BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig5714
         (813 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:BT015363_1642191 Arabidopsis thaliana At1g33360 gene, complet...   109   5e-23   
gb:AC027035_1539803 Arabidopsis thaliana chromosome 1 BAC T16O9 ...   109   5e-23   
pir|D86457|D86457 hypothetical protein F10C21.5 - Arabidopsis th...   109   5e-23   Arabidopsis thaliana [mouse-ear cress]
gb:AP004865_1846223 Oryza sativa (japonica cultivar-group) genom...   100   6e-20   
gb:AB025612_1516358 Arabidopsis thaliana genomic DNA, chromosome...    77   5e-13   
gb:AJ749949_530930 Francisella tularensis subsp. tularensis comp...    36   0.99    
gb:BX294142_768050 Pirellula sp. strain 1 complete genome; segme...    33   4.9     
gb:AY458641_619570 Uncultured bacterium 463 clone EBAC080-L32B05...    33   4.9     
gb:AP002061_1821784 Arabidopsis thaliana genomic DNA, chromosome...    33   8.4     


>gb:BT015363_1642191 Arabidopsis thaliana At1g33360 gene, complete
           cds.>gb:BT015893_1642511 Arabidopsis thaliana At1g33360
           gene, complete cds.
          Length = 656

 Score =  109 bits (273), Expect = 5e-23
 Identities = 70/195 (35%), Positives = 94/195 (48%), Gaps = 26/195 (13%)
 Frame = +2

Query: 305 VQARYKWDRGGSSD---------ETRRIRAEVNCPRCSKHMDLLFTNRH---PHLIPAPP 448
           +Q R+K ++GG              R++RAE NCPRCSK MDLLF+NR     +L+  P 
Sbjct: 39  IQERFKSEQGGGGGGGDDFPVPVTRRKLRAEPNCPRCSKQMDLLFSNRQFPSSNLLQRPD 98

Query: 449 -SDSNSACDSNNGKNASVLASSVAVXXXXXXXXXXXXXXXXXXKPGGPYHAVNICPNCKT 625
            SDS+ A D  N                                    + +VN CP CKT
Sbjct: 99  DSDSSGAGDKTN------------------------------------FQSVNFCPTCKT 122

Query: 626 GYYFRPYKMAPLQGSFFEIGRVK------TNVTGKNSDKKMSEEEE-------YGKRLKS 766
            Y F P  ++PLQG+F EIGRV+      TN T   S +K  +  +       Y  +L+S
Sbjct: 123 AYGFNPRGVSPLQGTFIEIGRVQSPTTTTTNATTSKSTRKQQQHSKDPNQGFNYRNKLRS 182

Query: 767 SFWETLQIYGSEPPE 811
           SFW+TL+ YG+EPPE
Sbjct: 183 SFWDTLRSYGAEPPE 197



>gb:AC027035_1539803 Arabidopsis thaliana chromosome 1 BAC T16O9
           genomic sequence, complete sequence.
          Length = 650

 Score =  109 bits (273), Expect = 5e-23
 Identities = 70/195 (35%), Positives = 94/195 (48%), Gaps = 26/195 (13%)
 Frame = +2

Query: 305 VQARYKWDRGGSSD---------ETRRIRAEVNCPRCSKHMDLLFTNRH---PHLIPAPP 448
           +Q R+K ++GG              R++RAE NCPRCSK MDLLF+NR     +L+  P 
Sbjct: 39  IQERFKSEQGGGGGGGDDFPVPVTRRKLRAEPNCPRCSKQMDLLFSNRQFPSSNLLQRPD 98

Query: 449 -SDSNSACDSNNGKNASVLASSVAVXXXXXXXXXXXXXXXXXXKPGGPYHAVNICPNCKT 625
            SDS+ A D  N                                    + +VN CP CKT
Sbjct: 99  DSDSSGAGDKTN------------------------------------FQSVNFCPTCKT 122

Query: 626 GYYFRPYKMAPLQGSFFEIGRVK------TNVTGKNSDKKMSEEEE-------YGKRLKS 766
            Y F P  ++PLQG+F EIGRV+      TN T   S +K  +  +       Y  +L+S
Sbjct: 123 AYGFNPRGVSPLQGTFIEIGRVQSPTTTTTNATTSKSTRKQQQHSKDPNQGFNYRNKLRS 182

Query: 767 SFWETLQIYGSEPPE 811
           SFW+TL+ YG+EPPE
Sbjct: 183 SFWDTLRSYGAEPPE 197



>pir|D86457|D86457 hypothetical protein F10C21.5 - Arabidopsis
           thaliana>gb:AE005172_892152 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC051630_1540090 Arabidopsis thaliana
           chromosome 1 BAC F10C21 genomic sequence, complete
           sequence.
          Length = 670

 Score =  109 bits (273), Expect = 5e-23
 Identities = 70/195 (35%), Positives = 94/195 (48%), Gaps = 26/195 (13%)
 Frame = +2

Query: 305 VQARYKWDRGGSSD---------ETRRIRAEVNCPRCSKHMDLLFTNRH---PHLIPAPP 448
           +Q R+K ++GG              R++RAE NCPRCSK MDLLF+NR     +L+  P 
Sbjct: 39  IQERFKSEQGGGGGGGDDFPVPVTRRKLRAEPNCPRCSKQMDLLFSNRQFPSSNLLQRPD 98

Query: 449 -SDSNSACDSNNGKNASVLASSVAVXXXXXXXXXXXXXXXXXXKPGGPYHAVNICPNCKT 625
            SDS+ A D  N                                    + +VN CP CKT
Sbjct: 99  DSDSSGAGDKTN------------------------------------FQSVNFCPTCKT 122

Query: 626 GYYFRPYKMAPLQGSFFEIGRVK------TNVTGKNSDKKMSEEEE-------YGKRLKS 766
            Y F P  ++PLQG+F EIGRV+      TN T   S +K  +  +       Y  +L+S
Sbjct: 123 AYGFNPRGVSPLQGTFIEIGRVQSPTTTTTNATTSKSTRKQQQHSKDPNQGFNYRNKLRS 182

Query: 767 SFWETLQIYGSEPPE 811
           SFW+TL+ YG+EPPE
Sbjct: 183 SFWDTLRSYGAEPPE 197



>gb:AP004865_1846223 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0020C11.
          Length = 666

 Score = 99.8 bits (247), Expect = 6e-20
 Identities = 62/168 (36%), Positives = 85/168 (50%), Gaps = 7/168 (4%)
 Frame = +2

Query: 305 VQARYKWDRGGSSD-------ETRRIRAEVNCPRCSKHMDLLFTNRHPHLIPAPPSDSNS 463
           VQ R KW+   SS        E RRIRAE +CPRCSKHMD+LF++R      APPS S +
Sbjct: 39  VQERRKWEGPTSSSSSSSDEHEPRRIRAEAHCPRCSKHMDILFSHR------APPSSSAA 92

Query: 464 ACDSNNGKNASVLASSVAVXXXXXXXXXXXXXXXXXXKPGGPYHAVNICPNCKTGYYFRP 643
           A     G  A                             GG Y A+N+CPNC++ Y+FRP
Sbjct: 93  A-----GAGAG----------------------------GGGYQALNLCPNCRSAYFFRP 119

Query: 644 YKMAPLQGSFFEIGRVKTNVTGKNSDKKMSEEEEYGKRLKSSFWETLQ 787
           + +APLQG+F EIGRV+ ++   ++ +             +SFWE ++
Sbjct: 120 HLLAPLQGTFVEIGRVRADLLPHDAVRARG----------ASFWEAIR 157



>gb:AB025612_1516358 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K21G20.
          Length = 608

 Score = 76.6 bits (187), Expect = 5e-13
 Identities = 42/121 (34%), Positives = 54/121 (44%)
 Frame = +2

Query: 332 GGSSDETRRIRAEVNCPRCSKHMDLLFTNRHPHLIPAPPSDSNSACDSNNGKNASVLASS 511
           GG  D+   IR++VNCPRCS  M ++F+NR   L    P                     
Sbjct: 68  GGGGDDYDHIRSDVNCPRCSAQMHVIFSNRPLSLTAREP--------------------- 106

Query: 512 VAVXXXXXXXXXXXXXXXXXXKPGGPYHAVNICPNCKTGYYFRPYKMAPLQGSFFEIGRV 691
                                   G Y AVN C  CKT +YFRP+K++PLQGSF E+G+V
Sbjct: 107 ------------------------GIYQAVNFCSQCKTAFYFRPFKLSPLQGSFIELGKV 142

Query: 692 K 694
           K
Sbjct: 143 K 143



>gb:AJ749949_530930 Francisella tularensis subsp. tularensis
           complete genome.
          Length = 451

 Score = 35.8 bits (81), Expect = 0.99
 Identities = 19/53 (35%), Positives = 28/53 (52%)
 Frame = +1

Query: 64  YFRSIGSECFPGGGF*IGSRDVRDMEMEEAERGGGYNCL*KAEDGGAGGGSSV 222
           Y +  G  C PG G  +GS + +++E+ E     GY  + KA  GG G G S+
Sbjct: 122 YMKKAGVPCVPGSGGPLGSDEKKNLEIAEKI---GYPVIIKAAGGGGGRGMSI 171



>gb:BX294142_768050 Pirellula sp. strain 1 complete genome; segment
           10/24.
          Length = 374

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 14/37 (37%), Positives = 24/37 (64%)
 Frame = -1

Query: 138 HIPDISTPDSKTTAWKAFTSYRPEIREIGSTSRNQPF 28
           ++PD++T  +KT+AW+A        R I  T+++QPF
Sbjct: 295 NVPDMATDCTKTSAWEATIDTCGTYRSINHTNKSQPF 331



>gb:AY458641_619570 Uncultured bacterium 463 clone EBAC080-L32B05
           genomic sequence.
          Length = 312

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 13/45 (28%), Positives = 27/45 (60%)
 Frame = +2

Query: 284 RRESVIGVQARYKWDRGGSSDETRRIRAEVNCPRCSKHMDLLFTN 418
           + ES + ++   +WD+   +D    +R +V  P+ SK +DL+F++
Sbjct: 51  KAESFLRLEFENEWDQDDGNDFGATVRGKVQLPKLSKRLDLVFSD 95



>gb:AP002061_1821784 Arabidopsis thaliana genomic DNA, chromosome 3,
           BAC clone: T21E2.
          Length = 881

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 17/53 (32%), Positives = 25/53 (47%)
 Frame = +2

Query: 332 GGSSDETRRIRAEVNCPRCSKHMDLLFTNRHPHLIPAPPSDSNSACDSNNGKN 490
           GGSSDE  R R E    +C     +L  N+    +  PP+ ++ A D    K+
Sbjct: 164 GGSSDEEGRNRDEAEVLKCGSKKPMLSRNKTKSRLQDPPTPTHPAIDKTEMKS 216


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 791,839,279
Number of Sequences: 1806583
Number of extensions: 15436181
Number of successful extensions: 48307
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 46184
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 48265
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 53504197652
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)