYWLSVENSTITPDGYTRSAMTFNGTVPGPAITADWGDNLIIHVTNNLQHNGTSIHWH 127

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           GIRQL S   DG   +TQCPI  G +  YK+    Q GT ++H+H S   A  L GP+II
Sbjct: 128 GIRQLGSLEYDGVPGVTQCPIAPGDTLTYKFQAT-QYGTTWYHSHFSLQYADGLFGPLII 186

Query: 524 LPKKNVSYPFVKPYKEVPIIF-GEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
                  Y      ++V  IF  +W +     I   A Q  G P   +   +NG
Sbjct: 187 NGPATADYD-----EDVGAIFLQDWAHKSVFEIWDSARQ--GAPPALENTLMNG 233



>gb:AF123571_1769926 Pycnoporus cinnabarinus laccase (lcc3-2) gene,
           complete cds.
          Length = 521

 Score = 95.5 bits (236), Expect = 8e-19
 Identities = 45/132 (34%), Positives = 76/132 (57%), Gaps = 7/132 (5%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPAY 391
           ++ V VNG +PGP I  ++GD   + V N + N+      SIHWHG+ Q  + WADGPA+
Sbjct: 45  RAAVVVNGAFPGPLISGKKGDHFQLNVINKLTNHTMLKTTSIHWHGLFQEHTNWADGPAF 104

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKPY 565
           + QCPI +G S++Y + +  Q GT ++H+H+S      L GP+++  P    ++ +    
Sbjct: 105 VNQCPIASGHSFLYDFHVPDQAGTYWYHSHLSTQYCDGLRGPLVVYDPHDPQAHLYDVDN 164

Query: 566 KEVPIIFGEWFN 601
            +  I   +W++
Sbjct: 165 DDTVITLADWYH 176



>gb:PGU65401_1700034 Basidiomycete CECT 20197 phenoloxidase (pox3)
           gene, complete cds.
          Length = 524

 Score = 95.5 bits (236), Expect = 8e-19
 Identities = 57/175 (32%), Positives = 89/175 (50%), Gaps = 7/175 (4%)
 Frame = +2

Query: 182 EFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWH 346
           +  ++  NV+     ++ V  NG  PGP I  ++GD   I V N + N+      SIHWH
Sbjct: 32  DLTISNANVSPDGFQRAAVVANGGVPGPLINGQKGDHFQINVVNQLTNHTMLKSTSIHWH 91

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           G  Q  + WADGPA++ QCPI TG S++Y + +  Q GT ++H+H+S      L GP ++
Sbjct: 92  GFFQKGTNWADGPAFVNQCPIATGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVV 151

Query: 524 L-PKKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
             P    +  +    ++  I   +W++    A +  A      P  +DA  INGL
Sbjct: 152 YDPNDPHASLYDVDNEDTVITLADWYH--VAAKLGPAF-----PPRADATLINGL 199



>gb:AY458017_1607237 Pycnoporus sanguineus laccase mRNA, complete
           cds.>gb:AY510604_1610468 Pycnoporus sanguineus laccase
           gene, complete cds.
          Length = 518

 Score = 95.5 bits (236), Expect = 8e-19
 Identities = 45/132 (34%), Positives = 76/132 (57%), Gaps = 7/132 (5%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPAY 391
           ++ V VNG +PGP I  ++GD   + V N + N+      SIHWHG+ Q  + WADGPA+
Sbjct: 42  RAAVVVNGDFPGPLISGKKGDHFQLNVINKLTNHTMLKTTSIHWHGLFQEHTNWADGPAF 101

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKPY 565
           + QCPI +G S++Y + +  Q GT ++H+H+S      L GP+++  P    ++ +    
Sbjct: 102 VNQCPIASGHSFLYDFHVPDQAGTYWYHSHLSTQYCDGLRGPLVVYDPHDPQAHLYDVDN 161

Query: 566 KEVPIIFGEWFN 601
            +  I   +W++
Sbjct: 162 DDTVITLADWYH 173



>gb:AY049725_1562065 Trametes versicolor laccase 1 (lac1) mRNA,
           complete cds.
          Length = 519

 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 54/160 (33%), Positives = 84/160 (52%), Gaps = 7/160 (4%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKV-----NNHVANNISIHWHGIRQLRSGWADGPAY 391
           +  + VNG  P P I A++GDR  + V     N+ +  + SIHWHG  Q  + WADGPA+
Sbjct: 42  RDAIVVNGVVPSPLIRAKKGDRFQLNVVDTLTNHSMLKSTSIHWHGFFQAGTNWADGPAF 101

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKPY 565
           + QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++  PK   +  +    
Sbjct: 102 VNQCPIASGHSFLYDFHVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPKDPHASRYDVDN 161

Query: 566 KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
           +   I   +W++  T A +      G     +DA  INGL
Sbjct: 162 ESTVITLTDWYH--TAARLGPRFPLG-----ADATVINGL 194



>pir|H86351|H86351 protein T26F17.6 [imported] - Arabidopsis
           thaliana>gb:AE005172_891134 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC013482_1537955 Genomic sequence for
           Arabidopsis thaliana BAC T26F17 from chromosome I,
           complete sequence.
          Length = 551

 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 54/171 (31%), Positives = 88/171 (51%), Gaps = 1/171 (0%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGI 352
           + +E++VT  N++ L   +  + +NGK+PGP I A   D L+I V NH+     I W GI
Sbjct: 29  KFFEWHVTYGNISPLKVAQQGILINGKFPGPDIAAVTNDNLIINVFNHLDEPFLISWSGI 88

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILP 529
           R  R+ + DG  Y T CPI  G++Y Y   +  Q G+ ++   + + +A    G I I  
Sbjct: 89  RNWRNSYQDG-VYGTTCPIPPGKNYTYALQVKDQIGSFYYFPSLGFHKAAGGFGAIRISS 147

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
           +  +  PF  P  +  ++ G+W+  + + + +Q L  GG     D   ING
Sbjct: 148 RPRIPVPFPAPAGDYTVLIGDWYKTNHKDLRAQ-LDNGGKLPFPDGILING 197



>gb:AF206721_1776764 Brassica juncea isolate BJAO1 ascorbate oxidase
           mRNA, partial cds.
          Length = 574

 Score = 94.7 bits (234), Expect = 1e-18
 Identities = 50/136 (36%), Positives = 79/136 (58%), Gaps = 3/136 (2%)
 Frame = +2

Query: 218 CHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANN-ISIHWHGIRQLRSGWADGPAYI 394
           C    ++ +NG++PGP I A  GD +++ V N ++   + IHWHGIRQ  + WADG A +
Sbjct: 40  CKEGIVIAINGEFPGPTINAVAGDTVIVHVTNKLSTEGVVIHWHGIRQNGTPWADGAAGV 99

Query: 395 TQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLR-ATLHGPIII-LPKKNVSYPFVKPYK 568
           TQCPI  G++  Y + IV + GT F+H H    R A L+G +I+  PK+ + Y       
Sbjct: 100 TQCPINPGETLTYNF-IVDKAGTHFYHGHYGMQRSAGLYGMMIVRSPKETLQYD-----G 153

Query: 569 EVPIIFGEWFNGDTEA 616
           E  ++  +W++  + A
Sbjct: 154 EFNLLLSDWWHQSSHA 169



>gb:AF176230_1774553 Polyporus ciliatus laccase (lcc3-1) mRNA,
           complete cds.
          Length = 518

 Score = 94.7 bits (234), Expect = 1e-18
 Identities = 44/120 (36%), Positives = 70/120 (58%), Gaps = 6/120 (5%)
 Frame = +2

Query: 182 EFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWH 346
           +  VT  N++     ++ V VNG +P P I  ++GDR  + + N + N+      SIHWH
Sbjct: 28  DLTVTDANISPDGFNRAAVVVNGVFPAPLITGQKGDRFQLNLVNQMTNHTMLKTTSIHWH 87

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           G  Q  + WADGPA++ QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++
Sbjct: 88  GFFQKGTNWADGPAFVNQCPIASGNSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVV 147



>gb:MTY15295_1687715 Medicago truncatula mRNA for L-ascorbate
           oxidase.
          Length = 569

 Score = 94.7 bits (234), Expect = 1e-18
 Identities = 51/128 (39%), Positives = 73/128 (57%), Gaps = 2/128 (1%)
 Frame = +2

Query: 176 HYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHV-ANNISIHWHGI 352
           HY+F+V        C    ++ +NG++PGP I A  GD L+I + N +      IHWHGI
Sbjct: 27  HYKFDVEYIYKKPDCKEHVVMGINGQFPGPTIRAEVGDTLVIDLTNKLHTEGTVIHWHGI 86

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILP 529
           RQ  + WADG A I+QC I  G+++ YK+  V + GT F+H H    RA  L+G +I+  
Sbjct: 87  RQFGTPWADGTAAISQCAINPGETFQYKFK-VDRPGTYFYHGHYGMQRAAGLYGSLIVDL 145

Query: 530 KKNVSYPF 553
            K+   PF
Sbjct: 146 PKSQREPF 153



>gb:AY676426_1621957 Lentinula edodes laccase 2 VT (LAC2) mRNA,
           complete cds.
          Length = 518

 Score = 94.7 bits (234), Expect = 1e-18
 Identities = 56/163 (34%), Positives = 83/163 (50%), Gaps = 10/163 (6%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWHGIRQLRSGWADGPAY 391
           +S V   G +PGP I   +GD   I V + + N     + SIHWHG+ Q  + WADGPA+
Sbjct: 40  RSGVLAEGVFPGPLITGNKGDNFQINVIDELTNGTMLLSTSIHWHGLFQKTTNWADGPAF 99

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPY- 565
           + QCPI    S++Y + +  Q GT ++H+H+S      L GP+++   ++   P+V  Y 
Sbjct: 100 VNQCPIAANDSFLYNFNVPDQAGTFWYHSHLSTQYCDGLRGPLVVYDPQD---PYVDLYD 156

Query: 566 ---KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
                  I   +W++         A Q G  P  SDA  INGL
Sbjct: 157 VDDDSTVITLADWYH-------VPAPQAGAVP-TSDATLINGL 191



>gb:AY532147_1612044 Phanerochaete chrysosporium strain BKM-1767
           multicopper oxidase 3B-I10 splice variant (mco3) mRNA,
           complete cds, alternatively spliced.
          Length = 462

 Score = 94.7 bits (234), Expect = 1e-18
 Identities = 53/160 (33%), Positives = 85/160 (53%), Gaps = 7/160 (4%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQLRSGWADGPAYITQCP 406
           K ++ VNG YPGP I A +GDR+++KV N + N  +IHWHG+ Q  + + DG A IT+C 
Sbjct: 112 KPMLVVNGMYPGPTIEANQGDRVVVKVTNMLENRTTIHWHGLFQNGTNYYDGTAAITECG 171

Query: 407 IQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPYKEVPII 583
           I  GQ+ VY +T+    GT +WHAH S      + G +++ P   +         ++ + 
Sbjct: 172 IPPGQTLVYNFTLGEFSGTTWWHAHYSTQYTDGITGALVVHPTDPLPASIPPWDGDLVVQ 231

Query: 584 FGEWFNGDTEAIISQALQ------TGGGPNVSDAYTINGL 685
             + ++  +  ++ + L         G   V DA T+NGL
Sbjct: 232 VSDLYHTFSPVLLERFLSPWGIDGVPGDEPVPDAGTLNGL 271



>gb:AY532142_1612039 Phanerochaete chrysosporium strain BKM-1767
           multicopper oxidase 3B (mco3) mRNA, complete cds.
          Length = 613

 Score = 94.7 bits (234), Expect = 1e-18
 Identities = 53/160 (33%), Positives = 85/160 (53%), Gaps = 7/160 (4%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQLRSGWADGPAYITQCP 406
           K ++ VNG YPGP I A +GDR+++KV N + N  +IHWHG+ Q  + + DG A IT+C 
Sbjct: 112 KPMLVVNGMYPGPTIEANQGDRVVVKVTNMLENRTTIHWHGLFQNGTNYYDGTAAITECG 171

Query: 407 IQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPYKEVPII 583
           I  GQ+ VY +T+    GT +WHAH S      + G +++ P   +         ++ + 
Sbjct: 172 IPPGQTLVYNFTLGEFSGTTWWHAHYSTQYTDGITGALVVHPTDPLPASIPPWDGDLVVQ 231

Query: 584 FGEWFNGDTEAIISQALQ------TGGGPNVSDAYTINGL 685
             + ++  +  ++ + L         G   V DA T+NGL
Sbjct: 232 VSDLYHTFSPVLLERFLSPWGIDGVPGDEPVPDAGTLNGL 271



>gb:AF548034_1810719 Trametes sp. I-62 laccase (pox2) mRNA, complete
           cds.
          Length = 520

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 52/160 (32%), Positives = 82/160 (51%), Gaps = 7/160 (4%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPAY 391
           +  V VNG  PGP +    GDR  + V +++ N+      SIHWHG+ Q  + WADGPA+
Sbjct: 43  RQAVVVNGVTPGPLVKGNMGDRFQLNVIDNLTNHTMLKSTSIHWHGLFQHGTNWADGPAF 102

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKPY 565
           + QCP+  G S++Y + + GQ GT ++H+H+S      L GP+++  P       +    
Sbjct: 103 VNQCPVSAGHSFLYDFQVPGQAGTFWYHSHLSTQYCDGLRGPLVVYDPHDPHKSRYDVDN 162

Query: 566 KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
            +  I   +W++         A +    P  +DA  INGL
Sbjct: 163 DDTVITLADWYH-------VAAKRRSAFPLGADATLINGL 195



>gb:PGU65400_1700033 Basidiomycete CECT 20197 phenoloxidase (pox2)
           gene, complete cds.
          Length = 520

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 52/160 (32%), Positives = 82/160 (51%), Gaps = 7/160 (4%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPAY 391
           +  V VNG  PGP +    GDR  + V +++ N+      SIHWHG+ Q  + WADGPA+
Sbjct: 43  RQAVVVNGVTPGPLVKGNMGDRFQLNVIDNLTNHTMLKSTSIHWHGLFQHGTNWADGPAF 102

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKPY 565
           + QCP+  G S++Y + + GQ GT ++H+H+S      L GP+++  P       +    
Sbjct: 103 VNQCPVSAGHSFLYDFQVPGQAGTFWYHSHLSTQYCDGLRGPLVVYDPHDPHKSRYDVDN 162

Query: 566 KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
            +  I   +W++         A +    P  +DA  INGL
Sbjct: 163 DDTVITLADWYH-------VAAKRRSAFPLGADATLINGL 195



>gb:AY532148_1612045 Phanerochaete chrysosporium strain BKM-1767
           multicopper oxidase 3B-E6/11 splice variant (mco3) mRNA,
           complete cds, alternatively spliced.
          Length = 286

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 42/87 (48%), Positives = 58/87 (66%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQLRSGWADGPAYITQCP 406
           K ++ VNG YPGP I A +GDR+++KV N + N  +IHWHG+ Q  + + DG A IT+C 
Sbjct: 112 KPMLVVNGMYPGPTIEANQGDRVVVKVTNMLENRTTIHWHGLFQNGTNYYDGTAAITECG 171

Query: 407 IQTGQSYVYKYTIVGQRGTLFWHAHIS 487
           I  GQ+ VY +T+    GT +WHAH S
Sbjct: 172 IPPGQTLVYNFTLGEFSGTTWWHAHYS 198



>gb:AY532146_1612043 Phanerochaete chrysosporium strain BKM-1767
           multicopper oxidase 3B-I6 splice variant (mco3) mRNA,
           complete cds, alternatively spliced.
          Length = 297

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 42/87 (48%), Positives = 58/87 (66%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQLRSGWADGPAYITQCP 406
           K ++ VNG YPGP I A +GDR+++KV N + N  +IHWHG+ Q  + + DG A IT+C 
Sbjct: 112 KPMLVVNGMYPGPTIEANQGDRVVVKVTNMLENRTTIHWHGLFQNGTNYYDGTAAITECG 171

Query: 407 IQTGQSYVYKYTIVGQRGTLFWHAHIS 487
           I  GQ+ VY +T+    GT +WHAH S
Sbjct: 172 IPPGQTLVYNFTLGEFSGTTWWHAHYS 198



>gb:AY450406_1606654 Flammulina velutipes laccase mRNA, complete
           cds.>gb:AY485826_1608503 Flammulina velutipes laccase
           gene, complete cds.
          Length = 521

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 45/117 (38%), Positives = 70/117 (59%), Gaps = 6/117 (5%)
 Frame = +2

Query: 191 VTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIR 355
           ++  +VT    T++ V VN  +P P I   +GD   + V N + N+      SIHWHG+ 
Sbjct: 31  ISNADVTPDGFTRAAVVVNEAFPSPLITGYKGDHFRLNVINRMTNHTMLKTTSIHWHGLF 90

Query: 356 QLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           Q  + WADGPA++TQCPI +G S++Y + + GQ GT ++H+H+S      L GP ++
Sbjct: 91  QRGTNWADGPAFVTQCPIASGDSFLYDFRVPGQAGTFWYHSHLSTQYCDGLRGPSVV 147



>gb:AY338484_1600485 Volvariella volvacea laccase 3 (lac3) mRNA,
           complete cds.
          Length = 533

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 45/106 (42%), Positives = 64/106 (60%), Gaps = 6/106 (5%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPA 388
           ++  V  NG YPGP I   +GDR LI V N + +       SIHWHG  Q  + WADG A
Sbjct: 39  SRGSVLANGAYPGPLITGSKGDRFLINVINELTDTTMLRATSIHWHGFFQNHTAWADGVA 98

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
            +TQCPI   +S++Y +T+  Q GTL++H+H+S      L GP+++
Sbjct: 99  SVTQCPIVPSESFLYNFTVPDQAGTLWYHSHLSTQYCDGLRGPLVV 144



>pir|S68120|S68120 laccase (EC 1.10.3.2) 4 precursor - Rhizoctonia
           solani
          Length = 529

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 59/180 (32%), Positives = 90/180 (50%), Gaps = 10/180 (5%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANN-----ISI 337
           R+Y+F++   NV      + IV+VNG  PG  I A +GD L I V N + +       +I
Sbjct: 23  RNYKFDIKNVNVAPDGFQRPIVSVNGLVPGTLITANKGDTLRINVTNQLTDPSMRRATTI 82

Query: 338 HWHGIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHI-SWLRATLHGP 514
           HWHG+ Q  +   DGPA++TQCPI    SY Y+  + GQ GT+++HAH+ S     L GP
Sbjct: 83  HWHGLFQATTADEDGPAFVTQCPIAQNLSYTYEIPLHGQTGTMWYHAHLASQYVDGLRGP 142

Query: 515 IIIL-PKKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVS---DAYTING 682
           ++I  P       +        ++  +W++     +  Q   T     +S   D+  ING
Sbjct: 143 LVIYDPNDPHKSRYDVDDASTVVMLEDWYHTPAPVLEKQMFSTNNTALLSPVPDSGLING 202



>sp|Q02081|LAC4_THACU Laccase 4 precursor (EC 1.10.3.2)
           (Benzenediol:oxygen oxidoreductase) (Urishiol oxidase)
           (Diphenol oxidase).>gb:RSLAC4_1704028 R.solani gene for
           laccase (3431 BP).
          Length = 531

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 59/180 (32%), Positives = 90/180 (50%), Gaps = 10/180 (5%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANN-----ISI 337
           R+Y+F++   NV      + IV+VNG  PG  I A +GD L I V N + +       +I
Sbjct: 23  RNYKFDIKNVNVAPDGFQRPIVSVNGLVPGTLITANKGDTLRINVTNQLTDPSMRRATTI 82

Query: 338 HWHGIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHI-SWLRATLHGP 514
           HWHG+ Q  +   DGPA++TQCPI    SY Y+  + GQ GT+++HAH+ S     L GP
Sbjct: 83  HWHGLFQATTADEDGPAFVTQCPIAQNLSYTYEIPLHGQTGTMWYHAHLASQYVDGLRGP 142

Query: 515 IIIL-PKKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVS---DAYTING 682
           ++I  P       +        ++  +W++     +  Q   T     +S   D+  ING
Sbjct: 143 LVIYDPNDPHKSRYDVDDASTVVMLEDWYHTPAPVLEKQMFSTNNTALLSPVPDSGLING 202



>gb:AY839938_1630506 Trametes sp. AH28-2 laccase D (lacD) gene,
           partial cds.
          Length = 459

 Score = 94.0 bits (232), Expect = 2e-18
 Identities = 52/162 (32%), Positives = 83/162 (51%), Gaps = 9/162 (5%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPAY 391
           +  +  NG +PGP I   +GDR  + V ++++N+      SIHWHG  Q  + WADGPA+
Sbjct: 22  RDAIVTNGVFPGPLIKGNKGDRFQLNVIDNLSNHTMLKSTSIHWHGFFQAGTNWADGPAF 81

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKN---VSYPFVK 559
           + QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++   K+     Y    
Sbjct: 82  VNQCPIASGHSFLYDFHVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPKDPHASRYDVDN 141

Query: 560 PYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
                 I   +W++  T A +      G     +D+  INGL
Sbjct: 142 GQSSTVITLSDWYH--TAARLRPRFPLG-----ADSTLINGL 176



>gb:AE005172_891135 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC013482_1537956 Genomic sequence
           for Arabidopsis thaliana BAC T26F17 from chromosome I,
           complete sequence.
          Length = 538

 Score = 94.0 bits (232), Expect = 2e-18
 Identities = 52/171 (30%), Positives = 91/171 (53%), Gaps = 1/171 (0%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGI 352
           R +E++VT  N++ L   +  + +NGK+PGP I++   D L+I V NH+     + W+GI
Sbjct: 29  RFFEWHVTYGNISPLGVAQQGILINGKFPGPDIISITNDNLIINVFNHLDEPFLLSWNGI 88

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILP 529
           R  ++ + DG  Y T CPI  G++Y Y   +  Q G+ ++   + + +A    G I I  
Sbjct: 89  RNWKNSFQDG-VYGTMCPIPPGKNYTYALQVKDQIGSFYYFPSLGFHKAAGGFGGIRISS 147

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
           +  +  PF  P  +  ++ G+W+  + + + +Q L  GG   + D   ING
Sbjct: 148 RALIPVPFPTPADDYTLLVGDWYKTNHKDLKAQ-LDNGGKLPLPDGILING 197



>sp|Q12718|LAC2_TRAVE Laccase 2 precursor (EC 1.10.3.2)
           (Benzenediol:oxygen oxidoreductase) (Urishiol oxidase)
           (Diphenol oxidase) (Laccase I).>gb:TVU44851_1726161
           Trametes versicolor laccase I (lccI) gene, complete cds.
          Length = 519

 Score = 94.0 bits (232), Expect = 2e-18
 Identities = 53/160 (33%), Positives = 84/160 (52%), Gaps = 7/160 (4%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVANN-----ISIHWHGIRQLRSGWADGPAY 391
           +  + VNG  P P I  ++GDR  + V++ + N+      SIHWHG  Q  + WADGPA+
Sbjct: 42  RDAIVVNGVVPSPLITGKKGDRFQLNVDDTLTNHSMLKSTSIHWHGFFQAGTNWADGPAF 101

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKPY 565
           + QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++  PK   +  +    
Sbjct: 102 VNQCPIASGHSFLYDFHVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPKDPHASRYDVDN 161

Query: 566 KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
           +   I   +W++  T A +      G     +DA  INGL
Sbjct: 162 ESTVITLTDWYH--TAARLGPRFPLG-----ADATLINGL 194



>gb:TVU44430_1726159 Trametes versicolor laccase I (lccI) mRNA,
           complete cds.
          Length = 519

 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 53/160 (33%), Positives = 83/160 (51%), Gaps = 7/160 (4%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKV-----NNHVANNISIHWHGIRQLRSGWADGPAY 391
           +  + VNG  P P I  ++GDR  + V     N+ +  + SIHWHG  Q  + WADGPA+
Sbjct: 42  RDAIVVNGVVPSPLITGKKGDRFQLNVVDTLTNHSMLKSTSIHWHGFFQAGTNWADGPAF 101

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKPY 565
           + QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++  PK   +  +    
Sbjct: 102 VNQCPIASGHSFLYDFHVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPKDPHASRYDVDN 161

Query: 566 KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
           +   I   +W++  T A +      G     +DA  INGL
Sbjct: 162 ESTVITLTDWYH--TAARLGPRFPLG-----ADATLINGL 194



>gb:AY693776_1623449 Trametes versicolor laccase 1 (lcc1) mRNA,
           complete cds.
          Length = 519

 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 53/160 (33%), Positives = 83/160 (51%), Gaps = 7/160 (4%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKV-----NNHVANNISIHWHGIRQLRSGWADGPAY 391
           +  + VNG  P P I  ++GDR  + V     N+ +  + SIHWHG  Q  + WADGPA+
Sbjct: 42  RDAIVVNGVVPSPLITGKKGDRFQLNVVDTLTNHSMLKSTSIHWHGFFQAGTNWADGPAF 101

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKPY 565
           + QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++  PK   +  +    
Sbjct: 102 VNQCPIASGHSFLYDFHVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPKDPHASRYDVDN 161

Query: 566 KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
           +   I   +W++  T A +      G     +DA  INGL
Sbjct: 162 ESTVITLTDWYH--TAARLGPRFPLG-----ADATLINGL 194



>gb:AY338487_1600488 Volvariella volvacea laccase 6 (lac6) mRNA,
           complete cds.
          Length = 508

 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 47/134 (35%), Positives = 76/134 (56%), Gaps = 7/134 (5%)
 Frame = +2

Query: 221 HTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGP 385
           H++ +V VNG   G  I  R+GD   I+V+N + N++     SIHWHG+ Q  S WADGP
Sbjct: 29  HSREVVLVNGALFGKLITGRKGDDFEIEVDNQLTNSLLRKSTSIHWHGLFQRGSAWADGP 88

Query: 386 AYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNV-SYPFVK 559
           A++TQCPI  G ++ Y +T   + GT ++H+H+       L GP +I  + +   + +  
Sbjct: 89  AFVTQCPIAPGNTFTYSFTPTDEVGTFWYHSHLDAQYCDGLRGPFVIYDRFDPHRHRYDV 148

Query: 560 PYKEVPIIFGEWFN 601
             K+  I   +W++
Sbjct: 149 DNKDTIITLADWYH 162



>gb:AX384796_1466759 Sequence 1 from Patent WO0196543.
          Length = 499

 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 53/160 (33%), Positives = 83/160 (51%), Gaps = 7/160 (4%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKV-----NNHVANNISIHWHGIRQLRSGWADGPAY 391
           +  + VNG  P P I  ++GDR  + V     N+ +  + SIHWHG  Q  + WADGPA+
Sbjct: 22  RDAIVVNGVVPSPLITGKKGDRFQLNVVDTLTNHSMLKSTSIHWHGFFQAGTNWADGPAF 81

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKPY 565
           + QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++  PK   +  +    
Sbjct: 82  VNQCPIASGHSFLYDFHVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPKDPHASRYDVDN 141

Query: 566 KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
           +   I   +W++  T A +      G     +DA  INGL
Sbjct: 142 ESTVITLTDWYH--TAARLGPRFPLG-----ADATLINGL 174



>gb:POAJ5017_1700933 Pleurotus ostreatus poxA1b gene for
           laccase.>gb:POAJ5018_1700934 Pleurotus ostreatus mRNA
           for laccase (poxa1b gene).
          Length = 533

 Score = 93.2 bits (230), Expect = 4e-18
 Identities = 55/163 (33%), Positives = 84/163 (51%), Gaps = 10/163 (6%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWHGIRQLRSGWADGPAY 391
           +S V   G YPGP I  + GDR  I V N +A+     + SIHWHG+      WADGPA 
Sbjct: 42  RSTVLAGGSYPGPLIKGKTGDRFQINVVNKLADTSMPVDTSIHWHGLFVKGHNWADGPAM 101

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPY- 565
           +TQCPI  G S++Y + +  Q GT ++H+H+       L GP+++  K +   P  + Y 
Sbjct: 102 VTQCPIVPGHSFLYDFEVPDQAGTFWYHSHLGTQYCDGLRGPLVVYSKND---PHKRLYD 158

Query: 566 ---KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
              +   +  G+W++       + +L   G P+  D+   NGL
Sbjct: 159 VDDESTVLTVGDWYH-------APSLSLTGVPH-PDSTLFNGL 193



>gb:CRILIPHA_1673420 C.hirsutus ligninolytic phenoloxidase gene,
           complete cds.
          Length = 520

 Score = 93.2 bits (230), Expect = 4e-18
 Identities = 53/160 (33%), Positives = 83/160 (51%), Gaps = 7/160 (4%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPAY 391
           +  V VN   PGP +   +GDR  + V +++ N+      SIHWHG  Q  + WADGPA+
Sbjct: 43  RQAVVVNNVTPGPLVAGNKGDRFQLNVIDNLTNHTMLKSTSIHWHGFFQKGTNWADGPAF 102

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKPY 565
           + QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++  P    +  +    
Sbjct: 103 VNQCPISSGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPHASLYDVDN 162

Query: 566 KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
            +  I   +W++  T A +  A   G     +DA  INGL
Sbjct: 163 DDTVITLADWYH--TAAKLGPAFPLG-----ADATLINGL 195



>gb:AY532144_1612041 Phanerochaete chrysosporium strain BKM-1767
           multicopper oxidase 3B-I5/10 splice variant (mco3) mRNA,
           complete cds, alternatively spliced.
          Length = 285

 Score = 93.2 bits (230), Expect = 4e-18
 Identities = 41/85 (48%), Positives = 57/85 (67%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQLRSGWADGPAYITQCP 406
           K ++ VNG YPGP I A +GDR+++KV N + N  +IHWHG+ Q  + + DG A IT+C 
Sbjct: 112 KPMLVVNGMYPGPTIEANQGDRVVVKVTNMLENRTTIHWHGLFQNGTNYYDGTAAITECG 171

Query: 407 IQTGQSYVYKYTIVGQRGTLFWHAH 481
           I  GQ+ VY +T+    GT +WHAH
Sbjct: 172 IPPGQTLVYNFTLGEFSGTTWWHAH 196



>gb:AY050406_1562183 Arabidopsis thaliana AT5g21100/T10F18_130 mRNA,
           complete cds.>gb:BT001074_1635329 Arabidopsis thaliana
           At5g21100/T10F18_130 mRNA, complete cds.
          Length = 530

 Score = 93.2 bits (230), Expect = 4e-18
 Identities = 55/141 (39%), Positives = 81/141 (57%), Gaps = 2/141 (1%)
 Frame = +2

Query: 236 VTVNGKYPGPPILAREGDRLLIKVNNHVANN-ISIHWHGIRQLRSGWADGPAYITQCPIQ 412
           +TVNG++PGP I A  GD +++ + N +    + IHWHGIRQ  S WADG A +TQC I 
Sbjct: 1   MTVNGEFPGPTIKAFAGDTIVVNLTNKLTTEGLVIHWHGIRQFGSPWADGAAGVTQCAIN 60

Query: 413 TGQSYVYKYTIVGQRGTLFWHAHISWLR-ATLHGPIIILPKKNVSYPFVKPYKEVPIIFG 589
            G+++ Y +T V + GT F+H H    R A L+G +I+   K  S   ++   E  ++  
Sbjct: 61  PGETFTYNFT-VEKPGTHFYHGHYGMQRSAGLYGSLIVDVAKGKS-ERLRYDGEFNLLLS 118

Query: 590 EWFNGDTEAIISQALQTGGGP 652
           +W++   EAI SQ L     P
Sbjct: 119 DWWH---EAIPSQELGLSSKP 136



>gb:AY017340_1558844 Coriolopsis gallica laccase (lcc1) gene,
           complete cds.>gb:AF263467_1781690 Coriolopsis gallica
           laccase (lcc1) mRNA, complete cds.
          Length = 517

 Score = 93.2 bits (230), Expect = 4e-18
 Identities = 52/160 (32%), Positives = 80/160 (50%), Gaps = 7/160 (4%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPAY 391
           +  +   G +PGP I  + GDR LI V + + N       SIHWHG+ Q  + WADGPA+
Sbjct: 45  RDTILAGGTFPGPLITGKTGDRFLIDVYDDLTNTTMLTPTSIHWHGLFQHTTNWADGPAF 104

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKPY 565
           +TQCPI +G +++Y + +  Q GT ++H+H        L GPI++  P     + +    
Sbjct: 105 VTQCPISSGHNFLYNFRVPDQSGTYWYHSHFGLQYCDGLRGPIVVYDPHDPQKHLYDVDD 164

Query: 566 KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
               I   +W++         A  +   P  SD+  INGL
Sbjct: 165 DSTVITLSDWYH--------VAAASVPVPPQSDSTLINGL 196



>gb:AB072704_1523107 Pycnoporus coccineus lcc1 gene for laccase,
           complete cds.
          Length = 518

 Score = 93.2 bits (230), Expect = 4e-18
 Identities = 43/106 (40%), Positives = 66/106 (62%), Gaps = 6/106 (5%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPA 388
           ++  V VNG+ PGP I  ++GDR  + V +++ N+      SIHWHG  Q  + WADGPA
Sbjct: 42  SREAVVVNGQTPGPLIAGQKGDRFQLNVIDNLTNHTMLKTTSIHWHGFFQHGTNWADGPA 101

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           +I QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++
Sbjct: 102 FINQCPIASGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVV 147



>gb:AB072703_1523106 Pycnoporus coccineus lcc1 mRNA for laccase,
           complete cds.
          Length = 518

 Score = 93.2 bits (230), Expect = 4e-18
 Identities = 43/106 (40%), Positives = 66/106 (62%), Gaps = 6/106 (5%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPA 388
           ++  V VNG+ PGP I  ++GDR  + V +++ N+      SIHWHG  Q  + WADGPA
Sbjct: 42  SREAVVVNGQTPGPLIAGQKGDRFQLNVIDNLTNHTMLKTTSIHWHGFFQHGTNWADGPA 101

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           +I QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++
Sbjct: 102 FINQCPIASGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVV 147



>gb:AB035409_1518943 Lentinula edodes LeLcc1 mRNA for laccase 1,
           complete cds.>gb:AB055157_1521429 Lentinula edodes lcc1
           gene for laccase, complete cds.
          Length = 518

 Score = 93.2 bits (230), Expect = 4e-18
 Identities = 55/163 (33%), Positives = 82/163 (50%), Gaps = 10/163 (6%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWHGIRQLRSGWADGPAY 391
           +S V   G +PGP I   +GD   I V + + N     + SIHWHG+ Q  + WADGPA+
Sbjct: 40  RSGVLAEGVFPGPLITGNKGDNFQINVIDELTNGTMLLSTSIHWHGLFQKTTNWADGPAF 99

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPY- 565
           + QCPI    S++Y + +  Q GT ++H+H+S      L GP+++   ++   P+   Y 
Sbjct: 100 VNQCPIAANDSFLYNFNVPDQAGTFWYHSHLSTQYCDGLRGPLVVYDPQD---PYADLYD 156

Query: 566 ---KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
                  I   +W++         A Q G  P  SDA  INGL
Sbjct: 157 VDDDSTVITLADWYH-------VPAPQAGAVP-TSDATLINGL 191



>pir|B35883|B35883 ligninolytic phenoloxidase (EC 1.10.-.-) 2
           precursor - white-rot fungus (Trametes versicolor)
          Length = 520

 Score = 93.2 bits (230), Expect = 4e-18
 Identities = 53/160 (33%), Positives = 83/160 (51%), Gaps = 7/160 (4%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPAY 391
           +  V VN   PGP +   +GDR  + V +++ N+      SIHWHG  Q  + WADGPA+
Sbjct: 43  RQAVVVNNVTPGPLVAGNKGDRFQLNVIDNLTNHTMLKSTSIHWHGFFQKGTNWADGPAF 102

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKPY 565
           + QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++  P    +  +    
Sbjct: 103 VNQCPISSGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPHASLYDVDN 162

Query: 566 KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
            +  I   +W++  T A +  A   G     +DA  INGL
Sbjct: 163 DDTVITLADWYH--TAAKLGPAFPLG-----ADATLINGL 195



>sp|Q02497|LAC1_TRAHI Laccase precursor (EC 1.10.3.2)
           (Benzenediol:oxygen oxidoreductase) (Urishiol oxidase)
           (Ligninolytic phenoloxidase).>pir|A35883|A35883 laccase
           (EC 1.10.3.2) A - white-rot fungus (Trametes
           versicolor)>gb:CRILIGPHE_1673419 C.hirsutus ligninolytic
           phenoloxidase gene, complete cds.
          Length = 520

 Score = 93.2 bits (230), Expect = 4e-18
 Identities = 53/160 (33%), Positives = 83/160 (51%), Gaps = 7/160 (4%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPAY 391
           +  V VN   PGP +   +GDR  + V +++ N+      SIHWHG  Q  + WADGPA+
Sbjct: 43  RQAVVVNNVTPGPLVAGNKGDRFQLNVIDNLTNHTMLKSTSIHWHGFFQKGTNWADGPAF 102

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKPY 565
           + QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++  P    +  +    
Sbjct: 103 VNQCPISSGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPHASLYDVDN 162

Query: 566 KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
            +  I   +W++  T A +  A   G     +DA  INGL
Sbjct: 163 DDTVITLADWYH--TAAKLGPAFPLG-----ADATLINGL 195



>gb:AF176231_1774554 Polyporus ciliatus laccase (lcc3-2) mRNA,
           complete cds.
          Length = 524

 Score = 92.8 bits (229), Expect = 5e-18
 Identities = 54/178 (30%), Positives = 89/178 (50%), Gaps = 10/178 (5%)
 Frame = +2

Query: 182 EFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWH 346
           +  +T  ++     T++ V  N  +PGP I   +GD   + V ++++N+      +IHWH
Sbjct: 30  DLTITNADINPDGFTRAAVLANNVFPGPLITGNKGDNFQLNVVDNLSNDTMLTATTIHWH 89

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           G  Q  + WADGPA++ QCPI TG S++Y +    Q GT ++H+H+S      L GP+++
Sbjct: 90  GFFQKGTNWADGPAFVNQCPISTGNSFLYNFNAPDQAGTFWYHSHLSTQYCDGLRGPMVV 149

Query: 524 LPKKNVSYPFVKPY----KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
               +   P    Y    +   I   +W++  T A +      G     SD+  INGL
Sbjct: 150 YDDAD---PHASLYDVDDESTVITLADWYH--TAARLGPCFPLG-----SDSTLINGL 197



>gb:AY081188_1568591 Trametes versicolor laccase III gene, complete
           cds.
          Length = 520

 Score = 92.8 bits (229), Expect = 5e-18
 Identities = 54/160 (33%), Positives = 82/160 (51%), Gaps = 7/160 (4%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPA 388
           ++  V VNG  PGP I    GDR  + V +++ N+      SIHWHG  Q  + WADGPA
Sbjct: 42  SRQAVVVNGGTPGPLITGNMGDRFQLNVIDNLTNHTMLKSTSIHWHGFFQKGTNWADGPA 101

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKP 562
           +I QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++  P    +  +   
Sbjct: 102 FINQCPISSGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPAADLYDVD 161

Query: 563 YKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
             +  I   +W++    A +  A   G     +DA  ING
Sbjct: 162 NDDTVITLADWYH--VAAKLGPAFPLG-----ADATLING 194



>gb:AX741023_1473884 Sequence 1 from Patent EP1300469.
          Length = 520

 Score = 92.8 bits (229), Expect = 5e-18
 Identities = 54/160 (33%), Positives = 83/160 (51%), Gaps = 7/160 (4%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPA 388
           ++  V VNG  PGP I    GDR  + V +++ N+      SIHWHG  Q  + WADGPA
Sbjct: 42  SRQAVVVNGGTPGPLITGNMGDRFQLNVIDNLTNHTMLKSTSIHWHGFFQKGTNWADGPA 101

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKP 562
           +I QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++  P +  +  +   
Sbjct: 102 FINQCPISSGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVVYEPNEPAADLYDVD 161

Query: 563 YKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
             +  I   +W++    A +  A   G     +DA  ING
Sbjct: 162 NDDTVITLVDWYH--VAANVGPAFPLG-----ADATLING 194



>pir|T05545|T05545 pollen-specific protein homolog F24A6.80 -
           Arabidopsis thaliana>gb:ATCHRIV63_1546406 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           63.>gb:ATF24A6_1549804 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F24A6 (ESSAII project).
          Length = 561

 Score = 92.8 bits (229), Expect = 5e-18
 Identities = 51/169 (30%), Positives = 91/169 (53%), Gaps = 1/169 (0%)
 Frame = +2

Query: 179 YEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQ 358
           Y+F V+    + L   + ++ VNG++PGP + A     +++ V NH+   + + W GI+ 
Sbjct: 31  YDFRVSYLTASPLGVPQQVIAVNGQFPGPLLNATTNYNVVVNVFNHLDEPLLLTWPGIQM 90

Query: 359 LRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKK 535
            R+ W DG    T CPI    ++ Y++ +  Q G+ F+   +++ RA+   GPI+I  + 
Sbjct: 91  RRNSWQDG-VLGTNCPIPPRWNFTYQFQVKDQIGSFFYSPSLNFQRASGGFGPIVINNRD 149

Query: 536 NVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
            +  PF +P  E+  I G+W+  D +A + +AL +G    + D   ING
Sbjct: 150 IIPIPFPQPDGELIFIIGDWYTQDHKA-LRRALDSGKELGMPDGVLING 197



>sp|Q8VXX5|SKS1_ARATH Monocopper oxidase-like protein SKS1
           precursor.>gb:AY074379_1567533 Arabidopsis thaliana
           putative Pollen-specific protein precursor (At4g25240)
           mRNA, complete cds.>gb:AY091230_1574438 Arabidopsis
           thaliana putative pollen-specific protein precursor
           (At4g25240) mRNA, complete cds.
          Length = 589

 Score = 92.8 bits (229), Expect = 5e-18
 Identities = 51/169 (30%), Positives = 91/169 (53%), Gaps = 1/169 (0%)
 Frame = +2

Query: 179 YEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQ 358
           Y+F V+    + L   + ++ VNG++PGP + A     +++ V NH+   + + W GI+ 
Sbjct: 31  YDFRVSYLTASPLGVPQQVIAVNGQFPGPLLNATTNYNVVVNVFNHLDEPLLLTWPGIQM 90

Query: 359 LRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKK 535
            R+ W DG    T CPI    ++ Y++ +  Q G+ F+   +++ RA+   GPI+I  + 
Sbjct: 91  RRNSWQDG-VLGTNCPIPPRWNFTYQFQVKDQIGSFFYSPSLNFQRASGGFGPIVINNRD 149

Query: 536 NVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
            +  PF +P  E+  I G+W+  D +A + +AL +G    + D   ING
Sbjct: 150 IIPIPFPQPDGELIFIIGDWYTQDHKA-LRRALDSGKELGMPDGVLING 197



>sp|Q40588|ASO_TOBAC L-ascorbate oxidase precursor (EC 1.10.3.3)
           (Ascorbase) (ASO).>pir|S66353|S66353 L-ascorbate oxidase
           (EC 1.10.3.3) precursor - common
           tobacco>gb:TOBTAOP_1725550 Tobacco mRNA for ascorbate
           oxidase precursor, complete cds.
          Length = 578

 Score = 92.8 bits (229), Expect = 5e-18
 Identities = 48/146 (32%), Positives = 85/146 (58%), Gaps = 2/146 (1%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHV-ANNISIHWH 346
           TRH++++V   + +       ++ +NG++PGP I A+ GD + + + N +    + IHWH
Sbjct: 30  TRHFKWDVEYIHWSPDGEESVVMGINGQFPGPTIRAKAGDTVAVHLTNKLHTEGVVIHWH 89

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLR-ATLHGPIII 523
           GIRQ+ + WADG A I+QC I  G++++Y++  V + GT F+H H    R A L+G +I+
Sbjct: 90  GIRQIGTPWADGTAAISQCAINPGETFLYRFK-VDKAGTYFYHGHYGMQRSAGLYGSLIV 148

Query: 524 LPKKNVSYPFVKPYKEVPIIFGEWFN 601
              +    PF     E  ++  +W++
Sbjct: 149 EVGEGEKEPFHYD-GEFNLLLSDWWH 173



>gb:AF162785_1773540 Basidiomycete C30 polyphenoloxidase (LAC1)
           gene, complete cds.>gb:AF491759_1804874 Basidiomycete
           C30 laccase 1 (lac1) mRNA, complete cds.
          Length = 517

 Score = 92.4 bits (228), Expect = 7e-18
 Identities = 50/161 (31%), Positives = 83/161 (51%), Gaps = 7/161 (4%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPA 388
           ++  + VN  +P P I   +GDR  + V +++ N+      SIHWHG  Q  + WADGPA
Sbjct: 42  SRQAILVNDVFPSPLITGNKGDRFQLNVIDNMTNHTMLKSTSIHWHGFFQHGTNWADGPA 101

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPY 565
           ++ QCPI TG +++Y + +  Q GT ++H+H+S      L GPI++   ++         
Sbjct: 102 FVNQCPISTGHAFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPIVVYDPQDPHKSLYDVD 161

Query: 566 KEVPII-FGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
            +  +I   +W++         A + G     +DA  INGL
Sbjct: 162 DDSTVITLADWYH--------LAAKVGPAVPTADATLINGL 194



>gb:TTR294820_1726067 Trametes trogii lcc1 gene for laccase, exons
           1-11.
          Length = 517

 Score = 92.4 bits (228), Expect = 7e-18
 Identities = 50/161 (31%), Positives = 83/161 (51%), Gaps = 7/161 (4%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPA 388
           ++  + VN  +P P I   +GDR  + V +++ N+      SIHWHG  Q  + WADGPA
Sbjct: 42  SRQAILVNDVFPSPLITGNKGDRFQLNVIDNMTNHTMLKSTSIHWHGFFQHGTNWADGPA 101

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPY 565
           ++ QCPI TG +++Y + +  Q GT ++H+H+S      L GPI++   ++         
Sbjct: 102 FVNQCPISTGHAFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPIVVYDPQDPHKSLYDVD 161

Query: 566 KEVPII-FGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
            +  +I   +W++         A + G     +DA  INGL
Sbjct: 162 DDSTVITLADWYH--------LAAKVGSPVPTADATLINGL 194



>gb:BLACCASEG_1633076 Basidiomycete gene for laccase.
          Length = 517

 Score = 92.4 bits (228), Expect = 7e-18
 Identities = 50/161 (31%), Positives = 83/161 (51%), Gaps = 7/161 (4%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPA 388
           ++  + VN  +P P I   +GDR  + V +++ N+      SIHWHG  Q  + WADGPA
Sbjct: 42  SRQAILVNDVFPSPLITGNKGDRFQLNVIDNMTNHTMLKSTSIHWHGFFQHGTNWADGPA 101

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPY 565
           ++ QCPI TG +++Y + +  Q GT ++H+H+S      L GPI++   ++         
Sbjct: 102 FVNQCPISTGHAFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPIVVYDPQDPHKSLYDVD 161

Query: 566 KEVPII-FGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
            +  +I   +W++         A + G     +DA  INGL
Sbjct: 162 DDSTVITLADWYH--------LAAKVGPAVPTADATLINGL 194



>gb:AY839936_1630504 Trametes sp. AH28-2 laccase A (lacA) gene,
           complete cds.
          Length = 520

 Score = 92.4 bits (228), Expect = 7e-18
 Identities = 52/160 (32%), Positives = 82/160 (51%), Gaps = 7/160 (4%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPAY 391
           +  V VN   PGP +   +GDR  + V +++ N+      SIHWHG  Q  + WADGPA+
Sbjct: 43  RQAVVVNNVTPGPLVAGNKGDRFQLNVIDNLTNHTMLKSTSIHWHGFFQKGTNWADGPAF 102

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKPY 565
           + QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++  P    +  +    
Sbjct: 103 VNQCPISSGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDTHASLYDVDN 162

Query: 566 KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
            +  I   +W++  T A +      G     +DA  INGL
Sbjct: 163 DDTVITLADWYH--TAAKLGPTFPLG-----ADATLINGL 195



>gb:AY081775_1569011 Coriolus hirsutus laccase (072-1) mRNA,
           complete cds.
          Length = 515

 Score = 92.4 bits (228), Expect = 7e-18
 Identities = 53/160 (33%), Positives = 81/160 (50%), Gaps = 7/160 (4%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPA 388
           ++  V VNG  PGP +    GDR  + V +++ N+      SIHWHG  Q  + WADGPA
Sbjct: 42  SRQAVVVNGVTPGPLVAGNIGDRFQLNVIDNLTNHTMLKSTSIHWHGFFQHGTNWADGPA 101

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKP 562
           +I QCPI  G S++Y + +  Q GT ++H+H+S      L GP ++  P    +  +   
Sbjct: 102 FINQCPISPGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPHASRYDVD 161

Query: 563 YKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
             +  I   +W++  T A +         P  +DA  ING
Sbjct: 162 NDDTVITLADWYH--TAAKLGPRF-----PGAADAVNING 194



>gb:D13372_1674465 Coriolus versicolor CVL3 gene for laccase,
           complete cds.
          Length = 520

 Score = 92.0 bits (227), Expect = 9e-18
 Identities = 54/160 (33%), Positives = 82/160 (51%), Gaps = 7/160 (4%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPA 388
           ++  V VNG  PGP I    GDR  + V +++ N+      SIHWHG  Q  + WADGPA
Sbjct: 42  SRQAVVVNGGTPGPLITGNMGDRFQLNVIDNLTNHTMLKSTSIHWHGFFQKGTNWADGPA 101

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKP 562
           +I QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++  P    +  +   
Sbjct: 102 FINQCPISSGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPAADLYDVD 161

Query: 563 YKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
             +  I   +W++    A +  A   G     +DA  ING
Sbjct: 162 NDDTVITLVDWYH--VAANVGPAFPLG-----ADATLING 194



>gb:AY645912S3_1619825 Acer pseudoplatanus laccase-like multicopper
           oxidase 2 gene, exon 5 and partial cds.
          Length = 281

 Score = 92.0 bits (227), Expect = 9e-18
 Identities = 40/71 (56%), Positives = 53/71 (74%)
 Frame = +2

Query: 479 HISWLRATLHGPIIILPKKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNV 658
           H SWLRAT++G +II PK+  SYPF KP +E+P++ GEW++ +   ++ QA  TG  PNV
Sbjct: 1   HSSWLRATVYGALIIYPKEGSSYPFPKPNREIPVLPGEWWDANPIDVVRQATITGAAPNV 60

Query: 659 SDAYTINGLPG 691
           SDAYTING PG
Sbjct: 61  SDAYTINGQPG 71



>sp|Q9SU40|SKU5_ARATH Putative monocopper oxidase precursor (Skewed
           roots).>pir|T07634|T07634 pollen-specific protein
           homolog T1P17.10 - Arabidopsis
           thaliana>gb:ATCHRIV34_1545007 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 34.>gb:ATT1P17_1554905
           Arabidopsis thaliana DNA chromosome 4, BAC clone T1P17
           (ESSA project).>gb:AF439406_1799975 Arabidopsis thaliana
           multi-copper oxidase-related protein (SKU5) mRNA,
           complete cds.
          Length = 587

 Score = 92.0 bits (227), Expect = 9e-18
 Identities = 48/169 (28%), Positives = 86/169 (50%), Gaps = 1/169 (0%)
 Frame = +2

Query: 179 YEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQ 358
           Y F V+    + L   + ++ +NGK+PGP I     + L++ V N +   + +HW+GI+Q
Sbjct: 27  YNFEVSYITASPLGVPQQVIAINGKFPGPTINVTTNENLVVNVRNKLDEGLLLHWNGIQQ 86

Query: 359 LRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKK 535
            R  W DG    T CPI    ++ Y++ +  Q G+ F+   + + RA+   G  ++ P+ 
Sbjct: 87  RRVSWQDG-VLGTNCPIPPKWNWTYEFQVKDQIGSFFYFPSLHFQRASGGFGSFVVNPRA 145

Query: 536 NVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
            +  PF  P  ++ +  G+W+  +  A + +AL  G    + D   ING
Sbjct: 146 IIPVPFSTPDGDITVTIGDWYIRNHTA-LRKALDDGKDLGMPDGVLING 193



>sp|Q99046|LAC2_TRAVI Laccase 2 precursor (EC 1.10.3.2)
           (Benzenediol:oxygen oxidoreductase) (Urishiol oxidase)
           (Diphenol oxidase).>gb:TMTLCCB_1725315 Trametes villosa
           (clone LCC2) laccase gene, exons 1-11, complete cds.
          Length = 519

 Score = 92.0 bits (227), Expect = 9e-18
 Identities = 52/160 (32%), Positives = 83/160 (51%), Gaps = 7/160 (4%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKV-----NNHVANNISIHWHGIRQLRSGWADGPAY 391
           +  + VNG  P P I  ++GDR  + V     N+ +  + SIHWHG  Q  + WA+GPA+
Sbjct: 42  RDAIVVNGVVPSPLITGKKGDRFQLNVVDTLTNHSMLKSTSIHWHGFFQAGTNWAEGPAF 101

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKPY 565
           + QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++  PK   +  +    
Sbjct: 102 VNQCPIASGHSFLYDFHVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPKDPHASRYDVDN 161

Query: 566 KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
           +   I   +W++  T A +      G     +DA  INGL
Sbjct: 162 ESTVITLTDWYH--TAARLGPKFPLG-----ADATLINGL 194



>gb:AF414109_1797600 Trametes versicolor laccase B precursor (lac1)
           mRNA, complete cds.
          Length = 520

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 54/160 (33%), Positives = 82/160 (51%), Gaps = 7/160 (4%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPA 388
           ++  V VNG  PGP I    GDR  + V +++ N+      SIHWHG  Q  + WADGPA
Sbjct: 42  SRQAVVVNGGTPGPLITGNMGDRFQLNVIDNLTNHTMLKSTSIHWHGFFQKGTNWADGPA 101

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKP 562
           +I QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++  P    +  +   
Sbjct: 102 FINQCPISSGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPAADLYDVD 161

Query: 563 YKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
             +  I   +W++    A +  A   G     +DA  ING
Sbjct: 162 NDDTVITLVDWYH--VAAKLGPAFPLG-----ADATLING 194



>pir|JC5355|JC5355 laccase (EC 1.10.3.2) 3 precursor - white-rot
           fungus  (Trametes villosa)
          Length = 512

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 44/132 (33%), Positives = 73/132 (55%), Gaps = 7/132 (5%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWHGIRQLRSGWADGPAY 391
           +  V   G +PGP I  ++GD   I V + + N     + +IHWHG+ Q  + WADGPA+
Sbjct: 43  RDTVLAGGTFPGPLITGKKGDNFRINVVDKLVNQTMLTSTTIHWHGMFQHTTNWADGPAF 102

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKPY 565
           +TQCPI TG  ++Y + +  Q GT ++H+H++      L GP++I  P    +Y +    
Sbjct: 103 VTQCPITTGDDFLYNFRVPDQTGTYWYHSHLALQYCDGLRGPLVIYDPHDPQAYLYDVDD 162

Query: 566 KEVPIIFGEWFN 601
           +   I   +W++
Sbjct: 163 ESTVITLADWYH 174



>sp|Q99049|LAC3_TRAVI Laccase 3 precursor (EC 1.10.3.2)
           (Benzenediol:oxygen oxidoreductase) (Urishiol oxidase)
           (Diphenol oxidase).>gb:TMTLCCC_1725316 Trametes villosa
           laccase (lcc3) gene, complete cds.
          Length = 473

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 44/132 (33%), Positives = 73/132 (55%), Gaps = 7/132 (5%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWHGIRQLRSGWADGPAY 391
           +  V   G +PGP I  ++GD   I V + + N     + +IHWHG+ Q  + WADGPA+
Sbjct: 43  RDTVLAGGTFPGPLITGKKGDNFRINVVDKLVNQTMLTSTTIHWHGMFQHTTNWADGPAF 102

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKPY 565
           +TQCPI TG  ++Y + +  Q GT ++H+H++      L GP++I  P    +Y +    
Sbjct: 103 VTQCPITTGDDFLYNFRVPDQTGTYWYHSHLALQYCDGLRGPLVIYDPHDPQAYLYDVDD 162

Query: 566 KEVPIIFGEWFN 601
           +   I   +W++
Sbjct: 163 ESTVITLADWYH 174



>sp|Q99044|LAC1_TRAVI Laccase 1 precursor (EC 1.10.3.2)
           (Benzenediol:oxygen oxidoreductase) (Urishiol oxidase)
           (Diphenol oxidase).>gb:TMTLCCA_1725314 Trametes villosa
           (clone LCC1) laccase gene, exons 1-9, complete cds.
          Length = 520

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 54/160 (33%), Positives = 82/160 (51%), Gaps = 7/160 (4%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPA 388
           ++  V VNG  PGP I    GDR  + V +++ N+      SIHWHG  Q  + WADGPA
Sbjct: 42  SRQAVVVNGGTPGPLITGNMGDRFQLNVIDNLTNHTMVKSTSIHWHGFFQKGTNWADGPA 101

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKP 562
           +I QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++  P    +  +   
Sbjct: 102 FINQCPISSGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPAADLYDVD 161

Query: 563 YKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
             +  I   +W++    A +  A   G     +DA  ING
Sbjct: 162 NDDTVITLVDWYH--VAAKLGPAFPLG-----ADATLING 194



>gb:AF414807_1797635 Trametes pubescens laccase 2 (lap2) gene,
           complete cds.
          Length = 520

 Score = 91.3 bits (225), Expect = 1e-17
 Identities = 53/160 (33%), Positives = 82/160 (51%), Gaps = 7/160 (4%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPA 388
           ++  V VNG  PGP I   +GD   + V +++ N+      SIHWHG  Q  + WADGPA
Sbjct: 42  SRQAVVVNGGTPGPLITGNKGDNFQLNVIDNLTNHTMLKSTSIHWHGFFQKGTNWADGPA 101

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPY 565
           +I QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++    + S       
Sbjct: 102 FINQCPISSGNSFLYNFQVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPSADLYDVD 161

Query: 566 KEVPII-FGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
            +  +I   +W++    A +  A   G     +DA  ING
Sbjct: 162 NDDTVITLVDWYH--VAAKLGPAFPLG-----ADATLING 194



>gb:AY532143_1612040 Phanerochaete chrysosporium strain BKM-1767
           multicopper oxidase 3B-I4/11 splice variant (mco3) mRNA,
           complete cds, alternatively spliced.
          Length = 214

 Score = 91.3 bits (225), Expect = 1e-17
 Identities = 41/87 (47%), Positives = 57/87 (65%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQLRSGWADGPAYITQCP 406
           K ++ VNG YPGP I A +GDR+++KV N + N  +IHWHG+ Q  + + DG A IT+C 
Sbjct: 112 KPMLVVNGMYPGPTIEANQGDRVVVKVTNMLENRTTIHWHGLFQNGTNYYDGTAAITECG 171

Query: 407 IQTGQSYVYKYTIVGQRGTLFWHAHIS 487
           I  GQ+ VY +T+    GT +WHA  S
Sbjct: 172 IPPGQTLVYNFTLGEFSGTTWWHARTS 198



>gb:TVE18012_1726126 Trametes versicolor mRNA for laccase.
          Length = 520

 Score = 90.9 bits (224), Expect = 2e-17
 Identities = 53/160 (33%), Positives = 82/160 (51%), Gaps = 7/160 (4%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPA 388
           ++  V VNG  PGP I    GDR  + V +++ ++      SIHWHG  Q  + WADGPA
Sbjct: 42  SRQAVVVNGGTPGPLITGNMGDRFQLNVIDNLTDHTMLKSTSIHWHGFFQKGTNWADGPA 101

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKP 562
           +I QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++  P    +  +   
Sbjct: 102 FINQCPISSGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPAADLYDVD 161

Query: 563 YKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
             +  I   +W++    A +  A   G     +DA  ING
Sbjct: 162 NDDTVITLADWYH--VAAKLGPAFPLG-----ADATLING 194



>gb:AY338761_1600497 Coprinopsis cinerea strain AmutBmut laccase 5
           (lcc5) gene, complete cds.
          Length = 533

 Score = 90.9 bits (224), Expect = 2e-17
 Identities = 54/161 (33%), Positives = 84/161 (52%), Gaps = 8/161 (4%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPA 388
           T+ ++ VNG++P P + A +GD   I V N++ ++      S+HWHG+ Q +S WADGP 
Sbjct: 45  TRPVIAVNGEFPSPLVRANKGDDFRINVVNNLDDDTMLRQTSVHWHGVFQHQSAWADGPD 104

Query: 389 YITQCPI-QTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKP 562
            +TQCPI Q+GQ + Y +    + GT ++H+H        L GP++I   ++        
Sbjct: 105 GVTQCPIPQSGQEFEYAFNAGQEAGTFWYHSHYGTQYCDGLRGPLVIYDPEDPHQDLYDV 164

Query: 563 YKEVPII-FGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
             E  II   +W++    +I         GP VS A  ING
Sbjct: 165 DDENTIITLADWYHLQAPSI--------QGPAVSQATLING 197



>gb:PSA507326_1702004 Pleurotus sajor-caju mRNA for laccase 3 (lac3
           gene).
          Length = 521

 Score = 90.5 bits (223), Expect = 3e-17
 Identities = 50/179 (27%), Positives = 92/179 (51%), Gaps = 7/179 (3%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-----NIS 334
           T+  +F++    V+     +  +TVNG +PG P++ ++ D++ IK  N + +     + S
Sbjct: 21  TKKLDFHIRNDVVSPDGFERRAITVNGIFPGTPVILQKNDKVQIKTINELTDPGMRRSTS 80

Query: 335 IHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHG 511
           IHWHG+ Q ++   DGP+++ QCPI    +++Y +   GQ G  ++H+H+S      L G
Sbjct: 81  IHWHGLFQHKTSGMDGPSFVNQCPIPPNTTFLYDFDTAGQTGNYWYHSHLSTQYCDGLRG 140

Query: 512 PIIIL-PKKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
             I+  P   + + +    +   I   +W++       +Q  QTG  P + D   ING+
Sbjct: 141 SFIVYDPNDPLKHLYDVDDESTIITLADWYHDLAPHAQNQFFQTGSVP-IPDTGLINGV 198



>gb:AY817107_1628700 Cryptococcus neoformans var. grubii LAC2
           isoform 2 mRNA, complete cds, alternatively spliced.
          Length = 507

 Score = 90.5 bits (223), Expect = 3e-17
 Identities = 53/149 (35%), Positives = 78/149 (52%), Gaps = 7/149 (4%)
 Frame = +2

Query: 257 PGPPILAREGDRLLIKVNNHVANNISIHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYK 436
           PGP I A  GD +++ VNN++     IHWHG+RQ  +   DG   ITQC I  G S+ Y+
Sbjct: 3   PGPVIEANTGDTVIVHVNNYLHEGQGIHWHGLRQNGTALMDGVPGITQCSIPPGGSFTYQ 62

Query: 437 YTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPYKEVPII-FGEWFNGDT 610
           +T+  Q GT +WH+H S   A  + GP+I+    N      + Y E  I+   +W + ++
Sbjct: 63  FTVSHQSGTFWWHSHYSNSMADGIWGPLIV-HSPNEPLQRGRDYDEDRIVAVTDWMHDES 121

Query: 611 EAIISQALQTGG-----GPNVSDAYTING 682
           E I+   + + G      P   DA  ING
Sbjct: 122 ETIVEALISSEGYRGRPFPPQGDAILING 150



>gb:AY225437_1590895 Phanerochaete chrysosporium extracellular
           multicopper oxidase (mco1) mRNA, mco1-B allele, complete
           cds.
          Length = 559

 Score = 90.5 bits (223), Expect = 3e-17
 Identities = 45/103 (43%), Positives = 60/103 (58%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGI 352
           RHYEF V          TK ++ VNG +PGP I   + DRL+++V N + N  +IHWHGI
Sbjct: 47  RHYEFVVEEMLGAPDGVTKPMLVVNGLFPGPTIEVNQYDRLVVRVINRIQNATTIHWHGI 106

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAH 481
            Q  + + DG A IT+C I  GQS  Y +T     GT +WH+H
Sbjct: 107 PQNGTAYYDGTAGITECGIPPGQSLTYDFTFGDFSGTTWWHSH 149



>gb:AF491760_1804875 Basidiomycete C30 laccase 2 (lac2) gene,
           complete cds.>gb:AF491761_1804876 Basidiomycete C30
           laccase 2 (lac2) mRNA, complete cds.
          Length = 528

 Score = 90.1 bits (222), Expect = 3e-17
 Identities = 38/107 (35%), Positives = 65/107 (60%), Gaps = 5/107 (4%)
 Frame = +2

Query: 182 EFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWH 346
           +  ++  N++    T++ V  N ++PGP I   +GD   I V ++++N+      +IHWH
Sbjct: 30  DLTISNANISPDGFTRAAVVANNQFPGPLITGNKGDNFQINVIDNLSNDTMLTSTTIHWH 89

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHIS 487
           G  Q  + WADGPA++ QCPI  G S++Y ++   Q GT ++H+H+S
Sbjct: 90  GFFQKGTNWADGPAFVNQCPISEGNSFLYDFSAADQAGTFWYHSHLS 136



>gb:AY839942_1630510 Trametes sp. 420 laccase D (lacD) gene,
           complete cds.
          Length = 563

 Score = 90.1 bits (222), Expect = 3e-17
 Identities = 42/106 (39%), Positives = 64/106 (60%), Gaps = 6/106 (5%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPA 388
           T++ V +NG+ PGP I   +GD   I V + + N+      +IHWHG  Q  + WADG A
Sbjct: 44  TRAAVVMNGQTPGPLITGNKGDDFQINVIDSLDNDTMLTPTTIHWHGFFQKGTNWADGAA 103

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           ++ QCPI TG S++Y +T   Q GT ++H+H+S      L GP+++
Sbjct: 104 FVNQCPISTGNSFLYDFTATDQAGTFWYHSHLSTQYCDGLRGPLVV 149



>gb:AY397783_1605112 Trametes sp. C30 laccase (lac3) mRNA, complete
           cds.
          Length = 524

 Score = 90.1 bits (222), Expect = 3e-17
 Identities = 52/164 (31%), Positives = 84/164 (51%), Gaps = 10/164 (6%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPA 388
           T++ V +N ++PGP I   +GD   I V ++++N+      +IHWHG  Q  + WADG A
Sbjct: 44  TRAAVVMNDQFPGPLIAGNKGDNFQINVIDNLSNSTMLTSTTIHWHGFFQKGTNWADGAA 103

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPY 565
           ++ QCPI  G S++Y +T   Q GT ++H+H+S      L GP+++    +   P    Y
Sbjct: 104 FVNQCPISAGNSFLYDFTATDQAGTFWYHSHLSTQYCDGLRGPMVVYDPDD---PHASLY 160

Query: 566 ----KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
                   I   +W++  T A +      G     +D+  INGL
Sbjct: 161 DVDDDSTVITLSDWYH--TAARLGARFPAG-----ADSTLINGL 197



>gb:AY219235_1590357 Ceriporiopsis subvermispora laccase 1 (lcs-1)
           gene, lcs-1-b allele, complete cds.>gb:AY219236_1590358
           Ceriporiopsis subvermispora Lcs-1 (lcs-1) mRNA, lcs-1b
           allele, complete cds.>gb:AF053472_1764453 Ceriporiopsis
           subvermispora laccase precursor (lcs1) gene, complete
           cds.
          Length = 519

 Score = 90.1 bits (222), Expect = 3e-17
 Identities = 40/105 (38%), Positives = 64/105 (60%), Gaps = 6/105 (5%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPAY 391
           +  V   G +PGP I   +GD   I V N++ N+      SIHWHG+ Q  + WADGPA+
Sbjct: 45  REAVLAGGTFPGPLIQGNKGDNFQINVVNNLTNHTMLKTTSIHWHGLFQHGTTWADGPAF 104

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           ++QCPI +G S++Y + +  Q GT ++H+H++      L GP+++
Sbjct: 105 VSQCPIASGNSFLYNFNVPDQAGTFWYHSHLATQYCDGLRGPLVV 149



>gb:AY839935_1630503 Panus rudis laccase A (lacA) gene, complete
           cds.
          Length = 519

 Score = 89.7 bits (221), Expect = 4e-17
 Identities = 39/107 (36%), Positives = 60/107 (56%), Gaps = 5/107 (4%)
 Frame = +2

Query: 182 EFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKV-----NNHVANNISIHWH 346
           + ++   N+     T++ V   G +PGP I   +GD   I V        +  + SIHWH
Sbjct: 28  DLHIVNDNIAPDGFTRAAVLAGGTFPGPLITGNKGDNFRINVIDDLTEESMLKSTSIHWH 87

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHIS 487
           G  Q  + WADGPA++ QCPI TG S++Y + +  Q GT ++H+H+S
Sbjct: 88  GFFQKGTNWADGPAFVNQCPITTGHSFLYNFNVPDQAGTFWYHSHLS 134



>pir|S18746|S18746 laccase (EC 1.10.3.2) - basidiomycete (Phlebia
           radiata)>gb:A20705_1447893 P.radiata cDNA for laccase.
          Length = 548

 Score = 89.7 bits (221), Expect = 4e-17
 Identities = 53/178 (29%), Positives = 85/178 (47%), Gaps = 10/178 (5%)
 Frame = +2

Query: 182 EFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWH 346
           +F++    V+    ++  V   G +PGP I   +GD   I V + + N       +IHWH
Sbjct: 28  DFHIVNAAVSPDGFSRQAVLAEGVFPGPLIAGNKGDNFQINVIDELTNATMLKTTTIHWH 87

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           G  Q  + WADGPA+I QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++
Sbjct: 88  GFFQHGTNWADGPAFINQCPIASGDSFLYNFQVPDQAGTFWYHSHLSTQYCDGLRGPFVV 147

Query: 524 LPKKNVSYPFVKPY----KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
               +   P++  Y        I   +W++         A + G     +D   INGL
Sbjct: 148 YDPAD---PYLDQYDVDDDSTVITLADWYH--------TAARLGSPFPAADTTLINGL 194



>sp|Q01679|LAC1_PHLRA Laccase precursor (EC 1.10.3.2)
           (Benzenediol:oxygen oxidoreductase) (Urishiol oxidase)
           (Ligninolytic phenoloxidase).>gb:PRLAC_1701814 Phlebia
           radiata lac gene for laccase.
          Length = 520

 Score = 89.7 bits (221), Expect = 4e-17
 Identities = 53/178 (29%), Positives = 85/178 (47%), Gaps = 10/178 (5%)
 Frame = +2

Query: 182 EFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWH 346
           +F++    V+    ++  V   G +PGP I   +GD   I V + + N       +IHWH
Sbjct: 28  DFHIVNAAVSPDGFSRQAVLAEGVFPGPLIAGNKGDNFQINVIDELTNATMLKTTTIHWH 87

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           G  Q  + WADGPA+I QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++
Sbjct: 88  GFFQHGTNWADGPAFINQCPIASGDSFLYNFQVPDQAGTFWYHSHLSTQYCDGLRGPFVV 147

Query: 524 LPKKNVSYPFVKPY----KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
               +   P++  Y        I   +W++         A + G     +D   INGL
Sbjct: 148 YDPAD---PYLDQYDVDDDSTVITLADWYH--------TAARLGSPFPAADTTLINGL 194



>gb:AY532151_1612048 Phanerochaete chrysosporium strain BKM-1767
           multicopper oxidase 4B-I5 splice variant (mco4) mRNA,
           complete cds, alternatively spliced.
          Length = 188

 Score = 89.4 bits (220), Expect = 6e-17
 Identities = 40/101 (39%), Positives = 62/101 (61%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TRH+ F V+  N +    +K ++ VNG +PGP I A +GDR+++ V N ++   +IHWHG
Sbjct: 87  TRHFNFVVSQMNGSPDGFSKPMLVVNGLFPGPTIEANQGDRIVVHVTNTLSTRTTIHWHG 146

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFW 472
           + Q  + + DG A +T+C I  GQS  Y +T+    GT +W
Sbjct: 147 LYQNGTNYYDGTAGVTECGIPPGQSLTYNFTVDDFSGTTWW 187



>gb:AY439331_1606314 Panus rudis laccase mRNA, partial cds.
          Length = 493

 Score = 89.4 bits (220), Expect = 6e-17
 Identities = 39/107 (36%), Positives = 60/107 (56%), Gaps = 5/107 (4%)
 Frame = +2

Query: 182 EFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKV-----NNHVANNISIHWH 346
           + ++   N+     T++ V   G +PGP I   +GD   I V        +  + SIHWH
Sbjct: 7   DLHIVNDNIAPDGFTRAAVLAGGTFPGPLITGNKGDNFRIDVIDDLTEESMLKSTSIHWH 66

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHIS 487
           G  Q  + WADGPA++ QCPI TG S++Y + +  Q GT ++H+H+S
Sbjct: 67  GFFQKGTNWADGPAFVNQCPITTGHSFLYNFNVPDQAGTFWYHSHLS 113



>gb:AY338485_1600486 Volvariella volvacea laccase 5 (lac5) mRNA,
           complete cds.
          Length = 533

 Score = 89.4 bits (220), Expect = 6e-17
 Identities = 45/121 (37%), Positives = 70/121 (57%), Gaps = 6/121 (4%)
 Frame = +2

Query: 179 YEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHW 343
           +  N+T  NV+   + +S + VNG      I+  +GD+ +I V N++ N +     SIHW
Sbjct: 39  HTLNLTNANVSPDGYNRSAILVNGNLLNEAIVGNKGDQFVITVENNLDNPLLRKSASIHW 98

Query: 344 HGIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPII 520
           HG+ Q  + WADGPA++TQCPI    S+ Y++T   + GT ++H+H+       L GP I
Sbjct: 99  HGLFQRGTQWADGPAFVTQCPIAPEHSFTYQFTAGHEAGTFWYHSHLDAQYCDGLRGPFI 158

Query: 521 I 523
           I
Sbjct: 159 I 159



>gb:AP004262_1839337 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0022B05.
          Length = 545

 Score = 89.0 bits (219), Expect = 7e-17
 Identities = 52/176 (29%), Positives = 90/176 (51%), Gaps = 4/176 (2%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHT-KSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           R + +NVT  ++  L  T +  + +NG++PGP I     D +++ V N++     + W+G
Sbjct: 30  RFFTWNVTYGSINPLGSTPQQGILINGQFPGPRIDCVTNDNIIVNVFNNLDEPFLLTWNG 89

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL 526
           I+Q ++ W DG    T CPI  G +Y YK+    Q GT  +   ++  RA    G + + 
Sbjct: 90  IKQRKNSWQDG-VLGTNCPIPPGANYTYKFQAKDQIGTFVYFPSVAMHRAAGGFGALNVY 148

Query: 527 PKKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNV--SDAYTINGLP 688
            +  +  P+  P  +  ++ G+W+    +  + QAL  GGG  +   DA  ING+P
Sbjct: 149 QRPAIPVPYPPPAGDFTLLVGDWYKAGHKQ-LRQALDAGGGGALPPPDALLINGMP 203



>gb:POS344434_1701040 Pleurotus ostreatus poxa3 gene for laccase.
          Length = 521

 Score = 89.0 bits (219), Expect = 7e-17
 Identities = 49/179 (27%), Positives = 91/179 (50%), Gaps = 7/179 (3%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-----NIS 334
           T+  +F++    V+     +  +TVNG +PG P++ ++ D++ I   N + +     + S
Sbjct: 21  TKKLDFHIRNDVVSPDGFERRAITVNGIFPGTPVILQKNDKVQINTINELTDPGMRRSTS 80

Query: 335 IHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHG 511
           IHWHG+ Q ++   DGP+++ QCPI    +++Y +   GQ G  ++H+H+S      L G
Sbjct: 81  IHWHGLFQHKTSGMDGPSFVNQCPIPPNSTFLYDFDTAGQTGNYWYHSHLSTQYCDGLRG 140

Query: 512 PIIIL-PKKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
             I+  P   + + +    +   I   +W++       +Q  QTG  P + D   ING+
Sbjct: 141 SFIVYDPNDPLKHLYDVDDESTIITLADWYHDLAPHAQNQFFQTGSVP-IPDTGLINGV 198



>gb:AY875867_1631877 Coriolopsis gallica laccase (lacA) mRNA,
           partial cds.
          Length = 496

 Score = 89.0 bits (219), Expect = 7e-17
 Identities = 49/161 (30%), Positives = 82/161 (50%), Gaps = 7/161 (4%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPA 388
           ++  + VN  +P P I   +GDR  + V +++ N+      SIHWHG  Q  + WADGPA
Sbjct: 21  SRQAILVNDVFPSPLITGNKGDRFQLNVIDNMTNHTMLKSTSIHWHGFFQHGTNWADGPA 80

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPY 565
           ++ QCPI TG +++Y + +  Q GT ++H+H+S      L G I++   ++         
Sbjct: 81  FVNQCPISTGHAFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGSIVVYDPQDPHKSLYDVD 140

Query: 566 KEVPII-FGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
            +  +I   +W++         A + G     +DA  INGL
Sbjct: 141 DDSTVITLADWYH--------LAARVGPAIPTADATLINGL 173



>gb:AY365228_1602878 Rigidoporus microporus laccase (lcc) mRNA,
           complete cds.
          Length = 518

 Score = 89.0 bits (219), Expect = 7e-17
 Identities = 39/107 (36%), Positives = 63/107 (58%), Gaps = 5/107 (4%)
 Frame = +2

Query: 182 EFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWH 346
           + +++  N++    T++ V   G +PGP I   +GD   I V N + +       +IHWH
Sbjct: 28  DLHISNANISPDGFTRAAVLAGGSFPGPLITGNKGDNFQINVINDLTDADQLKTTTIHWH 87

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHIS 487
           G  Q  + WADGPA+I QCPI +G S++Y + +  Q GT ++H+H+S
Sbjct: 88  GFFQHGTNWADGPAFINQCPIASGNSFLYNFQVPDQAGTFWYHSHLS 134



>gb:AY167042_1586241 Rigidoporus microporus laccase (lcc) gene,
           complete cds.
          Length = 518

 Score = 89.0 bits (219), Expect = 7e-17
 Identities = 39/107 (36%), Positives = 63/107 (58%), Gaps = 5/107 (4%)
 Frame = +2

Query: 182 EFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWH 346
           + +++  N++    T++ V   G +PGP I   +GD   I V N + +       +IHWH
Sbjct: 28  DLHISNANISPDGFTRAAVLAGGSFPGPLITGNKGDNFQINVINDLTDADQLKTTTIHWH 87

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHIS 487
           G  Q  + WADGPA+I QCPI +G S++Y + +  Q GT ++H+H+S
Sbjct: 88  GFFQHGTNWADGPAFINQCPIASGNSFLYNFQVPDQAGTFWYHSHLS 134



>gb:AY338483_1600484 Volvariella volvacea laccase 2 (lac2) mRNA,
           complete cds.
          Length = 545

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 47/138 (34%), Positives = 74/138 (53%), Gaps = 7/138 (5%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPAY 391
           +  V VNG   G  I  ++GD  +I+V+N + +++     SIHWHG+ Q  S WADGPA+
Sbjct: 52  RDAVLVNGGLFGAVITGQKGDGFVIEVDNQLTDSLLRKSTSIHWHGLFQRDSAWADGPAF 111

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPYK 568
           +TQCPI  G ++ Y++T   + GT ++H+H+       L GP II    +          
Sbjct: 112 VTQCPIAPGHTFTYRFTATEEAGTFWYHSHLDAQYCDGLRGPFIIYGPNDPHLGLYDVDN 171

Query: 569 EVPII-FGEWFNGDTEAI 619
           E  II   +W++   E +
Sbjct: 172 EDTIITLADWYHTPAELL 189



>gb:AB006824_1193048 Trachyderma tsunodae mRNA for Bilirubin
           Oxidase, complete cds.
          Length = 521

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 40/105 (38%), Positives = 63/105 (60%), Gaps = 6/105 (5%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPAY 391
           +  + VNG +P P I  ++GDR  + V +++ N+      SIHWHG  Q  + WADG A+
Sbjct: 43  RDAIVVNGVFPAPLITGKKGDRFQLNVIDNMTNHTMLKSTSIHWHGFFQKGTNWADGGAF 102

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           + QCPI  G S++Y + +  Q GT ++H+H+S      L GPI++
Sbjct: 103 VNQCPIAPGHSFLYDFRVPDQAGTFWYHSHLSTQYCDGLRGPIVV 147



>gb:AP003723_1832421 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0003H08.>gb:AP003728_1832576 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0710B08.
          Length = 542

 Score = 88.2 bits (217), Expect = 1e-16
 Identities = 51/171 (29%), Positives = 86/171 (50%), Gaps = 1/171 (0%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGI 352
           R Y +N+T  ++  L   +  + +NG++PGP I A   D ++I V N++ +   + W GI
Sbjct: 27  RFYTWNITFGDIYPLGVKQQGILINGQFPGPQIDAVTNDNIIINVFNNLPSPFLLSWQGI 86

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILP 529
           +Q RS W DG  Y T CPI  G ++ Y      Q G+ ++   +++ +A   +G I +L 
Sbjct: 87  QQRRSSWQDG-VYGTNCPIPPGGNFTYIMQFKDQIGSYYYFPSLAFHKAAGGYGGIRVLS 145

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
           +  +  PF  P  +  I+ G+WF  +    +   L +G      D   ING
Sbjct: 146 RPGIPVPFAPPAGDFTILAGDWFKLN-HTDLQGILDSGNDLPPPDGLLING 195



>gb:AF152170_1772728 Pycnoporus cinnabarinus laccase (lac1) mRNA,
           complete cds.>gb:AF170093_1774242 Pycnoporus
           cinnabarinus laccase (Lac1) gene, complete cds.
          Length = 518

 Score = 88.2 bits (217), Expect = 1e-16
 Identities = 41/105 (39%), Positives = 61/105 (58%), Gaps = 6/105 (5%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPAY 391
           +  V VNG  P P I   +GDR  + V + + N+      SIHWHG  Q  + WADGPA+
Sbjct: 43  REAVVVNGITPAPLITGNKGDRFQLNVIDQLTNHTMLKTSSIHWHGFFQQGTNWADGPAF 102

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           + QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++
Sbjct: 103 VNQCPIASGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVV 147



>gb:CR382127_1660289 Yarrowia lipolytica chromosome A of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 695

 Score = 88.2 bits (217), Expect = 1e-16
 Identities = 47/130 (36%), Positives = 80/130 (61%), Gaps = 5/130 (3%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQLRSGWADGPAYITQCP 406
           + +  +NGK+PGP I A EGDR+++ V N  A+   +H+HG+ Q  + + DG   +TQC 
Sbjct: 167 RKMTVINGKFPGPLIEANEGDRIIVHVKNEGADPTGMHFHGMFQKGTNFMDGVLGVTQCG 226

Query: 407 IQTGQSYVYKYTIVGQRGTLFWHAHISW-LRAT--LHGPIII-LPKKNVSYPFVKPYKEV 574
           I  G  + Y +T+ GQ GT ++H+H  W L+A   + GP++I  PK++ +Y  +  Y E 
Sbjct: 227 IMPGHEFTYNFTLDGQYGTYWYHSH--WDLQAIDGVAGPLVIHSPKEDEAYKHL--YDEE 282

Query: 575 PIIF-GEWFN 601
            ++F  +W++
Sbjct: 283 MVLFVNDWYH 292



>gb:AY338764_1600500 Coprinopsis cinerea strain AmutBmut laccase 8
           (lcc8) gene, complete cds.
          Length = 567

 Score = 88.2 bits (217), Expect = 1e-16
 Identities = 56/170 (32%), Positives = 84/170 (49%), Gaps = 20/170 (11%)
 Frame = +2

Query: 242 VNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPAYITQCP 406
           VNG +P P I A +GD   + V N + ++      SIHWHGI Q  + WADG A + QCP
Sbjct: 41  VNGVFPAPLIKANKGDHFSLNVVNDMTDDTQFRATSIHWHGIYQKHTNWADGVAGVNQCP 100

Query: 407 IQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPY----KE 571
           I  G S++Y++ +  Q GT ++H+H        L GP++I   ++   P+   Y    + 
Sbjct: 101 IGPGDSFLYQFDVPNQAGTFWYHSHFRTQYCDGLRGPLVIYDPED---PYRDLYDVDDEN 157

Query: 572 VPIIFGEWFNGDTEAIISQALQTG----------GGPNVSDAYTINGLPG 691
             I  G+W++  + +I   A              GGP V D   IN +PG
Sbjct: 158 TVITIGDWYHLQSPSITGVASNDATVINGKGRYVGGPLV-DLAIINVVPG 206



>gb:AY249052_1592662 Volvariella volvacea laccase 1 (lac1) mRNA,
           complete cds.
          Length = 518

 Score = 88.2 bits (217), Expect = 1e-16
 Identities = 53/165 (32%), Positives = 83/165 (50%), Gaps = 10/165 (6%)
 Frame = +2

Query: 221 HTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGP 385
           H++ +V VNG      I   +GD   I+V+N +   I     SIHWHG+ Q  S WADGP
Sbjct: 43  HSREVVLVNGGLFQAVIAGNKGDDFEIEVDNQLTVEILRKSTSIHWHGLFQRGSAWADGP 102

Query: 386 AYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKP 562
           A++TQCPI  G ++ Y++T   + GT ++H+H+       L GP +I    +   P +  
Sbjct: 103 AFVTQCPIAPGNTFTYEFTPTDEVGTFWYHSHLDAQYCDGLRGPFVIYDPND---PHLAL 159

Query: 563 Y----KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
           Y    ++  I   +W++   E +         G  + D+  INGL
Sbjct: 160 YDVDDEDTIITLADWYHTAAELLT--------GVVIPDSALINGL 196



>gb:AP005185_1849011 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0409B11.
          Length = 563

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 52/171 (30%), Positives = 87/171 (50%), Gaps = 1/171 (0%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGI 352
           R + + VT  ++T L   +  + +NG++PGP I A   D L+I V N + +   I W+GI
Sbjct: 29  RFFTWTVTYGDITPLGVKQQGILINGQFPGPTIEAVTNDNLIINVFNKLNDPFLISWNGI 88

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILP 529
           +Q R+ + DG A  T CPI  G ++ Y   +  Q GT F+   +++ +A    G I +L 
Sbjct: 89  QQRRNSFEDGVAG-TTCPIPPGGNFTYILQVKDQIGTYFYFPSLAFHKAAGGFGAIRVLS 147

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
           +  +  PF  P  + P++ G+W+  +    +   L +G      D   ING
Sbjct: 148 RPMIPVPFPPPAADYPLLIGDWYKAN-HTDLKYMLDSGKALGFPDGLLING 197



>gb:ASNDHGO_1542200 Aspergillus terreus DHGO gene for dihydrogeodin
           oxidase, complete cds (exon1-7).
          Length = 605

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 46/118 (38%), Positives = 69/118 (58%), Gaps = 3/118 (2%)
 Frame = +2

Query: 179 YEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANN--ISIHWHGI 352
           Y+  VT   ++   + +     NG+YPGP I A  GD L I V+N++ N    ++HWHGI
Sbjct: 62  YDLTVTQVTISPDGYERLGTVFNGQYPGPLIEADWGDTLRITVHNNLTNGNGTAVHWHGI 121

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           R   + W DG   +TQCPI  G+S VY++    Q GT ++H+H S   +  L+GP++I
Sbjct: 122 RLFETNWIDGVPGVTQCPIPPGESQVYEFRAT-QYGTSWYHSHFSLQYSNGLYGPLVI 178



>gb:AY676427_1621958 Lentinula edodes laccase 3 VT (LAC3) mRNA,
           complete cds.
          Length = 548

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 52/153 (33%), Positives = 84/153 (54%), Gaps = 7/153 (4%)
 Frame = +2

Query: 245 NGKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWHGIRQLRSGWADGPAYITQCPI 409
           +  +PGP I  R+GDR  I V + + +     + SIHWHG+ Q  + +ADG A+++QCPI
Sbjct: 72  DASFPGPLIAGRKGDRFTINVTDLLTDPTMDRSTSIHWHGLSQKTTNYADGVAFVSQCPI 131

Query: 410 QTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPYKEVPII- 583
            T  S++Y + +  Q GTL++H+H+S      L GPI+I   ++          E  II 
Sbjct: 132 ATNHSFLYDFGVPDQAGTLWYHSHLSVQYGDGLRGPIVIYDPEDPHQDLYDVDDESTIIT 191

Query: 584 FGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
             +WF+  +  +++  +     PN +DA  ING
Sbjct: 192 IADWFHLTSLQLLAALVV----PN-ADATLING 219



>gb:AY338486_1600487 Volvariella volvacea laccase 4 (lac4) mRNA,
           complete cds.
          Length = 562

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 51/160 (31%), Positives = 81/160 (50%), Gaps = 7/160 (4%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNIS-----IHWHGIRQLRSGWADGPAY 391
           ++ V VNG      I   +GD   IK++N + N++S     IHWHG+ Q  + WADGPA+
Sbjct: 83  RNAVLVNGGLFQTAITGNKGDEFAIKIDNKLTNSLSHKSTSIHWHGLFQHGTPWADGPAF 142

Query: 392 ITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKPY 565
           ++QCPI  G  Y Y+++   Q GT ++H+H+       L GP II  P       +    
Sbjct: 143 VSQCPIAPGHQYTYRFSSADQAGTFWYHSHLDAQYCDGLRGPFIIYDPGDPHRSLYDIDN 202

Query: 566 KEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
           K+  I   +W++ D+  +         G  + ++  INGL
Sbjct: 203 KDTIITLADWYHRDSNLL--------SGIVIPNSTLINGL 234



>gb:AE016959_1021990 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC079634_1732666
           Genomic Sequence for Oryza sativa, Nipponbare strain,
           clone OSJNBa0045C13, from Chromosome 10, complete
           sequence.>gb:AE017080_1751809 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 34 of 77 of the
           complete sequence.
          Length = 531

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 39/94 (41%), Positives = 55/94 (58%)
 Frame = +2

Query: 179 YEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQ 358
           + F V+  N+T LC   +   VNG+ PGP I   EGD + + V N    N++IHWHG+ Q
Sbjct: 43  HTFVVSQVNMTHLCKEMAFTVVNGQLPGPTIEVTEGDSVTVHVVNKSPYNLTIHWHGVYQ 102

Query: 359 LRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRG 460
           L + W DG   ITQ PIQ   ++ Y++ + GQ G
Sbjct: 103 LLNCWNDGVPMITQRPIQPNHNFTYRFNVAGQEG 136



>gb:AB015758_1512727 Schizophyllum commune mRNA for laccase,
           complete cds.
          Length = 518

 Score = 86.7 bits (213), Expect = 4e-16
 Identities = 39/93 (41%), Positives = 58/93 (62%), Gaps = 5/93 (5%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWHGIRQLRSGWADGPA 388
           ++  V  NGK+PG  I   +G+   I V + + +     + +IHWHG  Q  S WADGPA
Sbjct: 37  SRPTVLANGKFPGELIKGTKGNTFKINVQDQLNDTRMLRSTTIHWHGFFQKNSNWADGPA 96

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHIS 487
            +TQCPI TG S+VY++ +  Q GT ++H+H+S
Sbjct: 97  GVTQCPIATGDSFVYEFGVPDQAGTFWYHSHLS 129



>sp|Q12542|LAC2_AGABI Laccase II precursor (EC 1.10.3.2)
           (Benzenediol:oxygen oxidoreductase) (Urishiol oxidase)
           (Diphenol oxidase).>gb:AEDLACCASE_1760435 Agaricus
           bisporus laccase (lcc2) mRNA, complete cds.
          Length = 520

 Score = 86.7 bits (213), Expect = 4e-16
 Identities = 48/178 (26%), Positives = 91/178 (51%), Gaps = 7/178 (3%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANN-----IS 334
           T+ + F++    +      +  V +NG++PG  +   +GD + I VNN + ++     +S
Sbjct: 21  TKTFNFDLVNTRLAPDGFERDTVVINGEFPGTLVQVNKGDSVRIPVNNKLTSSTMRRSVS 80

Query: 335 IHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHG 511
           IHWHG  Q R+   DGPA++ QCP     ++ Y++++  + GT ++H+H+S      L G
Sbjct: 81  IHWHGFFQARTSGQDGPAFVNQCPQPPNTTFTYEFSVADESGTFWYHSHLSTQYCDGLRG 140

Query: 512 PIIIL-PKKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
             ++  P+  + + +    +   I   EW++     I ++   +G  P V D+  ING
Sbjct: 141 AFVVYDPEDPLGHLYDVDDETTVITLAEWYHVLAPDINNEFFSSGIIP-VQDSGLING 197



>gb:AY875863_1631873 Coriolopsis gallica laccase (lacg450) gene,
           partial cds.
          Length = 111

 Score = 86.3 bits (212), Expect = 5e-16
 Identities = 37/105 (35%), Positives = 61/105 (58%), Gaps = 5/105 (4%)
 Frame = +2

Query: 182 EFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWH 346
           +  ++  N++    T++ V  N + PGP I   +GD   + V +++ N+      +IHWH
Sbjct: 7   DLTISNANISPDGFTRAAVVANNQLPGPLITGNKGDTFQLNVIDNLTNDTMLTATTIHWH 66

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAH 481
           G  Q  + WADGPA++ QCPI  G S++Y +   GQ GT ++H+H
Sbjct: 67  GFFQKGTNWADGPAFVNQCPISEGNSFLYDFAAPGQAGTFWYHSH 111



>gb:AE013599_1130140 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003786_1224563 Drosophila melanogaster
           chromosome 2R, section 3 of 74 of the complete sequence.
          Length = 733

 Score = 86.3 bits (212), Expect = 5e-16
 Identities = 42/101 (41%), Positives = 62/101 (61%), Gaps = 2/101 (1%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-NISIHWHGIRQLRSGWADGPAYITQC 403
           + I+T N   PGP I   E D+++I V NH+    ++IHWHGI Q  S + DG  ++TQC
Sbjct: 183 RGILTANRMIPGPSIQVCENDKVVIDVENHMEGMEVTIHWHGIWQRGSQYYDGVPFVTQC 242

Query: 404 PIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           PIQ G ++ Y++T  G  GT FWHAH    +   L+G +++
Sbjct: 243 PIQQGNTFRYQWT--GNAGTHFWHAHTGLQKLDGLYGSVVV 281



>gb:AE013599_1130139 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003786_1224562 Drosophila melanogaster
           chromosome 2R, section 3 of 74 of the complete
           sequence.>gb:BT010091_1357457 Drosophila melanogaster
           HL05804 full insert cDNA.
          Length = 784

 Score = 86.3 bits (212), Expect = 5e-16
 Identities = 42/101 (41%), Positives = 62/101 (61%), Gaps = 2/101 (1%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-NISIHWHGIRQLRSGWADGPAYITQC 403
           + I+T N   PGP I   E D+++I V NH+    ++IHWHGI Q  S + DG  ++TQC
Sbjct: 234 RGILTANRMIPGPSIQVCENDKVVIDVENHMEGMEVTIHWHGIWQRGSQYYDGVPFVTQC 293

Query: 404 PIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           PIQ G ++ Y++T  G  GT FWHAH    +   L+G +++
Sbjct: 294 PIQQGNTFRYQWT--GNAGTHFWHAHTGLQKLDGLYGSVVV 332



>gb:AE013599_1130138 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003786_1224561 Drosophila melanogaster
           chromosome 2R, section 3 of 74 of the complete sequence.
          Length = 855

 Score = 86.3 bits (212), Expect = 5e-16
 Identities = 42/101 (41%), Positives = 62/101 (61%), Gaps = 2/101 (1%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-NISIHWHGIRQLRSGWADGPAYITQC 403
           + I+T N   PGP I   E D+++I V NH+    ++IHWHGI Q  S + DG  ++TQC
Sbjct: 234 RGILTANRMIPGPSIQVCENDKVVIDVENHMEGMEVTIHWHGIWQRGSQYYDGVPFVTQC 293

Query: 404 PIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           PIQ G ++ Y++T  G  GT FWHAH    +   L+G +++
Sbjct: 294 PIQQGNTFRYQWT--GNAGTHFWHAHTGLQKLDGLYGSVVV 332



>pir|A85439|A85439 pectinesterase like protein [imported] -
           Arabidopsis thaliana>gb:ATAP21_1543981 Arabidopsis
           thaliana DNA chromosome 4, ESSA I AP2 contig fragment
           No. 1.>gb:ATCHRIV86_1547671 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 86.
          Length = 541

 Score = 86.3 bits (212), Expect = 5e-16
 Identities = 47/170 (27%), Positives = 87/170 (51%), Gaps = 1/170 (0%)
 Frame = +2

Query: 179 YEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQ 358
           Y + VT    + L   + ++ +NG++PGP I A   + +++ + N +     I W+G++Q
Sbjct: 33  YTWTVTYGTRSPLGVPQQVILINGQFPGPAIEAVTNNNIVVNLINKLDEPFLITWNGVKQ 92

Query: 359 LRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKK 535
            R+ W DG    T CPIQ   ++ Y++ +  Q GT  + A  S  RA+   G + I  + 
Sbjct: 93  RRTSWQDG-VLGTNCPIQPNSNWTYQFQLKDQIGTYTYFASTSLHRASGAFGALNINQRS 151

Query: 536 NVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
            ++ P+  P  +  ++  +WF+  T   + ++L  G    + DA  ING+
Sbjct: 152 VITTPYPTPDGDFTLLVSDWFSNMTHKDLRKSLDAGSALPLPDALLINGV 201



>gb:PSA507324_1702002 Pleurotus sajor-caju mRNA for laccase 1 (lac1
           gene).
          Length = 531

 Score = 85.9 bits (211), Expect = 6e-16
 Identities = 41/112 (36%), Positives = 62/112 (55%), Gaps = 6/112 (5%)
 Frame = +2

Query: 206 VTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSG 370
           V R   +    +  G  PG  +   +GD   + V N +++       SIHWHGI Q  S 
Sbjct: 49  VARSAPSTESTSETGSTPGVLVQGNKGDNFQLNVLNQLSDTTMLKTTSIHWHGIFQTNST 108

Query: 371 WADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           WADGPA++ QCPI +G S++Y + +  Q GT ++H+H+S      L GP++I
Sbjct: 109 WADGPAFVNQCPIASGNSFLYDFNVADQAGTFWYHSHLSTQYCDGLRGPLVI 160



>gb:AY136404_1581905 Arabidopsis thaliana pectinesterase, putative
           (At1g76160) mRNA, complete cds.>gb:BT000227_1634505
           Arabidopsis thaliana pectinesterase, putative
           (At1g76160) mRNA, complete cds.
          Length = 541

 Score = 85.9 bits (211), Expect = 6e-16
 Identities = 50/171 (29%), Positives = 87/171 (50%), Gaps = 1/171 (0%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGI 352
           R +E+N+T  ++  L   +  + +NG +PGP I +   D L+I V N +     + W+GI
Sbjct: 28  RFFEWNITYGDIYPLGVRQQGILINGAFPGPDIHSVTNDNLIINVYNSLDEPFLLSWNGI 87

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILP 529
           +Q R+ + DG  Y T CPI  G++Y Y   +  Q G+ ++   + + +A    G I IL 
Sbjct: 88  QQRRNSFVDG-VYGTTCPIPPGKNYTYILQMKDQIGSFYYFPSLGFHKAAGGFGGIRILS 146

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
           +  +  PF  P  +  ++ G+W+  +   + +Q L  G    + D   ING
Sbjct: 147 RPRIPVPFPDPAGDTTVLIGDWYKANHTDLRAQ-LDNGKKLPLPDGILING 196



>gb:AY057492_1563911 Arabidopsis thaliana At1g76160/T23E18_10 mRNA,
           complete cds.
          Length = 541

 Score = 85.9 bits (211), Expect = 6e-16
 Identities = 50/171 (29%), Positives = 87/171 (50%), Gaps = 1/171 (0%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGI 352
           R +E+N+T  ++  L   +  + +NG +PGP I +   D L+I V N +     + W+GI
Sbjct: 28  RFFEWNITYGDIYPLGVRQQGILINGAFPGPDIHSVTNDNLIINVYNSLDEPFLLSWNGI 87

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILP 529
           +Q R+ + DG  Y T CPI  G++Y Y   +  Q G+ ++   + + +A    G I IL 
Sbjct: 88  QQRRNSFVDG-VYGTTCPIPPGKNYTYILQMKDQIGSFYYFPSLGFHKAAGGFGGIRILS 146

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
           +  +  PF  P  +  ++ G+W+  +   + +Q L  G    + D   ING
Sbjct: 147 RPRIPVPFPDPAGDTTVLIGDWYKANHTDLRAQ-LDNGKKLPLPDGILING 196



>gb:AB055709_1521604 Colletotrichum lagenarium LAC1 gene for
           laccase, complete cds.
          Length = 589

 Score = 85.9 bits (211), Expect = 6e-16
 Identities = 63/178 (35%), Positives = 90/178 (50%), Gaps = 7/178 (3%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCH---TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANN-ISI 337
           TR Y+F +T  NVT       +K  + +NG++PGP I A  GD + I V+N +A+N  SI
Sbjct: 68  TRVYDFTIT--NVTDFAADGISKPAMLINGQFPGPTIEADWGDWVEINVHNQLADNGTSI 125

Query: 338 HWHGIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGP 514
           HWHG+ Q  S   DG   +T+CPI  G S  YK+ ++ Q GT ++H+H S      + G 
Sbjct: 126 HWHGMHQRNSNDQDGANGVTECPIAPGHSKTYKFQMI-QYGTSWYHSHFSSQYGNGVVGA 184

Query: 515 IIILPKKNVSYPF-VKPYKEVPIIFGEWFNGDTEAIISQA-LQTGGGPNVSDAYTING 682
           I I    +  Y   + PY        +W+    + +  QA L   G P  SD    NG
Sbjct: 185 IKINGPASADYDIDLGPY-----TVSDWYYDTADRLERQAELVANGPPPDSDNVLFNG 237



>gb:AY135186_1302954 Manduca sexta laccase 2 mRNA, complete cds.
          Length = 760

 Score = 85.9 bits (211), Expect = 6e-16
 Identities = 43/101 (42%), Positives = 62/101 (61%), Gaps = 2/101 (1%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-NISIHWHGIRQLRSGWADGPAYITQC 403
           + I+T N   PGP I A E D+++I V NH+    ++IHWHGI Q  S + DG  ++TQC
Sbjct: 207 RGILTANRMLPGPSIQACENDKVVIDVENHMEGMEVTIHWHGIWQRGSQYYDGVPFVTQC 266

Query: 404 PIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           PIQ G ++ Y++   G  GT FWHAH    +   L+G I++
Sbjct: 267 PIQQGNTFRYQWQ--GNAGTHFWHAHTGLQKLDGLYGSIVV 305



>pir|E96789|E96789 protein T23E18.10 [imported] - Arabidopsis
           thaliana>gb:AE005173_895149 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC009978_1536895 Genomic sequence for
           Arabidopsis thaliana BAC T23E18 from chromosome I,
           complete sequence.
          Length = 541

 Score = 85.9 bits (211), Expect = 6e-16
 Identities = 50/171 (29%), Positives = 87/171 (50%), Gaps = 1/171 (0%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGI 352
           R +E+N+T  ++  L   +  + +NG +PGP I +   D L+I V N +     + W+GI
Sbjct: 28  RFFEWNITYGDIYPLGVRQQGILINGAFPGPDIHSVTNDNLIINVYNSLDEPFLLSWNGI 87

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILP 529
           +Q R+ + DG  Y T CPI  G++Y Y   +  Q G+ ++   + + +A    G I IL 
Sbjct: 88  QQRRNSFVDG-VYGTTCPIPPGKNYTYILQMKDQIGSFYYFPSLGFHKAAGGFGGIRILS 146

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
           +  +  PF  P  +  ++ G+W+  +   + +Q L  G    + D   ING
Sbjct: 147 RPRIPVPFPDPAGDTTVLIGDWYKANHTDLRAQ-LDNGKKLPLPDGILING 196



>gb:AP003411_1829039 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1148D12.
          Length = 553

 Score = 85.5 bits (210), Expect = 8e-16
 Identities = 47/170 (27%), Positives = 86/170 (50%), Gaps = 2/170 (1%)
 Frame = +2

Query: 179 YEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQ 358
           +++ VT    T +   + ++ +N  +PGP I     + +++ V N + + +  +WHGI+Q
Sbjct: 30  FDWKVTYGTRTIMDVAQKVMLINDMFPGPTINCSSNNNIVVNVFNQLDHPLLFNWHGIQQ 89

Query: 359 LRSGWADG-PAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPK 532
            ++ W DG P   T CPIQ G ++ YK+    Q GT F+   +   RA   +G I +  +
Sbjct: 90  RKNSWMDGMPG--TNCPIQPGTNWTYKWQPKDQIGTFFYFPSMGMQRAAGGYGIITVHSR 147

Query: 533 KNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
             +  PF +P  + P++ G+W+  D   ++++ L  G          ING
Sbjct: 148 LLIPVPFDEPAGDYPVLVGDWYTKD-HTVLAKNLDAGKSIGRPAGLVING 196



>gb:AF479568_1803525 Petunia x hybrida 1-ascorbate oxidase (p303)
           gene, complete cds.
          Length = 559

 Score = 85.5 bits (210), Expect = 8e-16
 Identities = 49/172 (28%), Positives = 84/172 (48%), Gaps = 1/172 (0%)
 Frame = +2

Query: 179 YEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQ 358
           +++NVT   ++ L   +  + +NG+ PGP I     + +++ V NH+   + I W+GI+Q
Sbjct: 31  FDWNVTYGTISPLGVPQQGILINGQLPGPTINCTSNNNIVVNVFNHLDEPLLITWNGIQQ 90

Query: 359 LRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKK 535
            ++ W DG    T CPI  G ++ Y + +  Q G+ F+       RA    GPI +  + 
Sbjct: 91  RKNSWQDGTPG-TMCPIMPGTNFTYHFQVKDQIGSFFYFPTTDLHRAAGGFGPINVHSRN 149

Query: 536 NVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
            +  PF  P  E  +  G+W+N   ++ + + L  G      D   ING  G
Sbjct: 150 LIPIPFDSPAAEYNVFVGDWYNKGYKS-LKKILDGGRTIGRPDGIHINGKSG 200



>gb:AY839939_1630507 Trametes sp. 420 laccase A (lacA) gene,
           complete cds.
          Length = 514

 Score = 85.5 bits (210), Expect = 8e-16
 Identities = 39/120 (32%), Positives = 69/120 (57%), Gaps = 6/120 (5%)
 Frame = +2

Query: 182 EFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWH 346
           +  ++  N++    T+S V +N ++PGP +   +G    I V +++ N+      +IHWH
Sbjct: 30  DLTISNANISPDGFTRSAVVMNNQFPGPLVTGNKGANFQINVIDNLTNDTMLTATTIHWH 89

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           G  Q  + WADG A++ QCPI  G S++Y ++   Q GT ++H+H+S      L GP+++
Sbjct: 90  GFFQKGTNWADGGAFVNQCPISKGNSFLYDFSAPDQAGTFWYHSHLSTQYCDGLRGPMVV 149



>gb:AY485828_1608505 Auricularia auricula-judae multicopper oxidase
           mRNA, complete cds.
          Length = 595

 Score = 85.5 bits (210), Expect = 8e-16
 Identities = 56/180 (31%), Positives = 87/180 (48%), Gaps = 8/180 (4%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHG 349
           TR Y F ++          K +V VN  +PGP I   + DR++I+V N   N  +IHWHG
Sbjct: 81  TREYNFTISNVRGAPAGVEKDMVVVNNIWPGPTIEVNQHDRVVIRVMNRAQNATAIHWHG 140

Query: 350 IRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAH-ISWLRATLHGPIIIL 526
           + Q  + + DG   ITQC I  GQ  VY +T+    GT +WH+H ++     + G  I+ 
Sbjct: 141 LYQRGTPFYDGTHGITQCGIPPGQDLVYNFTLGDFSGTTWWHSHYMTQYTDGVTGAFIVH 200

Query: 527 P-KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQ------TGGGPNVSDAYTINGL 685
           P    VS P       + +  G+ ++  ++ +++          T G   V D  TING+
Sbjct: 201 PTNATVSAPTYDTDSLIQV--GDMYHTISDKLLAAFTSPSGIDGTPGDEPVPDTGTINGM 258



>gb:AY586512_1616453 Aspergillus fumigatus ferroxidase (fetC) and
           high-affinity iron permease (ftrA) genes, complete cds.
          Length = 592

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 52/169 (30%), Positives = 87/169 (51%), Gaps = 8/169 (4%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCH-TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-SIHW 343
           T HY++N+T           + ++ +NG++P P +    GDR++ KV+N + N   S+HW
Sbjct: 22  TLHYDWNITWVTANPDGQFERPVIGINGQWPPPVLSFTRGDRIIAKVHNALGNETTSVHW 81

Query: 344 HGIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPII 520
           HG  Q  +   DGP  +TQC I  G ++VY +T V Q GT ++H+H        L   ++
Sbjct: 82  HGFFQNGTNHMDGPPSVTQCDIAPGSTFVYNFT-VEQSGTYWYHSHTKGQYPDGLRQALV 140

Query: 521 ILPKKNVSYPFVKPYKEVPII-FGEWFNGD----TEAIISQALQTGGGP 652
           +   KN   P++  Y E  +I   +W++       ++ IS +  TG  P
Sbjct: 141 VTDPKN---PYIGQYDEERVISLSDWYHDQMPTLLKSFISISNPTGAEP 186



>gb:AY072215_1567101 Arabidopsis thaliana putative pectinesterase
           (At4g38420) mRNA, complete cds.>gb:AY096593_1576133
           Arabidopsis thaliana putative pectinesterase (At4g38420)
           mRNA, complete cds.
          Length = 549

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 48/171 (28%), Positives = 85/171 (49%), Gaps = 1/171 (0%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGI 352
           R +++ VT  N++ L   +  + +NG+YPGP I +   D L+I V+N +     + W+G+
Sbjct: 30  RFFDWRVTYGNISPLGIPQRGILINGQYPGPDIYSVTNDNLIINVHNDLDEPFLLSWNGV 89

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILP 529
           +  ++ + DG  Y T CPI  G++Y Y   +  Q G+ F+   ++  +A    G   IL 
Sbjct: 90  QLRKNSYQDG-VYGTTCPIPPGKNYTYAIQVKDQIGSFFYFPSLAVHKAAGGFGGFRILS 148

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
           +  +  PF +P  +   + G+WF  D   ++   L  G    +     ING
Sbjct: 149 RPRIPVPFPEPAGDFTFLIGDWFKHD-HKVLKAILDRGHKLPLPQGVLING 198



>gb:AB046713_1520542 Lentinula edodes LeLcc3 mRNA for laccase,
           complete cds.>gb:AB055159_1521431 Lentinula edodes lcc3
           gene for laccase, complete cds.
          Length = 548

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 51/153 (33%), Positives = 83/153 (54%), Gaps = 7/153 (4%)
 Frame = +2

Query: 245 NGKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWHGIRQLRSGWADGPAYITQCPI 409
           +  +PGP I  R+GDR  I V + + +     + SIHWHG+ Q  + +ADG A+++QCPI
Sbjct: 72  DASFPGPLITGRKGDRFTINVTDLLTDPTMDRSTSIHWHGLFQKTTNYADGVAFVSQCPI 131

Query: 410 QTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPYKEVPII- 583
            T  S++Y + +  Q GT ++H+H+S      L GPI+I   ++          E  II 
Sbjct: 132 ATNHSFLYDFGVPDQAGTFWYHSHLSVQYGDGLRGPIVIYDPEDPHQDLYDVDDESTIIT 191

Query: 584 FGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
             +WF+  +  +++  +     PN +DA  ING
Sbjct: 192 IADWFHLTSLQLLAALVV----PN-ADATLING 219



>gb:AB018109_1513736 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K17N15.>gb:BT004129_1637229 Arabidopsis
           thaliana clone RAFL15-06-D22 (R20700) unknown protein
           (At5g51480) mRNA, complete cds.>gb:BT004990_1637936
           Arabidopsis thaliana clone U20700 unknown protein
           (At5g51480) mRNA, complete cds.
          Length = 592

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 49/169 (28%), Positives = 86/169 (50%), Gaps = 1/169 (0%)
 Frame = +2

Query: 179 YEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQ 358
           Y+F ++    + L   + ++ VNGK+PGP I A     + + V NH+   + + W G++ 
Sbjct: 30  YDFTLSYITASPLGVPQQVIAVNGKFPGPVINATTNYNVHVNVLNHLDEPLLLTWPGVQM 89

Query: 359 LRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKK 535
            R+ W DG    T CPI    ++ Y + +  Q G+ F+   +++ RA+   G +II  + 
Sbjct: 90  RRNSWQDG-VLGTNCPIPPNWNFTYDFQLKDQIGSYFYSPSLNFQRASGGFGALIINNRD 148

Query: 536 NVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
            V  PF +P  E+  I G+W+  +  A + + L +G    + D   ING
Sbjct: 149 LVPIPFTEPDGEIIFIIGDWYTQNHTA-LRRILDSGKELGMPDGVLING 196



>gb:AC093952_1736168 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1004_E02, complete
           sequence.>gb:AC118289_1739562 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBb0099O15,
           complete sequence.
          Length = 556

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 48/172 (27%), Positives = 85/172 (49%), Gaps = 1/172 (0%)
 Frame = +2

Query: 179 YEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQ 358
           +E+ VT    T L   + ++ +NG++PGP I     + +++ V N +   +   W+G++ 
Sbjct: 34  FEWKVTYGTKTLLDAPQKVILINGEFPGPRINCSSNNNIVVNVFNQLDEPLLFTWNGMQH 93

Query: 359 LRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKK 535
            ++ W DG A  TQCPI  G +Y YK+    Q G+ F+   +   RA   +G I ++ + 
Sbjct: 94  RKNSWQDGLAG-TQCPIAPGTNYTYKWQPKDQIGSFFYFPSLGMHRAAGGYGGISVVSRL 152

Query: 536 NVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGLPG 691
            +  PF  P  +  ++ G+W+  D  A +++ L  G          ING  G
Sbjct: 153 LIPVPFDPPADDHMVLIGDWYTKD-HAAMAKMLDAGKSFGRPHGVVINGKSG 203



>gb:OSJN00087_1694666 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0084K11, complete sequence.
          Length = 554

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 47/171 (27%), Positives = 87/171 (50%), Gaps = 1/171 (0%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGI 352
           R +++ VT  N+  L   +  + +NG++PGP I  +  D L++ V+N ++    + W+G+
Sbjct: 31  RFFDWEVTTGNINPLGVQQQGILINGQFPGPEIDCQTNDNLIVNVHNRLSEPFLLSWNGL 90

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILP 529
           +  ++ W DG +  T CPI  GQ++ Y+     Q G+ F+   +++ +A    G I I  
Sbjct: 91  QHRKNSWQDGVSG-TNCPIPPGQNFTYQMQAKDQIGSFFYFPSLAFHKAAGGFGAIRIRS 149

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
           +  +  PF  P  E  ++ G+W+    +A +   L +G      D   ING
Sbjct: 150 RPLIPVPFDPPAGEYTMLIGDWYKTSHKA-LQAMLDSGKQLPSPDGILING 199



>gb:NCB23B10_1689717 Neurospora crassa DNA linkage group II BAC
           contig B23B10.
          Length = 605

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 58/163 (35%), Positives = 80/163 (49%), Gaps = 10/163 (6%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHV-ANNISIHWHGIRQLRSGWADGPAYITQC 403
           K  + +NG YPGP I A  GDR+ + V N +  N  S+HWHG  QL S   DG A +T+C
Sbjct: 84  KGAMLINGGYPGPLIKADWGDRIEVTVTNKLKTNGTSMHWHGFHQLNSNNQDGVAGVTEC 143

Query: 404 PIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPYKEVPI 580
            I  G S VY + +  Q GT ++H+HIS   A  + GPI I      SYP+       PI
Sbjct: 144 LIVPGASKVYSF-LATQHGTSWYHSHISSQYANGIVGPIQI--NGPSSYPYDTDLGVFPI 200

Query: 581 IFGEWFNGDTEAIISQALQTG--------GGPNVSDAYTINGL 685
              +W+    E I+ + +           G P  S+    NG+
Sbjct: 201 --SDWYYDSAEHIVDRMMDPNDPFLKGVPGSPPPSNNILFNGM 241



>gb:AY147188_1583917 Pycnoporus cinnabarinus laccase (Lcc1) gene,
           complete cds.
          Length = 518

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 50/161 (31%), Positives = 82/161 (50%), Gaps = 7/161 (4%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPA 388
           ++  V VNG  P P I  ++GDR  + V +++ N+      SIHWHG  Q  + WADG +
Sbjct: 42  SREAVVVNGITPAPLIAGQKGDRFQLNVIDNLTNHTMLKTTSIHWHGFFQHGTNWADGVS 101

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKP 562
           ++ QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++  P    +  +   
Sbjct: 102 FVNQCPIASGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPQASLYDID 161

Query: 563 YKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
             +  I   +W++    A +      G     +DA  INGL
Sbjct: 162 NDDTVITLADWYH--VAAKLGPRFPLG-----ADATLINGL 195



>sp|O59896|LAC1_PYCCI Laccase precursor (EC 1.10.3.2)
           (Benzenediol:oxygen oxidoreductase) (Urishiol oxidase)
           (Ligninolytic phenoloxidase).>gb:AF025481_1762160
           Pycnoporus cinnabarinus laccase (lcc3-1) gene, complete
           cds.
          Length = 518

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 50/161 (31%), Positives = 82/161 (50%), Gaps = 7/161 (4%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPA 388
           ++  V VNG  P P I  ++GDR  + V +++ N+      SIHWHG  Q  + WADG +
Sbjct: 42  SREAVVVNGITPAPLIAGQKGDRFQLNVIDNLTNHTMLKTTSIHWHGFFQHGTNWADGVS 101

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKP 562
           ++ QCPI +G S++Y + +  Q GT ++H+H+S      L GP ++  P    +  +   
Sbjct: 102 FVNQCPIASGHSFLYDFQVPDQAGTFWYHSHLSTQYCDGLRGPFVVYDPNDPQASLYDID 161

Query: 563 YKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
             +  I   +W++    A +      G     +DA  INGL
Sbjct: 162 NDDTVITLADWYH--VAAKLGPRFPLG-----ADATLINGL 195



>sp|Q12541|LAC1_AGABI Laccase I precursor (EC 1.10.3.2)
           (Benzenediol:oxygen oxidoreductase) (Urishiol oxidase)
           (Diphenol oxidase).>gb:L10664_1683828 Agaricus bisporus
           laccase (lcc1), exons 1 through 15 and complete cds; and
           laccase (lcc2), partial cds.
          Length = 520

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 48/178 (26%), Positives = 91/178 (51%), Gaps = 7/178 (3%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-----NIS 334
           TR ++F++    +      +  V +NG++PG  I   +GD + I ++N + +     ++S
Sbjct: 21  TRTFDFDLVNTRLAPDGFERDTVVINGEFPGTLIQVNKGDSVRIPLHNKLTSPTMRRSVS 80

Query: 335 IHWHGIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHG 511
           IHWHG  Q R+   DGP+++ QCP     ++ Y++++  Q GT ++H+H+S      L G
Sbjct: 81  IHWHGFFQARTSGQDGPSFVNQCPQPPNTTFTYEFSVAEQSGTFWYHSHLSTQYCDGLRG 140

Query: 512 PIIIL-PKKNVSYPFVKPYKEVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
             I+  P+  + + +    +   I   EW++       ++   +G  P V D+  ING
Sbjct: 141 AFIVYDPRDPLRHLYDVDDESTVITLAEWYHILAPDATNEFFSSGIIP-VQDSGLING 197



>gb:AY875866_1631876 Coriolopsis gallica laccase (lacc333b) mRNA,
           partial cds.
          Length = 111

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 35/91 (38%), Positives = 56/91 (61%), Gaps = 5/91 (5%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWHGIRQLRSGWADGPA 388
           ++  + VN  +P P I   +GDR  + V +++ N+      SIHWHG  Q  + WADGPA
Sbjct: 21  SRQAILVNDVFPSPLITGNKGDRFQLNVIDNMTNHTMLKSTSIHWHGFFQHGTNWADGPA 80

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAH 481
           ++ QCPI TG +++Y + +  Q GT ++H+H
Sbjct: 81  FVNQCPISTGHAFLYDFQVPDQAGTFWYHSH 111



>gb:AY338763_1600499 Coprinopsis cinerea strain AmutBmut laccase 7
           (lcc7) gene, complete cds.
          Length = 549

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 48/164 (29%), Positives = 80/164 (48%), Gaps = 10/164 (6%)
 Frame = +2

Query: 224 TKSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWHGIRQLRSGWADGPA 388
           T+S V VNG +PGP ++  + D   I V N + +     + S+HWHG+ Q  + WADG  
Sbjct: 45  TRSAVVVNGVHPGPVLIGEKDDVFAINVVNELTDPTMLRSTSVHWHGLFQRGTNWADGAE 104

Query: 389 YITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILPKKNVSYPFVKPY 565
            + QCPI   +S++Y+++  G  GT ++H+H        L GP+++    +   P+   Y
Sbjct: 105 GVNQCPISPERSFLYRFSPAGHAGTFWYHSHFGTQYCDGLRGPMVVYDPDD---PYKNEY 161

Query: 566 K----EVPIIFGEWFNGDTEAIISQALQTGGGPNVSDAYTINGL 685
                   I   +W++    +I         GP   D+  ING+
Sbjct: 162 DVDDVNTIITLADWYHTPAPSI--------RGPFFPDSTLINGI 197



>gb:CR382134_1667250 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 653

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 50/123 (40%), Positives = 71/123 (57%), Gaps = 4/123 (3%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGIRQLRSGWADGPAYITQCP 406
           KS   +NG+ PGP I   EGD + I V N++  +I+IH+HGI Q  + W+DG   ITQ P
Sbjct: 56  KSNFLINGQSPGPIIEGDEGDWVNITVVNYLPVSITIHFHGILQKGTPWSDGVPGITQYP 115

Query: 407 IQTGQSYVYKYTIVGQRGTLFWHAHI-SWLRATLHGPIIILPKKNVSYPF---VKPYKEV 574
           I +G  Y Y + +  Q G  ++HAH   +L   L+GPI I P K    P+   VK  +E+
Sbjct: 116 ILSGDCYSYLFQLKDQYGFYWYHAHYRGYLTDGLYGPIYIKPNKARERPYDLIVKSKEEL 175

Query: 575 PII 583
            +I
Sbjct: 176 DLI 178



>gb:AY875865_1631875 Coriolopsis gallica laccase (lacc333a) mRNA,
           partial cds.
          Length = 111

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 36/105 (34%), Positives = 61/105 (58%), Gaps = 5/105 (4%)
 Frame = +2

Query: 182 EFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNI-----SIHWH 346
           +  ++  N++    T++ V  N ++PGP I   +GD   + V +++ N+      +IHWH
Sbjct: 7   DLTISNANISPDGFTRAAVVANNQFPGPLITGNKGDTFQLNVIDNLTNDTMLTATTIHWH 66

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAH 481
           G  Q  + WADGPA++ Q PI  G S++Y +   GQ GT ++H+H
Sbjct: 67  GFFQKGTNWADGPAFVNQSPISEGNSFLYDFAAPGQAGTFWYHSH 111



>gb:AY676424_1621955 Lentinula edodes laccase 1 CVT (LAC1) mRNA,
           complete cds, alternatively spliced.
          Length = 445

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 45/152 (29%), Positives = 82/152 (53%), Gaps = 7/152 (4%)
 Frame = +2

Query: 248 GKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWHGIRQLRSGWADGPAYITQCPIQ 412
           G +PGP I   +G R  + V + + +     + ++HWHG+ Q  + +ADG A+++QCPI 
Sbjct: 62  GSFPGPLISGNKGVRFNLNVTDQLTDPSMVRSTTVHWHGLFQKTTNYADGVAFVSQCPIA 121

Query: 413 TGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKPYKEVPIIF 586
              S++Y + +  Q GT ++H+HIS      L GP++I  P+   +Y +    +   +  
Sbjct: 122 ANHSFLYDFQVPDQAGTFWYHSHISVQYCDGLRGPLVIYDPQDPQAYLYDVDDETTVLTI 181

Query: 587 GEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
            +WF+  +  +I+ A+       ++DA  ING
Sbjct: 182 ADWFHNTSTELIAAAVAP-----LADATLING 208



>pir|T05670|T05670 pollen-specific protein homolog F22I13.190 -
           Arabidopsis thaliana>gb:ATCHRIV89_1547796 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           89.>gb:ATF22I13_1549655 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F22I13 (ESSA project).
          Length = 548

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 43/150 (28%), Positives = 79/150 (52%), Gaps = 1/150 (0%)
 Frame = +2

Query: 173 RHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHVANNISIHWHGI 352
           R +++ VT  N++ L   +  + +NG+YPGP I +   D L+I V+N +     + W+G+
Sbjct: 30  RFFDWRVTYGNISPLGIPQRGILINGQYPGPDIYSVTNDNLIINVHNDLDEPFLLSWNGV 89

Query: 353 RQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIILP 529
           +  ++ + DG  Y T CPI  G++Y Y   +  Q G+ F+   ++  +A    G   IL 
Sbjct: 90  QLRKNSYQDG-VYGTTCPIPPGKNYTYAIQVKDQIGSFFYFPSLAVHKAAGGFGGFRILS 148

Query: 530 KKNVSYPFVKPYKEVPIIFGEWFNGDTEAI 619
           +  +  PF +P  +   + G+WF  D + +
Sbjct: 149 RPRIPVPFPEPAGDFTFLIGDWFKHDHKVL 178



>gb:AY676425_1621956 Lentinula edodes laccase 1 DVT (LAC1) mRNA,
           complete cds, alternatively spliced.
          Length = 494

 Score = 83.6 bits (205), Expect = 3e-15
 Identities = 45/152 (29%), Positives = 82/152 (53%), Gaps = 7/152 (4%)
 Frame = +2

Query: 248 GKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWHGIRQLRSGWADGPAYITQCPIQ 412
           G +PGP I   +G R  + V + + +     + ++HWHG+ Q  + +ADG A+++QCPI 
Sbjct: 62  GSFPGPLISGNKGVRFNLNVTDQLTDPSMVRSTTVHWHGLFQKTTNYADGVAFVSQCPIA 121

Query: 413 TGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKPYKEVPIIF 586
              S++Y + +  Q GT ++H+HIS      L GP++I  P+   +Y +    +   +  
Sbjct: 122 ANHSFLYDFQVPDQAGTFWYHSHISVQYCDGLRGPLVIYDPQDPQAYLYDVDDETTVLTI 181

Query: 587 GEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
            +WF+  +  +I+ A+       ++DA  ING
Sbjct: 182 ADWFHNTSTELIAAAVVP-----LADATLING 208



>gb:BT003483_1356885 Drosophila melanogaster RE55660 full insert
           cDNA.
          Length = 733

 Score = 83.2 bits (204), Expect = 4e-15
 Identities = 41/101 (40%), Positives = 61/101 (60%), Gaps = 2/101 (1%)
 Frame = +2

Query: 227 KSIVTVNGKYPGPPILAREGDRLLIKVNNHVAN-NISIHWHGIRQLRSGWADGPAYITQC 403
           + I+T N   PGP I   E D+++I V NH+    ++IHW GI Q  S + DG  ++TQC
Sbjct: 183 RGILTANRMIPGPSIQVCENDKVVIDVENHMEGMEVTIHWRGIWQRGSQYYDGVPFVTQC 242

Query: 404 PIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           PIQ G ++ Y++T  G  GT FWHAH    +   L+G +++
Sbjct: 243 PIQQGNTFRYQWT--GNAGTHFWHAHTGLQKLDGLYGSVVV 281



>gb:GGR437319_1680005 Gaeumannomyces graminis var. graminis lac1
           gene for laccase, exons 1-3.
          Length = 607

 Score = 82.8 bits (203), Expect = 5e-15
 Identities = 50/128 (39%), Positives = 67/128 (52%), Gaps = 2/128 (1%)
 Frame = +2

Query: 170 TRHYEFNVTMQNVTRLCHTKSIVTVNGKYPGPPILAREGDRLLIKVNNHV-ANNISIHWH 346
           TR Y  +V         + +   T NG +PGP I A  GD L+I V N++  N  SIHWH
Sbjct: 77  TREYWLSVEEGICNNDGYKRYCQTFNGSFPGPLIWANWGDNLVIHVTNNMKTNGTSIHWH 136

Query: 347 GIRQLRSGWADGPAYITQCPIQTGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIII 523
           G+ Q  S   DG   +TQCPI  G+S  YK+ +  Q GT ++H+H S   A  L GP+I 
Sbjct: 137 GLHQRGSVEYDGVPGVTQCPIAPGKSLTYKFRVT-QYGTTWYHSHFSLQYAEGLFGPMIF 195

Query: 524 LPKKNVSY 547
                 +Y
Sbjct: 196 YGPTTANY 203



>gb:AY676423_1621954 Lentinula edodes laccase 1 BVT (LAC1) mRNA,
           complete cds, alternatively spliced.
          Length = 533

 Score = 82.8 bits (203), Expect = 5e-15
 Identities = 45/152 (29%), Positives = 81/152 (53%), Gaps = 7/152 (4%)
 Frame = +2

Query: 248 GKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWHGIRQLRSGWADGPAYITQCPIQ 412
           G +PGP I   +G R  + V + + +     + ++HWHG+ Q  + +ADG A+++QCPI 
Sbjct: 62  GSFPGPLISGNKGVRFNLNVTDQLTDPSMVRSTTVHWHGLFQKTTNYADGVAFVSQCPIA 121

Query: 413 TGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKPYKEVPIIF 586
              S++Y + +  Q GT ++H+HIS      L GP++I  P+   +Y +    +   +  
Sbjct: 122 ANHSFLYDFQVPDQAGTFWYHSHISVQYCDGLRGPLVIYDPQDPQAYLYDVDDETTVLTI 181

Query: 587 GEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
            +WF+  +  +I+ A+        +DA  ING
Sbjct: 182 ADWFHNTSTELIAAAVAP-----PADATLING 208



>gb:AY676422_1621953 Lentinula edodes laccase 1 AVT (LAC1) mRNA,
           complete cds, alternatively spliced.
          Length = 533

 Score = 82.8 bits (203), Expect = 5e-15
 Identities = 45/152 (29%), Positives = 81/152 (53%), Gaps = 7/152 (4%)
 Frame = +2

Query: 248 GKYPGPPILAREGDRLLIKVNNHVAN-----NISIHWHGIRQLRSGWADGPAYITQCPIQ 412
           G +PGP I   +G R  + V + + +     + ++HWHG+ Q  + +ADG A+++QCPI 
Sbjct: 62  GSFPGPLISGNKGVRFNLNVTDQLTDPSMVRSTTVHWHGLFQKTTNYADGVAFVSQCPIA 121

Query: 413 TGQSYVYKYTIVGQRGTLFWHAHISWLRAT-LHGPIIIL-PKKNVSYPFVKPYKEVPIIF 586
              S++Y + +  Q GT ++H+HIS      L GP++I  P+   +Y +        +  
Sbjct: 122 ANHSFLYDFQVPDQAGTFWYHSHISVQYCDGLRGPLVIYDPQDPQAYLYDVDDGTTVLTI 181

Query: 587 GEWFNGDTEAIISQALQTGGGPNVSDAYTING 682
            +WF+  +  +I+ A+       ++DA  ING
Sbjct: 182 ADWFHNTSTELIAAAVAP-----LADATLING 208


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 799,429,505
Number of Sequences: 1806583
Number of extensions: 17790747
Number of successful extensions: 44663
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 42963
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 44354
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 39798953635
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)