BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig5702
         (1402 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY456411_1607186 Lycopersicon esculentum ribosomal protein L3...   717   0.0     
gb:AY395738_1604827 Nicotiana tabacum ribosomal protein L3A (RPL...   716   0.0     
gb:AY395739_1604828 Nicotiana tabacum ribosomal protein L3B (RPL...   689   0.0     
pir|S38359|S38359 ribosomal protein L3.e, cytosolic - rice>gb:RI...   676   0.0     Oryza sativa Japonica Group [Japonica rice]
gb:AY347532_1601389 Triticum aestivum cultivar Falat ribosomal p...   676   0.0     
gb:AY343327_1600856 Triticum aestivum ribosomal protein L3 (RPL3...   676   0.0     
gb:MSA248327_1687018 Medicago sativa subsp. X varia mRNA for L3 ...   674   0.0     
gb:AY343328_1600857 Triticum aestivum ribosomal protein L3 (RPL3...   674   0.0     
sp|P35684|RL3_ORYSA|RL3_ORYSA 60S ribosomal protein L3.                         674   0.0     Oryza sativa [red rice]
pir|E96498|E96498 L3 cytoplasmic ribosomal protein [imported] - ...   669   0.0     Arabidopsis thaliana [mouse-ear cress]
gb:BT000756_1635028 Arabidopsis thaliana clone RAFL09-59-D03 (R1...   667   0.0     
sp|P17094|RL3A_ARATH|RL3A_ARATH 60S ribosomal protein L3.                        667   0.0     Arabidopsis thaliana [mouse-ear cress]
pir|JQ0771|JQ0771 ribosomal protein L3.e (clone ARP1), cytosolic...   662   0.0     Arabidopsis thaliana [mouse-ear cress]
pir|B96641|B96641 60s ribosomal protein L3 [imported] - Arabidop...   662   0.0     Arabidopsis thaliana [mouse-ear cress]
pir|JQ0772|JQ0772 ribosomal protein L3.e (clone ARP2), cytosolic...   661   0.0     Arabidopsis thaliana [mouse-ear cress]
sp|P22738|RL3B_ARATH|RL3B_ARATH 60S ribosomal protein L3.                        660   0.0     Arabidopsis thaliana [mouse-ear cress]
gb:AY236158_1592018 Oryza sativa (indica cultivar-group) ribosom...   587   e-166   
pir|S25592|S25592 ribosomal protein L3.e, cytosolic - fission ye...   516   e-145   Schizosaccharomyces pombe
gb:AY072287_1295908 Spodoptera frugiperda ribosomal protein L3 m...   516   e-145   
pir|T37818|T37818 60s ribosomal protein L3 - fission yeast  (Sch...   516   e-145   Schizosaccharomyces pombe
gb:AE017351_1759487 Cryptococcus neoformans var. neoformans JEC2...   516   e-145   
gb:BTA238851_1436533 Bos taurus rpl3 gene for ribosomal protein ...   514   e-144   
sp|P36584|RL3B_SCHPO|RL3B_SCHPO 60S ribosomal protein L3-B.                      514   e-144   Schizosaccharomyces pombe
gb:MMJ1PRO_2116175 Murine mRNA for J1 protein, yeast ribosomal p...   514   e-144   
sp|P40372|RL3A_SCHPO|RL3A_SCHPO 60S ribosomal protein L3-A.                      514   e-144   Schizosaccharomyces pombe
gb:AJ720292_2502479 Gallus gallus mRNA for hypothetical protein,...   514   e-144   
pir|S50221|S50221 ribosomal protein L3, cytosolic - bovine>gb:BT...   513   e-144   Bos taurus [bovine]
gb:AY769270_1350421 Bombyx mori ribosomal protein L3 (RpL3) mRNA...   513   e-144   
gb:AK088993_1175742 Mus musculus 2 days neonate thymus thymic ce...   513   e-144   
gb:BC042242_2548064 Xenopus laevis ribosomal protein L3, mRNA (c...   512   e-144   
sp|P27659|RL3_MOUSE|RL3_MOUSE 60S ribosomal protein L3 (J1 protein).            512   e-144   Mus musculus [mouse]
pir|JQ1536|R5RT3L ribosomal protein L3, cytosolic [validated] - ...   512   e-144   
pir|S34195|S34195 ribosomal protein L3, cytosolic - human>gb:AB0...   511   e-143   Homo sapiens [man]
sp|P39872|RL3_BOVIN|RL3_BOVIN 60S ribosomal protein L3.                         511   e-143   Bos taurus [bovine]
gb:BC008492_1971416 Homo sapiens ribosomal protein L3, mRNA (cDN...   511   e-143   
pir|JC4382|JC4382 ribosomal protein L3.e, cytosolic - Toxocara c...   510   e-143   Toxocara canis
sp|P21531|RL3_RAT|RL3_RAT 60S ribosomal protein L3 (L4).                      510   e-143   Rattus norvegicus [brown rat]
sp|P39023|RL3_HUMAN|RL3_HUMAN 60S ribosomal protein L3 (HIV-1 TAR RNA bind...   509   e-143   Homo sapiens [man]
sp|P49149|RL3_TOXCA|RL3_TOXCA 60S ribosomal protein L3.                         508   e-142   Toxocara canis
gb:AE016817_1747590 Ashbya gossypii (= Eremothecium gossypii) AT...   508   e-142   
gb:AF464911_1802027 Aspergillus fumigatus large subunit ribosoma...   503   e-141   
gb:AF526241_1279330 Chlamys farreri clone iolscfcl1ct2cn2 riboso...   503   e-141   
gb:BC080121_2561553 Xenopus laevis MGC84749 protein, mRNA (cDNA ...   502   e-141   
gb:HUMRRL3A_2036426 Human ribosomal protein L3 mRNA, 3' end.          501   e-140   
gb:BT011339_1357821 Drosophila melanogaster RH62603 full insert ...   501   e-140   
sp|P50880|RL3_CAEEL|RL3_CAEEL 60S ribosomal protein L3.>pir|T19771|T19771 ...   501   e-140   Caenorhabditis elegans [roundworm]
gb:AF401554_2491981 Ictalurus punctatus ribosomal protein L3 mRN...   500   e-140   
gb:AE014297_1138962 Drosophila melanogaster chromosome 3R, compl...   499   e-140   
sp|P59671|RL3_NEUCR|RL3_NEUCR 60S ribosomal protein L3.>gb:NCB17B1_1689408...   498   e-140   
gb:AF198447_1776429 Emericella nidulans 60S ribosomal protein L3...   498   e-139   
gb:CR380953_1650705 Candida glabrata strain CBS138 chromosome G ...   497   e-139   
gb:CR382134_1667020 Debaryomyces hansenii chromosome B of strain...   497   e-139   
sp|O16797|RL3_DROME|RL3_DROME 60S ribosomal protein L3.                         497   e-139   Drosophila melanogaster
gb:CR382126_1659086 Kluyveromyces lactis strain NRRL Y-1140 chro...   496   e-139   
gb:BC082692_2562836 Xenopus laevis hypothetical LOC494722, mRNA ...   495   e-138   
gb:AY561514_2537704 Danio rerio ribosomal protein L3 (rpl3) mRNA...   494   e-138   
gb:CR382129_1662172 Yarrowia lipolytica chromosome C of strain C...   494   e-138   
gb:AY223152_1176616 Schistosoma japonicum clone ZZD1512 mRNA seq...   493   e-138   
pir|S66946|R5BY4E ribosomal protein L3.e, cytosolic - yeast (Sac...   492   e-138   
pir|JC4254|JC4254 ribosomal protein L3.e, cytosolic - slime mold...   491   e-137   Dictyostelium discoideum
sp|P14126|RL3_YEAST|RL3_YEAST 60S ribosomal protein L3 (YL1) (RP1) (Tricho...   490   e-137   Saccharomyces cerevisiae [brewer's yeast]
sp|P34113|RL3_DICDI|RL3_DICDI 60S ribosomal protein L3.                         489   e-137   Dictyostelium discoideum
gb:YSCRP13_1730487 S.cerevisiae ribosomal protein L3 (tcm1) gene.     487   e-136   
gb:AE014185_937848 Plasmodium falciparum 3D7 chromosome 10 compl...   476   e-133   
gb:AE014297_1138964 Drosophila melanogaster chromosome 3R, compl...   475   e-133   
gb:BC050413_1984326 Homo sapiens ribosomal protein L3-like, mRNA...   472   e-132   
gb:TTH012585_1401136 Tetrahymena thermophila macronuclear gene e...   470   e-131   
sp|Q92901|RL3L_HUMAN|RL3L_HUMAN 60S ribosomal protein L3-like.>gb:AE006640_...   470   e-131   Homo sapiens [man]
gb:BC022790_1977977 Homo sapiens, clone IMAGE:3538792, mRNA, par...   460   e-128   
gb:AF225211_1252646 Trypanoplasma borreli ribosomal protein L3, ...   457   e-127   
gb:AB008848_1510560 Cucumis sativus Csf-3 mRNA, complete cds.         427   e-118   
gb:CEC36A4_1361032 Caenorhabditis elegans cosmid C36A4, complete...   426   e-118   
gb:AY389725_1178336 Hyacinthus orientalis ribosomal protein L3 m...   416   e-115   
gb:HSA238852_2000762 Homo sapiens partial rpl3 gene for ribosoma...   414   e-114   
pir|D90134|D90134 60S ribosomal protein L3 [imported] - Guillard...   413   e-114   Guillardia theta
gb:AF346004_1789932 Lolium perenne L3 ribosomal protein mRNA, pa...   408   e-112   
gb:HUMTAPR_2036827 Homo sapiens HIV-1 TAR RNA binding protein (T...   384   e-105   
gb:CNS07EGA_1373031 chromosome III of strain GB-M1 of Encephalit...   378   e-103   
gb:BC004323_1969175 Homo sapiens ribosomal protein L3, mRNA (cDN...   330   4e-89   
gb:AY829782_1180181 Lonomia obliqua ribosomal protein 24 mRNA, p...   319   8e-86   
gb:CEC36A4_1361031 Caenorhabditis elegans cosmid C36A4, complete...   318   1e-85   
sp|Q9NBK4|RL3_CAEBR|RL3_CAEBR 60S ribosomal protein L3 (Fragment).>gb:AF24...   305   2e-81   Caenorhabditis briggsae
gb:AF526233_1279329 Argopecten irradians isolate iolsaicl555ct59...   302   1e-80   
gb:BC085243_2109126 Mus musculus ribosomal protein L3-like, mRNA...   299   1e-79   
gb:AK002393_1151169 Mus musculus adult male kidney cDNA, RIKEN f...   281   2e-74   
gb:CR926481_1185638 Pongo pygmaeus mRNA; cDNA DKFZp468G0827 (fro...   258   2e-67   
gb:AX885973_1481426 Sequence 1836 from Patent EP1033401.              219   1e-55   
sp|O28354|RL3_ARCFU|RL3_ARCFU 50S ribosomal protein L3P.>pir|D69490|D69490...   218   2e-55   Archaeoglobus fulgidus
sp|Q9UWG2|RL3_METVA|RL3_METVA 50S ribosomal protein L3P.                        217   5e-55   Methanococcus vannielii
sp|P54014|RL3_METJA|RL3_METJA 50S ribosomal protein L3P.>pir|A64322|A64322...   216   1e-54   Methanocaldococcus jannaschii
gb:AB024901_1194294 Bombyx mori RPL3 mRNA for ribosomal protein ...   215   2e-54   
gb:BX957223_844796 Methanococcus maripaludis S2 complete genome;...   214   4e-54   
gb:AP006878_576694 Thermococcus kodakaraensis strain KOD1 DNA, c...   211   2e-53   
sp|Q8TY90|RL3_METKA|RL3_METKA 50S ribosomal protein L3P.>gb:AE010337_26204...   210   5e-53   Methanopyrus kandleri
sp|Q8TZZ8|RL3_PYRFU|RL3_PYRFU 50S ribosomal protein L3P.>gb:AE010278_26139...   209   1e-52   Pyrococcus furiosus
sp|O26110|RL3_METTH|RL3_METTH 50S ribosomal protein L3P.>pir|C69124|C69124...   209   1e-52   Methanothermobacter thermautotrophicus
sp|Q9V1T5|RL3_PYRAB|RL3_PYRAB 50S ribosomal protein L3P.>pir|A75148|A75148...   206   9e-52   Pyrococcus abyssi
sp|O59418|RL3_PYRHO|RL3_PYRHO 50S ribosomal protein L3P.>pir|H71187|H71187...   206   1e-51   Pyrococcus horikoshii
gb:AY534910_626197 Uncultured marine group II euryarchaeote Deep...   202   2e-50   
sp|Q8ZW52|RL3_PYRAE|RL3_PYRAE 50S ribosomal protein L3P.>gb:AE009850_25647...   198   3e-49   Pyrobaculum aerophilum
gb:AE014297_1138963 Drosophila melanogaster chromosome 3R, compl...   197   3e-49   
sp|Q9YFM2|RL3_AERPE|RL3_AERPE 50S ribosomal protein L3P.>pir|A72780|A72780...   196   1e-48   Aeropyrum pernix
sp|Q9HPD4|RL3_HALN1|RL3_HALN1 50S ribosomal protein L3P.>pir|D84321|D84321...   194   4e-48   Halobacterium sp.
sp|Q975I1|RL3_SULTO|RL3_SULTO 50S ribosomal protein L3P.>gb:BA000023_69100...   193   6e-48   Sulfurisphaera tokodaii
gb:AY383698_1178121 Rattus norvegicus LRRGT00043 mRNA, complete ...   188   2e-47   
gb:AJ606030_1811944 Triticum aestivum partial mRNA for putative ...   188   3e-46   
gb:AE017261_419657 Picrophilus torridus DSM 9790, complete genome.    185   2e-45   
sp|Q8TRU7|RL3_METAC|RL3_METAC 50S ribosomal protein L3P.>gb:AE010775_26643...   185   2e-45   Methanosarcina acetivorans
gb:AY596297_632992 Haloarcula marismortui ATCC 43049 chromosome ...   184   5e-45   
pir|C35063|R5HS3L ribosomal protein L3 [similarity] - Haloarcula...   184   5e-45   
pir|T43816|T43816 ribosomal protein L3.eR [similarity] - Halobac...   183   6e-45   Halobacterium salinarum
sp|Q06844|RL3_HALSA|RL3_HALSA 50S ribosomal protein L3P.                        183   6e-45   Halobacterium salinarum
sp|P20279|RL3_HALMA|RL3_HALMA 50S ribosomal protein L3P (Hmal3) (Hl1).          183   8e-45   Haloarcula marismortui
sp|Q8PV50|RL3_METMA|RL3_METMA 50S ribosomal protein L3P.>gb:AE013454_29245...   182   2e-44   Methanosarcina mazei
sp|Q9UXA8|RL3_SULSO|RL3_SULSO 50S ribosomal protein L3P.>pir|C90220|C90220...   181   4e-44   Saccharolobus solfataricus
gb:MMU89417_2123888 Mus musculus strain BALB/c ribosomal protein...   176   1e-42   
sp|Q29293|RL3_PIG|RL3_PIG 60S ribosomal protein L3 (Fragment).                171   4e-41   Sus scrofa [pigs]
gb:AE014297_1138966 Drosophila melanogaster chromosome 3R, compl...   170   7e-41   
gb:AX885972_1481425 Sequence 1835 from Patent EP1033401.              168   2e-40   
sp|P60458|RL3_NANEQ|RL3_NANEQ 50S ribosomal protein L3P.>gb:AE017199_40325...   167   4e-40   Nanoarchaeum equitans
sp|Q97BX7|RL3_THEVO|RL3_THEVO 50S ribosomal protein L3P.>gb:BA000011_66477...   166   1e-39   Thermoplasma volcanium
gb:AY158026_2516026 Fundulus heteroclitus ribosomal protein L3 m...   164   5e-39   
sp|Q9HIQ9|RL3_THEAC|RL3_THEAC 50S ribosomal protein L3P.>gb:TACID5_197025 ...   163   7e-39   Thermoplasma acidophilum
gb:AF051237_1764226 Picea mariana 60S ribosomal protein L3 (Sb51...   156   1e-36   
gb:AB099068_1410391 Bos taurus mRNA for similar to ribosomal pro...   119   2e-25   
gb:AB007166_1863932 Homo sapiens gene for ribosomal protein L3, ...    90   1e-16   
gb:AB098822_1410191 Bos taurus mRNA for similar to ribosomal pro...    86   2e-15   
gb:AF247852_1255293 Caenorhabditis remanei ribosomal protein L3 ...    79   3e-13   
gb:AF227523_2059934 Mus musculus ribosomal protein L3 (Rp13) gen...    74   9e-12   
gb:AF127447_1770539 Picea abies 60S ribosomal protein L3 (Sb51) ...    64   6e-09   
sp|Q890N9|RL3_CLOTE|RL3_CLOTE 50S ribosomal protein L3.>gb:AE015945_321618...    56   2e-06   Clostridium tetani
sp|Q97EH8|RL3_CLOAB|RL3_CLOAB 50S ribosomal protein L3.>pir|E97285|E97285 ...    54   8e-06   Clostridium acetobutylicum
sp|Q7XYP4|RK3_CHLS6|RK3_CHLS6 50S ribosomal protein L3, chloroplast precur...    52   4e-05   
gb:AE017308_437857 Mycoplasma mobile 163K complete genome.             50   9e-05   
gb:BA000016_675445 Clostridium perfringens str. 13 DNA, complete...    50   1e-04   
sp|Q8XHS3|RL3_CLOPE|RL3_CLOPE 50S ribosomal protein L3.                          50   1e-04   Clostridium perfringens
sp|Q839G4|RL3_ENTFA|RL3_ENTFA 50S ribosomal protein L3.>gb:AE016947_364336...    49   2e-04   Enterococcus faecalis
gb:AE016822_340976 Leifsonia xyli subsp. xyli str. CTCB07, compl...    48   6e-04   
gb:AF236098_1416545 Bos taurus ribosomal protein L3 gene, partia...    47   7e-04   
gb:BA000043_736683 Geobacillus kaustophilus HTA426 DNA, complete...    47   7e-04   
sp|P28600|RL3_BACST|RL3_BACST 50S ribosomal protein L3.>pir|S24363|S24363 ...    47   7e-04   Geobacillus stearothermophilus
sp|Q7MTL3|RL3_PORGI|RL3_PORGI 50S ribosomal protein L3.>gb:AE017178_398059...    47   0.001   Porphyromonas gingivalis
gb:CR522870_99969 Desulfotalea psychrophila LSv54 chromosome.          46   0.002   
gb:AP006841_574701 Bacteroides fragilis YCH46 DNA, complete genome.    45   0.003   
sp|O66431|RL3_AQUAE|RL3_AQUAE 50S ribosomal protein L3.>pir|D70300|D70300 ...    45   0.003   Aquifex aeolicus
sp|O46894|RK3_GUITH|RK3_GUITH Chloroplast 50S ribosomal protein L3.>gb:AF0...    45   0.005   Guillardia theta
gb:BC084076_2563482 Xenopus laevis hypothetical LOC494992, mRNA ...    44   0.006   
sp|Q98PY0|RL3_MYCPU|RL3_MYCPU 50S ribosomal protein L3.>pir|E90585|E90585 ...    44   0.006   Mycoplasma pulmonis
sp|Q8A476|RL3_BACTN|RL3_BACTN 50S ribosomal protein L3.>gb:AE016937_362094...    44   0.006   Bacteroides thetaiotaomicron
gb:CP000023_875780 Streptococcus thermophilus LMG 18311, complet...    44   0.008   
gb:CP000003_860018 Streptococcus pyogenes MGAS10394, complete ge...    44   0.008   
sp|P38515|RL3_THEMA|RL3_THEMA 50S ribosomal protein L3.>pir|S40188|S40188 ...    44   0.008   Thermotoga maritima
sp|Q9A1X4|RL3_STRPY|RL3_STRPY 50S ribosomal protein L3.>gb:AE006477_219307...    44   0.008   Streptococcus pyogenes
sp|Q8G417|RL3_BIFLO|RL3_BIFLO 50S ribosomal protein L3.>gb:AE014295_312239...    44   0.008   Bifidobacterium longum
gb:AE017333_446069 Bacillus licheniformis DSM 13, complete genom...    44   0.010   
sp|Q83I78|RL3_TROW8|RL3_TROW8 50S ribosomal protein L3.>sp|Q83FY6|RL3_TROW...    44   0.010   Tropheryma whipplei
sp|Q81J42|RL3_BACCR|RL3_BACCR 50S ribosomal protein L3.>gb:AE016998_375168...    44   0.010   Bacillus cereus
sp|Q81VT0|RL3_BACAN|RL3_BACAN 50S ribosomal protein L3.>gb:AE017024_380406...    44   0.010   Bacillus anthracis [anthrax]
sp|Q9ZI50|RL3_AQUPY|RL3_AQUPY 50S ribosomal protein L3.>gb:AF040100_472182...    44   0.010   Aquifex pyrophilus
gb:BACRPL1_746196 Bacillus subtilis genes for ribosomal proteins...    43   0.014   
sp|P60457|RL3_SPIKU|RL3_SPIKU 50S ribosomal protein L3.>gb:AY198133_596863...    43   0.014   Spiroplasma kunkelii
sp|P42920|RL3_BACSU|RL3_BACSU 50S ribosomal protein L3 (BL3).>pir|G69694|G...    43   0.014   Bacillus subtilis
sp|P60451|RL3_STRP3|RL3_STRP3 50S ribosomal protein L3.>sp|P60452|RL3_STRP...    43   0.018   Streptococcus pyogenes serotype M3
sp|Q8E7T8|RL3_STRA3|RL3_STRA3 50S ribosomal protein L3.>sp|Q8E2D1|RL3_STRA...    43   0.018   
sp|Q8Y440|RL3_LISMO|RL3_LISMO 50S ribosomal protein L3.>pir|AH1403|AH1403 ...    43   0.018   
sp|Q927K7|RL3_LISIN|RL3_LISIN 50S ribosomal protein L3.>pir|AG1779|AG1779 ...    43   0.018   
gb:PFA929357_1393402 Plasmodium falciparum strain 3D7, chromosom...    42   0.023   
sp|Q8KAH2|RL3_CHLTE|RL3_CHLTE 50S ribosomal protein L3.>gb:AE012965_287647...    42   0.023   Chlorobaculum tepidum
sp|P60454|RL3_GEOSL|RL3_GEOSL 50S ribosomal protein L3.>gb:AE017180_401147...    42   0.031   Geobacter sulfurreducens
sp|P10134|RL3_MYCCA|RL3_MYCCA 50S ribosomal protein L3.>pir|S02831|R5YM3C ...    41   0.052   Mycoplasma capricolum
gb:SPAC644_1718187 S.pombe chromosome I cosmid c644.                   41   0.068   
gb:AP006840_570261 Symbiobacterium thermophilum DNA, complete ge...    41   0.068   
sp|Q8R7V4|RL3_THETN|RL3_THETN 50S ribosomal protein L3.>gb:AE013171_289860...    41   0.068   
sp|Q9Z9L4|RL3_BACHD|RL3_BACHD 50S ribosomal protein L3.>pir|T44383|T44383 ...    41   0.068   Bacillus halodurans
gb:BC055650_2551510 Danio rerio zgc:66423, mRNA (cDNA clone MGC:...    40   0.089   
sp|P18665|RM03_RAT|RM03_RAT Mitochondrial 60S ribosomal protein L3 (L3mt)...    40   0.089   Rattus norvegicus [brown rat]
sp|P09001|RM03_HUMAN|RM03_HUMAN Mitochondrial 60S ribosomal protein L3 (L3m...    40   0.089   Homo sapiens [man]
gb:BC011128_2091256 Mus musculus mitochondrial ribosomal protein...    40   0.12    
gb:AE017263_420675 Mesoplasma florum L1 complete genome.               40   0.12    
sp|Q99N95|RM03_MOUSE|RM03_MOUSE Mitochondrial 60S ribosomal protein L3 (L3m...    40   0.12    Mus musculus [mouse]
gb:AJ719688_2501875 Gallus gallus mRNA for hypothetical protein,...    40   0.15    
sp|Q97SV5|RL3_STRPN|RL3_STRPN 50S ribosomal protein L3.>sp|Q8CWV8|RL3_STRR...    40   0.15    
sp|Q8DS16|RL3_STRMU|RL3_STRMU 50S ribosomal protein L3.>gb:AE015024_314301...    40   0.15    Streptococcus mutans serotype C
gb:AE017332_445447 Mycoplasma hyopneumoniae 232, complete genome.      39   0.20    
sp|P52860|RL3_THETH|RL3_THETH 50S ribosomal protein L3.>gb:TTRPS10L3_19862...    39   0.20    Thermus thermophilus
sp|Q8ETY2|RL3_OCEIH|RL3_OCEIH 50S ribosomal protein L3.>gb:BA000028_694506...    39   0.20    Oceanobacillus iheyensis
sp|P60453|RL3_CORDI|RL3_CORDI 50S ribosomal protein L3.>gb:BX248355_761768...    39   0.20    Corynebacterium diphtheriae
gb:AE017283_431619 Propionibacterium acnes KPA171202, complete g...    39   0.26    
gb:BX842644_822747 Mycoplasma mycoides subsp. mycoides SC genomi...    39   0.34    
gb:AF115283_480068 Leptospira interrogans S10-spc-alpha locus, c...    39   0.34    
sp|Q9XD36|RL3_LEPIN|RL3_LEPIN 50S ribosomal protein L3.>gb:AE011262_270977...    39   0.34    
sp|Q9LRN8|RK3B_ARATH|RK3B_ARATH 50S ribosomal protein L3-2, chloroplast pre...    39   0.34    Arabidopsis thaliana [mouse-ear cress]
gb:BA000026_694363 Mycoplasma penetrans HF-2 DNA, complete genome.     38   0.44    
gb:AP006618_557127 Nocardia farcinica IFM 10152 DNA, complete ge...    38   0.44    
sp|Q8EUB3|RL3_MYCPE|RL3_MYCPE 50S ribosomal protein L3.                          38   0.44    Mycoplasma penetrans
gb:AE017248_415815 Treponema denticola ATCC 35405, section 3 of ...    38   0.58    
gb:AE008692_240255 Zymomonas mobilis subsp. mobilis ZM4, complet...    38   0.58    
sp|Q8NT09|RL3_CORGL|RL3_CORGL 50S ribosomal protein L3.>gb:BA000036_718233...    38   0.58    Corynebacterium glutamicum
gb:BX640422_807999 Bordetella pertussis strain Tohama I, complet...    37   0.75    
gb:AE017313_439554 Desulfovibrio vulgaris subsp. vulgaris str. H...    37   0.75    
gb:AE017201_403714 Lactobacillus johnsonii NCC 533, section 2 of...    37   0.75    
gb:CP000046_92328 Staphylococcus aureus subsp. aureus COL, compl...    37   0.75    
gb:CP000033_88599 Lactobacillus acidophilus NCFM, complete genome.     37   0.75    
sp|P60448|RL3_STAAM|RL3_STAAM 50S ribosomal protein L3.>sp|P60449|RL3_STAA...    37   0.75    Staphylococcus aureus
sp|Q9HWD5|RL3_PSEAE|RL3_PSEAE 50S ribosomal protein L3.>pir|E83116|E83116 ...    37   0.75    Pseudomonas aeruginosa
sp|Q7WRC5|RL3_BORBR|RL3_BORBR 50S ribosomal protein L3.>sp|Q7W2F6|RL3_BORP...    37   0.75    Bordetella bronchiseptica
gb:AY552545_627847 Uncultured marine gamma proteobacterium EBAC2...    37   0.98    
sp|P60443|RL3_NEIMA|RL3_NEIMA 50S ribosomal protein L3.>sp|P60444|RL3_NEIM...    37   0.98    
sp|Q88XY6|RL3_LACPL|RL3_LACPL 50S ribosomal protein L3.>gb:AL935254_550917...    37   0.98    Lactobacillus plantarum
gb:AP001278_1820912 Oryza sativa (japonica cultivar-group) genom...    37   1.3     
gb:CP000020_870412 Vibrio fischeri ES114 chromosome I, complete ...    37   1.3     
gb:AP006627_562477 Bacillus clausii KSM-K16 DNA, complete genome.      37   1.3     
gb:CP000029_82422 Staphylococcus epidermidis RP62A, complete gen...    37   1.3     
pir|T01736|T01736 ribosomal protein L3 precursor, chloroplast - ...    37   1.3     Nicotiana tabacum [American tobacco]
sp|Q8PC49|RL3_XANCP|RL3_XANCP 50S ribosomal protein L3.>gb:AE012189_280161...    37   1.3     Xanthomonas campestris pv. campestris
sp|Q8PNS4|RL3_XANAC|RL3_XANAC 50S ribosomal protein L3.>gb:AE011728_275926...    37   1.3     Xanthomonas citri
sp|Q8CRG0|RL3_STAEP|RL3_STAEP 50S ribosomal protein L3.>gb:AE016750_323474...    37   1.3     Staphylococcus epidermidis
sp|Q9RXK2|RL3_DEIRA|RL3_DEIRA 50S ribosomal protein L3.>pir|G75533|G75533 ...    37   1.3     Deinococcus radiodurans
sp|O80360|RK3_TOBAC|RK3_TOBAC 50S ribosomal protein L3, chloroplast precur...    37   1.3     Nicotiana tabacum [American tobacco]
gb:CP000013_869708 Borrelia garinii PBi, complete genome.              36   1.7     
gb:AY744382_644936 Buchnera aphidicola (Cinara cedri) genomic se...    36   1.7     
gb:CR378663_93736 Photobacterium profundum SS9; segment 1/12.          36   1.7     
sp|Q87T13|RL3_VIBPA|RL3_VIBPA 50S ribosomal protein L3.>gb:BA000031_705717...    36   1.7     
sp|Q889X1|RL3_PSESM|RL3_PSESM 50S ribosomal protein L3.>gb:AE016858_350080...    36   1.7     Pseudomonas syringae pv. tomato
sp|O52332|RL3_MYCGA|RL3_MYCGA 50S ribosomal protein L3.>gb:AE016967_369320...    36   1.7     
sp|Q8FS80|RL3_COREF|RL3_COREF 50S ribosomal protein L3.>gb:BA000035_715307...    36   1.7     Corynebacterium efficiens
gb:AY085287_1570359 Arabidopsis thaliana clone 142861 mRNA, comp...    36   2.2     
gb:AF036708_471573 Mycoplasma gallisepticum strain A5969var.B ri...    36   2.2     
gb:CP000033_89824 Lactobacillus acidophilus NCFM, complete genome.     36   2.2     
pir|C88445|C88445 protein C26E6.6 [imported] - Caenorhabditis el...    36   2.2     Caenorhabditis elegans [roundworm]
sp|P49404|RM03_CAEEL|RM03_CAEEL Putative mitochondrial 60S ribosomal protei...    36   2.2     Caenorhabditis elegans [roundworm]
sp|Q824Q1|RL3_CHLCV|RL3_CHLCV 50S ribosomal protein L3.>gb:AE016994_374160...    36   2.2     Chlamydia caviae
sp|Q89A68|RL3_BUCBP|RL3_BUCBP 50S ribosomal protein L3.>gb:AE014017_302857...    36   2.2     
sp|Q9SKX4|RK3A_ARATH|RK3A_ARATH 50S ribosomal protein L3-1, chloroplast pre...    36   2.2     Arabidopsis thaliana [mouse-ear cress]
gb:CR382138_1670792 Debaryomyces hansenii chromosome F of strain...    35   2.9     
gb:MBS10OPER_142865 Mycobacterium bovis BCG DNA for ribosomal S1...    35   2.9     
pir|E70159|E70159 ribosomal protein L3 (rplC) - Lyme disease spi...    35   2.9     Borreliella burgdorferi
pir|I53597|I53597 proline dehydrogenase (EC 1.5.99.8) / 1-pyrrol...    35   2.9     Escherichia coli [E. coli]
sp|Q7MPI8|RL3_VIBVY|RL3_VIBVY 50S ribosomal protein L3.>gb:BA000037_721201...    35   2.9     Vibrio vulnificus
sp|Q8DE39|RL3_VIBVU|RL3_VIBVU 50S ribosomal protein L3.>gb:AE016799_335523...    35   2.9     Vibrio vulnificus
sp|Q9KNY4|RL3_VIBCH|RL3_VIBCH 50S ribosomal protein L3.>pir|F82059|F82059 ...    35   2.9     
sp|P60441|RL3_MYCBO|RL3_MYCBO 50S ribosomal protein L3.>sp|P60442|RL3_MYCT...    35   2.9     Mycobacterium tuberculosis variant bovis
sp|Q8K950|RL3_BUCAP|RL3_BUCAP 50S ribosomal protein L3.>gb:AE014125_303408...    35   2.9     
gb:BX908798_829968 Parachlamydia-related symbiont UWE25, complet...    35   3.7     
gb:AE013598_297285 Xanthomonas oryzae pv. oryzae KACC10331, comp...    35   3.7     
sp|O83219|RL3_TREPA|RL3_TREPA 50S ribosomal protein L3.>pir|G71354|G71354 ...    35   3.7     Treponema pallidum
gb:AK035282_1164060 Mus musculus adult male urinary bladder cDNA...    35   4.9     
gb:CP000027_79479 Dehalococcoides ethenogenes 195, complete genome.    35   4.9     
sp|Q8D212|RL3_WIGBR|RL3_WIGBR 50S ribosomal protein L3.>gb:BA000021_687289...    35   4.9     Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis
sp|P57591|RL3_BUCAI|RL3_BUCAI 50S ribosomal protein L3.>pir|A84991|A84991 ...    35   4.9     
gb:BC014817_2092042 Mus musculus RIKEN cDNA 1190002C06 gene, mRN...    34   6.4     
gb:CR628337_113564 Legionella pneumophila str. Lens complete gen...    34   6.4     
gb:CR628336_110506 Legionella pneumophila str. Paris complete ge...    34   6.4     
sp|P75580|RL3_MYCPN|RL3_MYCPN 50S ribosomal protein L3.>pir|S73992|S73992 ...    34   6.4     Mycoplasma pneumoniae
gb:BC003654_1968961 Homo sapiens solute carrier family 27 (fatty...    34   8.3     
gb:AL513523_1928937 Human DNA sequence from clone RP11-216N14 on...    34   8.3     
sp|P47397|RL3_MYCGE|RL3_MYCGE 50S ribosomal protein L3.>pir|G64216|G64216 ...    34   8.3     Mycoplasma genitalium


>gb:AY456411_1607186 Lycopersicon esculentum ribosomal protein L3
            (RPL3) mRNA, complete cds.
          Length = 389

 Score =  717 bits (1851), Expect = 0.0
 Identities = 347/389 (89%), Positives = 364/389 (93%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKFEHPRHGSLGFLPRKRA+R RGKVKAFPKDD SKPC+LTAFLGYKAGMTHIVREV
Sbjct: 1    MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPSKPCKLTAFLGYKAGMTHIVREV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHL+E+++RRFYK
Sbjct: 61   EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLSEDIKRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NWC                     DIQ+QLEKLKKY+CVIRVLAHTQIRKMKGLKQKKAH
Sbjct: 121  NWCKSKKKAFLKYSKKYETDEGKKDIQAQLEKLKKYACVIRVLAHTQIRKMKGLKQKKAH 180

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQVNGG+IAQKVDFAYGFFEKQVP+DAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR
Sbjct: 181  LMEIQVNGGSIAQKVDFAYGFFEKQVPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 240

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTE+NKK+YKLGKVGQE+HTALT
Sbjct: 241  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKVYKLGKVGQESHTALT 300

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
            EFDRTEKDITP+GGFPHYGVVK+DYLLIKG CVG KKRVVTLRQSLLNQTSRVALEEIKL
Sbjct: 301  EFDRTEKDITPIGGFPHYGVVKEDYLLIKGCCVGTKKRVVTLRQSLLNQTSRVALEEIKL 360

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFFGRLKA 1248
            KFIDTSSKFGHGRFQTTQEKQKF+GRLKA
Sbjct: 361  KFIDTSSKFGHGRFQTTQEKQKFYGRLKA 389



>gb:AY395738_1604827 Nicotiana tabacum ribosomal protein L3A (RPL3A)
            mRNA, complete cds.
          Length = 389

 Score =  716 bits (1847), Expect = 0.0
 Identities = 344/388 (88%), Positives = 362/388 (93%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKFEHPRHGSLGFLPRKRA+R RGKVKAFPKDD +KPC+LTAFLGYKAGMTHIVR+V
Sbjct: 1    MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPNKPCKLTAFLGYKAGMTHIVRDV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            EKPGSKLHKKETCEAVTI+ETPPMVIVGVVGYVKTPRGLRCLNTVWAQHL+EEL+RRFYK
Sbjct: 61   EKPGSKLHKKETCEAVTIIETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLSEELKRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NWC                     DIQ+QLEKLKKY+CVIRVLAHTQIRKMKGLKQKKAH
Sbjct: 121  NWCKSKKKAFLKYSKKYESDEGKKDIQTQLEKLKKYACVIRVLAHTQIRKMKGLKQKKAH 180

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQVNGGTIAQKVDFAYGFFEKQVP+DAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR
Sbjct: 181  LMEIQVNGGTIAQKVDFAYGFFEKQVPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 240

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTHRGLRKVACIGAWHPARVS+TVARAGQNGYHHRTE+NKK+YKLGK GQE+H A+T
Sbjct: 241  LPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTEMNKKVYKLGKAGQESHAAVT 300

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
            +FDRTEKDITPMGGFPHYGVVKDDYLLIKG CVGPKKRVVTLRQSLLNQTSRVALEEIKL
Sbjct: 301  DFDRTEKDITPMGGFPHYGVVKDDYLLIKGCCVGPKKRVVTLRQSLLNQTSRVALEEIKL 360

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            KFIDTSSKFGHGRFQTTQEKQKF+GRLK
Sbjct: 361  KFIDTSSKFGHGRFQTTQEKQKFYGRLK 388



>gb:AY395739_1604828 Nicotiana tabacum ribosomal protein L3B (RPL3B)
            mRNA, complete cds.
          Length = 409

 Score =  689 bits (1778), Expect = 0.0
 Identities = 330/409 (80%), Positives = 360/409 (88%), Gaps = 20/409 (4%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKFEHPRHGSLGFLPRKRA+R RGKVKAFPKDD++KPCRLTAFLGYKAGMTHIVR+V
Sbjct: 1    MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDTTKPCRLTAFLGYKAGMTHIVRDV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            EKPGSKLHKKETCE VTI+ETPPM++VGVVGYVKTPRGLRCL+TVWAQHL+EE++RRFYK
Sbjct: 61   EKPGSKLHKKETCELVTIIETPPMIVVGVVGYVKTPRGLRCLSTVWAQHLSEEIKRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXX--------------------XXXDIQSQLEKLKKYSCVI 561
            NWC                                         DI +QLEK+KKY CVI
Sbjct: 121  NWCMSKKKAFAKYSKKYETDNWCMSKKKAFAKYSKKYETDDGKKDINAQLEKMKKYCCVI 180

Query: 562  RVLAHTQIRKMKGLKQKKAHVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDI 741
            RVLAHTQIRKMKGLKQKKAH+MEIQVNGG ++QKVD+AYGFFEKQ+P+DA+FQKDEMIDI
Sbjct: 181  RVLAHTQIRKMKGLKQKKAHLMEIQVNGGDVSQKVDYAYGFFEKQIPVDAIFQKDEMIDI 240

Query: 742  IGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTE 921
            IGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVS+TVARAGQNGYHHRTE
Sbjct: 241  IGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTE 300

Query: 922  LNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVV 1101
            LNKK+Y+LGK GQE+H+A+TEFDRTEKDITPMGGFPHYG+VK+D+LLIKG CVGPKKRVV
Sbjct: 301  LNKKVYRLGKAGQESHSAITEFDRTEKDITPMGGFPHYGIVKEDFLLIKGCCVGPKKRVV 360

Query: 1102 TLRQSLLNQTSRVALEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLKA 1248
            TLRQSLLNQTSRVALEEIKLKFIDTSSKFGHGRFQTTQEK KF+GRLKA
Sbjct: 361  TLRQSLLNQTSRVALEEIKLKFIDTSSKFGHGRFQTTQEKDKFYGRLKA 409



>pir|S38359|S38359 ribosomal protein L3.e, cytosolic -
            rice>gb:RICRPL3A_1703761 Oryza sativa (japonica
            cultivar-group) mRNA for ribosomal protein L3, complete
            cds.
          Length = 389

 Score =  676 bits (1745), Expect = 0.0
 Identities = 320/389 (82%), Positives = 351/389 (90%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKFEHPRHGSLGFLPRKR+SR RGKVK+FPKDD SKPC LT+F+GYKAGMTHIVREV
Sbjct: 1    MSHRKFEHPRHGSLGFLPRKRSSRHRGKVKSFPKDDVSKPCHLTSFVGYKAGMTHIVREV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            EKPGSKLHKKETCEAVTI+ETPP+VIVG+V YVKTPRGLR LN+VWAQHL+EE+RRRFYK
Sbjct: 61   EKPGSKLHKKETCEAVTIIETPPLVIVGLVAYVKTPRGLRSLNSVWAQHLSEEVRRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NWC                     +IQ QLEK+KKY+ ++RV+AHTQIRKMKGLKQKKAH
Sbjct: 121  NWCKSKKKAFTKYALKYDSDAGKKEIQMQLEKMKKYASIVRVIAHTQIRKMKGLKQKKAH 180

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQ+NGGTIA KVD+ Y FFEK++P+DAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR
Sbjct: 181  LMEIQINGGTIADKVDYGYKFFEKEIPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 240

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTHRGLRKVACIGAWHPARVS+TVARAGQNGYHHRTE+NKK+YK+GK GQE+H A T
Sbjct: 241  LPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTEMNKKVYKIGKSGQESHAACT 300

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
            EFDRTEKDITPMGGFPHYGVVK DYL+IKG CVGPKKRVVTLRQSLL QTSR+ALEEIKL
Sbjct: 301  EFDRTEKDITPMGGFPHYGVVKGDYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKL 360

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFFGRLKA 1248
            KFIDTSSKFGHGRFQTT EKQ+FFG+LKA
Sbjct: 361  KFIDTSSKFGHGRFQTTDEKQRFFGKLKA 389



>gb:AY347532_1601389 Triticum aestivum cultivar Falat ribosomal
            protein L3 (RPL3) mRNA, RPL3-B3 allele, complete
            cds.>gb:AY347533_1601390 Triticum aestivum cultivar LI
            ribosomal protein L3 (RPL3) mRNA, RPL3-B3 allele,
            complete cds.
          Length = 389

 Score =  676 bits (1744), Expect = 0.0
 Identities = 323/389 (83%), Positives = 349/389 (89%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKFEHPRHGSLGFLPRKR SR RGKVKAFP+DD SK C LTAFLGYKAGMTHIVREV
Sbjct: 1    MSHRKFEHPRHGSLGFLPRKRCSRHRGKVKAFPRDDQSKKCHLTAFLGYKAGMTHIVREV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            EKPGSKLHKKETCEAVTIVETPP+VIVG+V YVKTPRGLR LN+VWAQHL+E++RRRFYK
Sbjct: 61   EKPGSKLHKKETCEAVTIVETPPIVIVGLVAYVKTPRGLRTLNSVWAQHLSEDVRRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NWC                     +IQ QLEK+KKY+ V+RV+AHTQIRKMKGLKQKKAH
Sbjct: 121  NWCKSKKKAFTKYALKYDSDAGKKEIQMQLEKMKKYATVVRVIAHTQIRKMKGLKQKKAH 180

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQ+NGGTIA KVD+ Y FFEK+VPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR
Sbjct: 181  LMEIQINGGTIADKVDYGYNFFEKEVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 240

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTHRGLRKVACIGAWHPARVS+TVARAGQNGYHHRTE+NKK+YK+GKVGQE H A T
Sbjct: 241  LPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTEMNKKVYKIGKVGQETHDAST 300

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
            EFDRTEKDITPMGGFPHYGVVK DYL+IKG CVGPKKRVVTLRQSLL QTSR+ALEEIKL
Sbjct: 301  EFDRTEKDITPMGGFPHYGVVKADYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKL 360

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFFGRLKA 1248
            KF+DTSSKFGHGRFQTT EKQ+F+G+LKA
Sbjct: 361  KFVDTSSKFGHGRFQTTDEKQRFYGKLKA 389



>gb:AY343327_1600856 Triticum aestivum ribosomal protein L3 (RPL3)
            mRNA, RPL3-A1 allele, complete cds.>gb:AY343330_1600858
            Triticum aestivum ribosomal protein L3 (RPL3) mRNA,
            RPL3-A1 allele, complete cds.
          Length = 389

 Score =  676 bits (1744), Expect = 0.0
 Identities = 322/389 (82%), Positives = 349/389 (89%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKFEHPRHGSLGFLPRKR SR RGKVK+FPKDD  KPC LTAFLGYKAGMTHIVREV
Sbjct: 1    MSHRKFEHPRHGSLGFLPRKRCSRHRGKVKSFPKDDQQKPCHLTAFLGYKAGMTHIVREV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            EKPGSKLHKKETCEAVTI+ETPP+VIVG+V YVKTPRGLR LN+VWAQHL+E++RRRFYK
Sbjct: 61   EKPGSKLHKKETCEAVTIIETPPLVIVGLVAYVKTPRGLRTLNSVWAQHLSEDVRRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NWC                     +IQ QLEK+KKY+ ++RV+AHTQIRKMKGLKQKKAH
Sbjct: 121  NWCKSKKKAFTKYALKYDSDAGKKEIQLQLEKMKKYATIVRVIAHTQIRKMKGLKQKKAH 180

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQVNGGTIA KVD+ Y FFEK+VP++AVFQKDEM+DIIGVTKGKGYEGVVTRWGVTR
Sbjct: 181  LMEIQVNGGTIADKVDYGYKFFEKEVPVEAVFQKDEMVDIIGVTKGKGYEGVVTRWGVTR 240

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTHRGLRKVACIGAWHPARVS+TVARAGQNGYHHRTE+NKKIYK+GK GQE+H A T
Sbjct: 241  LPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTEMNKKIYKMGKSGQESHEACT 300

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
            EFDRTEKDITPMGGFPHYGVVK DYL+IKG CVGPKKRVVTLRQSLL QTSR+ALEEIKL
Sbjct: 301  EFDRTEKDITPMGGFPHYGVVKGDYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKL 360

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFFGRLKA 1248
            KFIDTSSKFGHGRFQTT EKQKF+GRLKA
Sbjct: 361  KFIDTSSKFGHGRFQTTDEKQKFYGRLKA 389



>gb:MSA248327_1687018 Medicago sativa subsp. X varia mRNA for L3
            Ribosomal protein.
          Length = 388

 Score =  674 bits (1740), Expect = 0.0
 Identities = 325/384 (84%), Positives = 346/384 (90%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKFEHPRHGSLGFLPRKRA+R RGKVKAFPKDD +KP +LTAFLGYKAGMTHIVREV
Sbjct: 1    MSHRKFEHPRHGSLGFLPRKRAARHRGKVKAFPKDDPTKPPKLTAFLGYKAGMTHIVREV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            EKPGSKLHKKETCE VTI+ETPPMV+VGVVGYVKTPRGLR LNTVW QHL+EE++RRFYK
Sbjct: 61   EKPGSKLHKKETCEPVTIIETPPMVVVGVVGYVKTPRGLRTLNTVWTQHLSEEIKRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NWC                     +IQ+QLEKLKKY+ VIRVLAHTQIRKMKGLKQKKAH
Sbjct: 121  NWCKSKKKAFSKYSKQYESDEGKKNIQTQLEKLKKYATVIRVLAHTQIRKMKGLKQKKAH 180

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQVNGGTIAQKVDFAY FFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR
Sbjct: 181  IMEIQVNGGTIAQKVDFAYNFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 240

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVG+E H A T
Sbjct: 241  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGEETHDAQT 300

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
            EFDRTEKDITPMGGFPHYG+VK+D+L+IKGGCVGPKKRV+TLRQSLL QTSR+ALE+IKL
Sbjct: 301  EFDRTEKDITPMGGFPHYGIVKEDFLMIKGGCVGPKKRVITLRQSLLKQTSRLALEDIKL 360

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFF 1233
            KFIDTS KFGHGRFQTT E Q  +
Sbjct: 361  KFIDTSFKFGHGRFQTTSENQSLW 384



>gb:AY343328_1600857 Triticum aestivum ribosomal protein L3 (RPL3)
            mRNA, RPL3-A2 allele, complete cds.>gb:AY347531_1601388
            Triticum aestivum cultivar Falat ribosomal protein L3
            (RPL3) mRNA, RPL3-A2 allele, complete cds.
          Length = 389

 Score =  674 bits (1740), Expect = 0.0
 Identities = 320/389 (82%), Positives = 349/389 (89%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKFEHPRHGSLGFLPRKR SR RGKVK+FPKDD  KPC LTAFLGYKAGMTHIVREV
Sbjct: 1    MSHRKFEHPRHGSLGFLPRKRCSRHRGKVKSFPKDDQQKPCHLTAFLGYKAGMTHIVREV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            EKPGSKLHKKETCEAVTI+ETPP+VIVG+V YVKTPRGLR LN+VWAQHL+E++RRRFYK
Sbjct: 61   EKPGSKLHKKETCEAVTIIETPPLVIVGLVAYVKTPRGLRTLNSVWAQHLSEDVRRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NWC                     +IQ QLEK+KKY+ ++RV+AHTQIRKMKGLKQKKAH
Sbjct: 121  NWCKSKKKAFTKYALKYDSDSGKKEIQLQLEKMKKYATIVRVIAHTQIRKMKGLKQKKAH 180

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQ+NGGTIA KVD+ Y FFEK+VP++AVFQKDEM+DIIGVTKGKGYEGVVTRWGVTR
Sbjct: 181  LMEIQINGGTIADKVDYGYKFFEKEVPVEAVFQKDEMVDIIGVTKGKGYEGVVTRWGVTR 240

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTHRGLRKVACIGAWHPARVS+TVARAGQNGYHHRTE+NKKIYK+GK GQE+H A T
Sbjct: 241  LPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTEMNKKIYKMGKSGQESHEACT 300

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
            EFDRTEKDITPMGGFPHYGVVK DYL+IKG CVGPKKRVVTLRQSLL QTSR+ALEEIKL
Sbjct: 301  EFDRTEKDITPMGGFPHYGVVKGDYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKL 360

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFFGRLKA 1248
            KFIDTSSKFGHGRFQTT EKQKF+G+LKA
Sbjct: 361  KFIDTSSKFGHGRFQTTDEKQKFYGKLKA 389



>sp|P35684|RL3_ORYSA 60S ribosomal protein L3.
          Length = 388

 Score =  674 bits (1740), Expect = 0.0
 Identities = 319/388 (82%), Positives = 350/388 (90%)
 Frame = +1

Query: 85   SHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVE 264
            SHRKFEHPRHGSLGFLPRKR+SR RGKVK+FPKDD SKPC LT+F+GYKAGMTHIVREVE
Sbjct: 1    SHRKFEHPRHGSLGFLPRKRSSRHRGKVKSFPKDDVSKPCHLTSFVGYKAGMTHIVREVE 60

Query: 265  KPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKN 444
            KPGSKLHKKETCEAVTI+ETPP+VIVG+V YVKTPRGLR LN+VWAQHL+EE+RRRFYKN
Sbjct: 61   KPGSKLHKKETCEAVTIIETPPLVIVGLVAYVKTPRGLRSLNSVWAQHLSEEVRRRFYKN 120

Query: 445  WCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHV 624
            WC                     +IQ QLEK+KKY+ ++RV+AHTQIRKMKGLKQKKAH+
Sbjct: 121  WCKSKKKAFTKYALKYDSDAGKKEIQMQLEKMKKYASIVRVIAHTQIRKMKGLKQKKAHL 180

Query: 625  MEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 804
            MEIQ+NGGTIA KVD+ Y FFEK++P+DAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL
Sbjct: 181  MEIQINGGTIADKVDYGYKFFEKEIPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 240

Query: 805  PRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTE 984
            PRKTHRGLRKVACIGAWHPARVS+TVARAGQNGYHHRTE+NKK+YK+GK GQE+H A TE
Sbjct: 241  PRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTEMNKKVYKIGKSGQESHAACTE 300

Query: 985  FDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLK 1164
            FDRTEKDITPMGGFPHYGVVK DYL+IKG CVGPKKRVVTLRQSLL QTSR+ALEEIKLK
Sbjct: 301  FDRTEKDITPMGGFPHYGVVKGDYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLK 360

Query: 1165 FIDTSSKFGHGRFQTTQEKQKFFGRLKA 1248
            FIDTSSKFGHGRFQTT EKQ+FFG+LKA
Sbjct: 361  FIDTSSKFGHGRFQTTDEKQRFFGKLKA 388



>pir|E96498|E96498 L3 cytoplasmic ribosomal protein [imported] -
            Arabidopsis thaliana>gb:AE005173_892545 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AX765804_1474591 Sequence 13 from Patent
            WO03008440.>gb:AC005687_1532884 Arabidopsis thaliana BAC
            F1I21 from chromosome 1, near 59 cM, complete
            sequence.>gb:AY039544_1560257 Arabidopsis thaliana
            At1g43170/F1I21_18 mRNA, complete
            cds.>gb:AY052743_1562903 Arabidopsis thaliana
            At1g43170/F1I21_18 mRNA, complete
            cds.>gb:AY057487_1563906 Arabidopsis thaliana
            At1g43170/F1I21_18 mRNA, complete
            cds.>gb:AF327421_1786790 Arabidopsis thaliana putative
            ribosomal protein (At1g43170) mRNA, complete
            cds.>gb:AF361101_1791312 Arabidopsis thaliana putative
            ribosomal protein (At1g43170) mRNA, complete
            cds.>gb:AF361809_1791401 Arabidopsis thaliana
            At1g43170/F1I21_18 mRNA, complete cds.
          Length = 389

 Score =  669 bits (1726), Expect = 0.0
 Identities = 320/387 (82%), Positives = 348/387 (89%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKFEHPRHGSLGFLPRKRA+R RGKVKAFPKDD +KPC+ TAF+GYKAGMTHIVREV
Sbjct: 1    MSHRKFEHPRHGSLGFLPRKRANRHRGKVKAFPKDDQTKPCKFTAFMGYKAGMTHIVREV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            EKPGSKLHKKETCEAVTI+ETP MV+VGVV YVKTPRGLR LNTVWAQHL+EE+RRRFYK
Sbjct: 61   EKPGSKLHKKETCEAVTIIETPAMVVVGVVAYVKTPRGLRSLNTVWAQHLSEEVRRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       IQ+QLEK+KKY+ VIRVLAHTQIRKMKGLKQKKAH
Sbjct: 121  NWAKSKKKAFTGYAKQYDSEDGKKGIQAQLEKMKKYATVIRVLAHTQIRKMKGLKQKKAH 180

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQ+NGGTIAQKVDFAY FFEKQ+PI+AVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR
Sbjct: 181  MMEIQINGGTIAQKVDFAYSFFEKQIPIEAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 240

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTHRGLRKVACIGAWHPARVS+TVARAGQNGYHHRTELNKKIY+LGKVG E HTA+T
Sbjct: 241  LPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTELNKKIYRLGKVGTEAHTAMT 300

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
            E+DRTEKD+TPMGGFPHYG+VKDDYL+IKG CVGPKKRVVTLRQSLL QTSR+ALEEIKL
Sbjct: 301  EYDRTEKDVTPMGGFPHYGIVKDDYLMIKGCCVGPKKRVVTLRQSLLTQTSRLALEEIKL 360

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFFGRL 1242
            KFIDT+S FGHGRFQT+ EK +F+ R+
Sbjct: 361  KFIDTASIFGHGRFQTSLEKMRFYNRV 387



>gb:BT000756_1635028 Arabidopsis thaliana clone RAFL09-59-D03 (R18985)
            putative ribosomal protein (At1g43170) mRNA, complete
            cds.
          Length = 389

 Score =  667 bits (1722), Expect = 0.0
 Identities = 319/387 (82%), Positives = 347/387 (89%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKFEHPRHGSLGFLPRKRA+R RGKVKAFPKDD +KPC+ TAF+GYKAGMTHIVREV
Sbjct: 1    MSHRKFEHPRHGSLGFLPRKRANRHRGKVKAFPKDDQTKPCKFTAFMGYKAGMTHIVREV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            EKPGSKLHKKETCEAVTI+ETP MV+VGVV YVKTPRGLR LNTVWAQH +EE+RRRFYK
Sbjct: 61   EKPGSKLHKKETCEAVTIIETPAMVVVGVVAYVKTPRGLRSLNTVWAQHFSEEVRRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       IQ+QLEK+KKY+ VIRVLAHTQIRKMKGLKQKKAH
Sbjct: 121  NWAKSKKKAFTGYAKQYDSEDGKKGIQAQLEKMKKYATVIRVLAHTQIRKMKGLKQKKAH 180

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQ+NGGTIAQKVDFAY FFEKQ+PI+AVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR
Sbjct: 181  MMEIQINGGTIAQKVDFAYSFFEKQIPIEAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 240

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTHRGLRKVACIGAWHPARVS+TVARAGQNGYHHRTELNKKIY+LGKVG E HTA+T
Sbjct: 241  LPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTELNKKIYRLGKVGTEAHTAMT 300

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
            E+DRTEKD+TPMGGFPHYG+VKDDYL+IKG CVGPKKRVVTLRQSLL QTSR+ALEEIKL
Sbjct: 301  EYDRTEKDVTPMGGFPHYGIVKDDYLMIKGCCVGPKKRVVTLRQSLLTQTSRLALEEIKL 360

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFFGRL 1242
            KFIDT+S FGHGRFQT+ EK +F+ R+
Sbjct: 361  KFIDTASIFGHGRFQTSLEKMRFYNRV 387



>sp|P17094|RL3A_ARATH 60S ribosomal protein L3.
          Length = 388

 Score =  667 bits (1721), Expect = 0.0
 Identities = 319/386 (82%), Positives = 347/386 (89%)
 Frame = +1

Query: 85   SHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVE 264
            SHRKFEHPRHGSLGFLPRKRA+R RGKVKAFPKDD +KPC+ TAF+GYKAGMTHIVREVE
Sbjct: 1    SHRKFEHPRHGSLGFLPRKRANRHRGKVKAFPKDDQTKPCKFTAFMGYKAGMTHIVREVE 60

Query: 265  KPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKN 444
            KPGSKLHKKETCEAVTI+ETP MV+VGVV YVKTPRGLR LNTVWAQHL+EE+RRRFYKN
Sbjct: 61   KPGSKLHKKETCEAVTIIETPAMVVVGVVAYVKTPRGLRSLNTVWAQHLSEEVRRRFYKN 120

Query: 445  WCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHV 624
            W                       IQ+QLEK+KKY+ VIRVLAHTQIRKMKGLKQKKAH+
Sbjct: 121  WAKSKKKAFTGYAKQYDSEDGKKGIQAQLEKMKKYATVIRVLAHTQIRKMKGLKQKKAHM 180

Query: 625  MEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 804
            MEIQ+NGGTIAQKVDFAY FFEKQ+PI+AVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL
Sbjct: 181  MEIQINGGTIAQKVDFAYSFFEKQIPIEAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 240

Query: 805  PRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTE 984
            PRKTHRGLRKVACIGAWHPARVS+TVARAGQNGYHHRTELNKKIY+LGKVG E HTA+TE
Sbjct: 241  PRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTELNKKIYRLGKVGTEAHTAMTE 300

Query: 985  FDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLK 1164
            +DRTEKD+TPMGGFPHYG+VKDDYL+IKG CVGPKKRVVTLRQSLL QTSR+ALEEIKLK
Sbjct: 301  YDRTEKDVTPMGGFPHYGIVKDDYLMIKGCCVGPKKRVVTLRQSLLTQTSRLALEEIKLK 360

Query: 1165 FIDTSSKFGHGRFQTTQEKQKFFGRL 1242
            FIDT+S FGHGRFQT+ EK +F+ R+
Sbjct: 361  FIDTASIFGHGRFQTSLEKMRFYNRV 386



>pir|JQ0771|JQ0771 ribosomal protein L3.e (clone ARP1), cytosolic -
            Arabidopsis thaliana>gb:ATHRPCA_1553361 Arabidopsis
            thaliana cytoplasmic ribosomal protein mRNA, complete
            cds.
          Length = 389

 Score =  662 bits (1709), Expect = 0.0
 Identities = 317/387 (81%), Positives = 346/387 (89%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKFEHPRHGSLGFLPRKRA+R RGKVKAFPKDD +KPC+ TAF+GYKAGMTHIVREV
Sbjct: 1    MSHRKFEHPRHGSLGFLPRKRANRHRGKVKAFPKDDQTKPCKFTAFMGYKAGMTHIVREV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            EKPGSKLHKKETCEAVTI+ETP MV+VGVV YVKTPRGLR LNTVWAQHL+EE+RRRFYK
Sbjct: 61   EKPGSKLHKKETCEAVTIIETPAMVVVGVVAYVKTPRGLRSLNTVWAQHLSEEVRRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       IQ+QLEK+KKY+ VIRVLAHTQIRKMKGLKQKKAH
Sbjct: 121  NWAKSKKKAFTGYAKQYDSEDGKKGIQAQLEKVKKYATVIRVLAHTQIRKMKGLKQKKAH 180

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQ+NGGTIAQKVDFAY FFEKQ+PI+AVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR
Sbjct: 181  MMEIQINGGTIAQKVDFAYSFFEKQIPIEAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 240

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTHRGLRKVACIGAWHPARVS+TVARAGQNGYHHRTELNKKIY+LGKVG E HTA+T
Sbjct: 241  LPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTELNKKIYRLGKVGTEAHTAMT 300

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
            E+DRTEKD+TPMGGFPHYG+VKDDY +IKG CVG KKRVVTLRQSLL QTSR+ALEEIKL
Sbjct: 301  EYDRTEKDVTPMGGFPHYGIVKDDYFMIKGCCVGAKKRVVTLRQSLLTQTSRLALEEIKL 360

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFFGRL 1242
            KFIDT+S FGHG+FQT+ EK +F+ R+
Sbjct: 361  KFIDTASIFGHGQFQTSLEKMRFYNRV 387



>pir|B96641|B96641 60s ribosomal protein L3 [imported] - Arabidopsis
            thaliana>gb:AE005173_893828 Arabidopsis thaliana
            chromosome 1, bottom arm complete
            sequence.>gb:AC005850_1533095 Arabidopsis thaliana
            chromosome I BAC T25B24 genomic sequence, complete
            sequence.>gb:BT003869_1636996 Arabidopsis thaliana clone
            RAFL15-38-D07 (R20878) putative ribosomal protein
            (At1g61580) mRNA, complete cds.>gb:BT005702_1638642
            Arabidopsis thaliana clone U20878 putative ribosomal
            protein (At1g61580) mRNA, complete cds.
          Length = 390

 Score =  662 bits (1708), Expect = 0.0
 Identities = 316/386 (81%), Positives = 346/386 (89%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKFEHPRHGSLGFLPRKRASR RGKVKAFPKDD +KPCRLT+FLGYKAGMTHIVR+V
Sbjct: 1    MSHRKFEHPRHGSLGFLPRKRASRHRGKVKAFPKDDPTKPCRLTSFLGYKAGMTHIVRDV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            EKPGSKLHKKETCEAVTI+ETPPMV+VGVVGYVKTPRGLR L TVWAQHL+EELRRRFYK
Sbjct: 61   EKPGSKLHKKETCEAVTIIETPPMVVVGVVGYVKTPRGLRSLCTVWAQHLSEELRRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                      DIQSQLEK+KKY  VIRVLAHTQIRKMKGLKQKKAH
Sbjct: 121  NWAKSKKKAFTRYSKKHETEEGKKDIQSQLEKMKKYCSVIRVLAHTQIRKMKGLKQKKAH 180

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            + EIQ+NGG IA+KVD+A   FEKQVP+DA+FQKDEMIDIIGVTKGKGYEGVVTRWGVTR
Sbjct: 181  LNEIQINGGDIAKKVDYACSLFEKQVPVDAIFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 240

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTHRGLRKVACIGAWHPARVS+TVARAGQNGYHHRTE+NKK+Y++GKVGQE H+A+T
Sbjct: 241  LPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTEMNKKVYRVGKVGQETHSAMT 300

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
            E+DRTEKDITPMGGFPHYG+VK+DYL+IKG CVGPKKRVVTLRQ+LL QTSR+A+EEIKL
Sbjct: 301  EYDRTEKDITPMGGFPHYGIVKEDYLMIKGCCVGPKKRVVTLRQTLLKQTSRLAMEEIKL 360

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFFGR 1239
            KFID +S  GHGRFQT+QEK KF+GR
Sbjct: 361  KFIDAASNGGHGRFQTSQEKAKFYGR 386



>pir|JQ0772|JQ0772 ribosomal protein L3.e (clone ARP2), cytosolic -
            Arabidopsis thaliana>gb:ATHRPCB_1553362 Arabidopsis
            thaliana ribosomal protein gene, complete cds.
          Length = 390

 Score =  661 bits (1705), Expect = 0.0
 Identities = 315/386 (81%), Positives = 346/386 (89%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKFEHPRHGSLGFLPRKRASR RGKVKAFPKDD +KPCRLT+FLGYKAGMTHIVR+V
Sbjct: 1    MSHRKFEHPRHGSLGFLPRKRASRHRGKVKAFPKDDPTKPCRLTSFLGYKAGMTHIVRDV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            EKPGSKLHKKETCEAVTI+ETPPMV+VGVVGYVKTPRGLR L TVWAQHL+EELRRRFYK
Sbjct: 61   EKPGSKLHKKETCEAVTIIETPPMVVVGVVGYVKTPRGLRSLCTVWAQHLSEELRRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                      DIQSQLEK+KKY  VIRVLAHTQIRKMKG+KQKKAH
Sbjct: 121  NWAKSKKKAFTRYSKKHETEEGKKDIQSQLEKMKKYCSVIRVLAHTQIRKMKGVKQKKAH 180

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            + EIQ+NGG IA+KVD+A   FEKQVP+DA+FQKDEMIDIIGVTKGKGYEGVVTRWGVTR
Sbjct: 181  LNEIQINGGDIAKKVDYACSLFEKQVPVDAIFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 240

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTHRGLRKVACIGAWHPARVS+TVARAGQNGYHHRTE+NKK+Y++GKVGQE H+A+T
Sbjct: 241  LPRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTEMNKKVYRVGKVGQETHSAMT 300

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
            E+DRTEKDITPMGGFPHYG+VK+DYL+IKG CVGPKKRVVTLRQ+LL QTSR+A+EEIKL
Sbjct: 301  EYDRTEKDITPMGGFPHYGIVKEDYLMIKGCCVGPKKRVVTLRQTLLKQTSRLAMEEIKL 360

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFFGR 1239
            KFID +S  GHGRFQT+QEK KF+GR
Sbjct: 361  KFIDAASNGGHGRFQTSQEKAKFYGR 386



>sp|P22738|RL3B_ARATH 60S ribosomal protein L3.
          Length = 389

 Score =  660 bits (1703), Expect = 0.0
 Identities = 315/385 (81%), Positives = 345/385 (89%)
 Frame = +1

Query: 85   SHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVE 264
            SHRKFEHPRHGSLGFLPRKRASR RGKVKAFPKDD +KPCRLT+FLGYKAGMTHIVR+VE
Sbjct: 1    SHRKFEHPRHGSLGFLPRKRASRHRGKVKAFPKDDPTKPCRLTSFLGYKAGMTHIVRDVE 60

Query: 265  KPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKN 444
            KPGSKLHKKETCEAVTI+ETPPMV+VGVVGYVKTPRGLR L TVWAQHL+EELRRRFYKN
Sbjct: 61   KPGSKLHKKETCEAVTIIETPPMVVVGVVGYVKTPRGLRSLCTVWAQHLSEELRRRFYKN 120

Query: 445  WCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHV 624
            W                      DIQSQLEK+KKY  VIRVLAHTQIRKMKGLKQKKAH+
Sbjct: 121  WAKSKKKAFTRYSKKHETEEGKKDIQSQLEKMKKYCSVIRVLAHTQIRKMKGLKQKKAHL 180

Query: 625  MEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 804
             EIQ+NGG IA+KVD+A   FEKQVP+DA+FQKDEMIDIIGVTKGKGYEGVVTRWGVTRL
Sbjct: 181  NEIQINGGDIAKKVDYACSLFEKQVPVDAIFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 240

Query: 805  PRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTE 984
            PRKTHRGLRKVACIGAWHPARVS+TVARAGQNGYHHRTE+NKK+Y++GKVGQE H+A+TE
Sbjct: 241  PRKTHRGLRKVACIGAWHPARVSYTVARAGQNGYHHRTEMNKKVYRVGKVGQETHSAMTE 300

Query: 985  FDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLK 1164
            +DRTEKDITPMGGFPHYG+VK+DYL+IKG CVGPKKRVVTLRQ+LL QTSR+A+EEIKLK
Sbjct: 301  YDRTEKDITPMGGFPHYGIVKEDYLMIKGCCVGPKKRVVTLRQTLLKQTSRLAMEEIKLK 360

Query: 1165 FIDTSSKFGHGRFQTTQEKQKFFGR 1239
            FID +S  GHGRFQT+QEK KF+GR
Sbjct: 361  FIDAASNGGHGRFQTSQEKAKFYGR 385



>gb:AY236158_1592018 Oryza sativa (indica cultivar-group) ribosomal
            protein L3B mRNA, partial cds.
          Length = 345

 Score =  587 bits (1512), Expect = e-166
 Identities = 277/345 (80%), Positives = 307/345 (88%)
 Frame = +1

Query: 115  GSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKE 294
            GSLGFLPRKR+SR RGKVK+FPKDD +KPC LT+F+GYKAGMTHIVREVEKPGSKLHKKE
Sbjct: 1    GSLGFLPRKRSSRHRGKVKSFPKDDVNKPCHLTSFVGYKAGMTHIVREVEKPGSKLHKKE 60

Query: 295  TCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKNWCXXXXXXXX 474
            TCEAVTI+ETPP+V+VG+V YVKTPRGLR LN+VWAQHL+EE+RRRFYKNWC        
Sbjct: 61   TCEAVTIIETPPIVVVGLVAYVKTPRGLRSLNSVWAQHLSEEVRRRFYKNWCKSKKKAFT 120

Query: 475  XXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHVMEIQVNGGTI 654
                         +IQ QLEK+KKY+ V+RV+ HTQIRKMKGLKQKKAH+MEIQ+NGGTI
Sbjct: 121  KYALKYDSDAGKKEIQMQLEKMKKYASVVRVIVHTQIRKMKGLKQKKAHLMEIQINGGTI 180

Query: 655  AQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRK 834
            A KVD+ Y FFEK++P+DAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRK
Sbjct: 181  ADKVDYGYKFFEKEIPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRK 240

Query: 835  VACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITP 1014
            VACIGAWHPARVS+TVARAGQNGYHHRTE+NKK+YK+GK GQE+H A TEFDRTEKDITP
Sbjct: 241  VACIGAWHPARVSYTVARAGQNGYHHRTEMNKKVYKIGKSGQESHAACTEFDRTEKDITP 300

Query: 1015 MGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALE 1149
            MGGFPHYGVVK DYL+IKG CVGPKKRVVTLRQSLL QTSR+ALE
Sbjct: 301  MGGFPHYGVVKGDYLMIKGCCVGPKKRVVTLRQSLLKQTSRLALE 345



>pir|S25592|S25592 ribosomal protein L3.e, cytosolic - fission yeast
            (Schizosaccharomyces pombe)>gb:SPAPB8E5_1718704 S.pombe
            chromosome I cosmid pB8E5.>gb:SPRPGL3_1722067 S.pombe
            rpgL3-2 gene for ribosomal protein L3.
          Length = 388

 Score =  516 bits (1330), Expect = e-145
 Identities = 255/388 (65%), Positives = 303/388 (78%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSH KFE PRHGSLGFLPRKRASRQRGKVKAFPKDD+SKP  LTAFLGYKAGMTHIVR++
Sbjct: 1    MSHCKFEQPRHGSLGFLPRKRASRQRGKVKAFPKDDASKPVHLTAFLGYKAGMTHIVRDL 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK+HK+E  EAVTI+ETPPMV+VGVVGYV+TPRGLR L TVWA+HL+EE++RRFYK
Sbjct: 61   DRPGSKMHKREILEAVTIIETPPMVVVGVVGYVETPRGLRSLTTVWAEHLSEEVKRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       I  +LE++KKY  V+RVLAHTQIRK   L QKKAH
Sbjct: 121  NW--FKSKKKAFTKYAKKYAESTQSINRELERIKKYCSVVRVLAHTQIRKTP-LAQKKAH 177

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQVNGG++A KV++A   FEK V I + F+++EMID+IGVT+GKG EG   RWG  R
Sbjct: 178  LMEIQVNGGSVADKVEWAREHFEKTVDIKSTFEQNEMIDVIGVTRGKGNEGTTARWGTKR 237

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTHRGLRKVACIGAWHPA V +TVARAG  GY HRT+LN KIY++G  G +   A T
Sbjct: 238  LPRKTHRGLRKVACIGAWHPANVQWTVARAGNAGYMHRTQLNSKIYRIG-AGDDAKNAST 296

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
            +FD TEK ITPMGGF  YGVV++D++++ G   GP KRV+TLR+SLL  TSR ALE + L
Sbjct: 297  DFDATEKRITPMGGFVRYGVVENDFVMLNGATPGPVKRVLTLRKSLLTHTSRKALEPVSL 356

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            K+IDT+SKFGHGRFQT  E ++F G LK
Sbjct: 357  KWIDTASKFGHGRFQTPAEAKQFLGTLK 384



>gb:AY072287_1295908 Spodoptera frugiperda ribosomal protein L3 mRNA,
            complete cds.
          Length = 413

 Score =  516 bits (1329), Expect = e-145
 Identities = 250/394 (63%), Positives = 304/394 (77%), Gaps = 6/394 (1%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKF  PRHGS+GF P+KR+ R RGKVKAFPKDD+SKP  LTAF+GYKAGMTH+VRE 
Sbjct: 1    MSHRKFSAPRHGSMGFYPKKRSRRHRGKVKAFPKDDASKPVHLTAFIGYKAGMTHVVREP 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK++KKE  EAVTI+ETPPMV VGVVGY++TP GLR L TVWA+H++E+ RRRFYK
Sbjct: 61   DRPGSKINKKEIVEAVTIIETPPMVCVGVVGYIETPHGLRALLTVWAEHMSEDCRRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       I+   +K+ +Y  V+RV+AHTQ++ +K  +QKKAH
Sbjct: 121  NWYKCKKKAFTKASKKWQDELGRKSIEKDFKKMIRYCSVVRVIAHTQMKLLK-QRQKKAH 179

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQVNGGTI  KV +A    EK +P+D+VF +DEMID IGVTKGKGY+GV +RW   +
Sbjct: 180  IMEIQVNGGTIEDKVKWAREHLEKPIPVDSVFAQDEMIDCIGVTKGKGYKGVTSRWHTKK 239

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG-----KVGQE- 963
            LPRKTH+GLRKVACIGAWHP+RVSFTVARAGQ GYHHRTE+NKKIY++G     K G+  
Sbjct: 240  LPRKTHKGLRKVACIGAWHPSRVSFTVARAGQKGYHHRTEMNKKIYRIGQGIHTKDGKVI 299

Query: 964  NHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVA 1143
             + A TE+D +EK ITPMGGFPHYG V +D+++IKG C+GPKKRV+TLR+SL   T R A
Sbjct: 300  KNNASTEYDLSEKSITPMGGFPHYGEVNNDFVMIKGCCMGPKKRVITLRKSLRTHTKRAA 359

Query: 1144 LEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            LE+I LKFIDTSSKFGHGRFQT  +K  F G LK
Sbjct: 360  LEKINLKFIDTSSKFGHGRFQTPADKAAFMGTLK 393



>pir|T37818|T37818 60s ribosomal protein L3 - fission yeast
            (Schizosaccharomyces pombe)>gb:SPAC17A5_1716712 S.pombe
            chromosome I cosmid c17A5.>gb:SPU00798_1722124
            Schizosaccharomyces pombe ribosomal protein L3 (rpg13-1)
            gene, complete cds.
          Length = 388

 Score =  516 bits (1329), Expect = e-145
 Identities = 254/388 (65%), Positives = 303/388 (78%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSH KFE PRHGSLGFLPRKRASRQRGKVKAFPKDD+SKP  LTAFLGYKAGMTHIVR++
Sbjct: 1    MSHCKFEQPRHGSLGFLPRKRASRQRGKVKAFPKDDASKPVHLTAFLGYKAGMTHIVRDL 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK+HK+E  EAVT++ETPPMV+VGVVGYV+TPRGLR L TVWA+HL+EE++RRFYK
Sbjct: 61   DRPGSKMHKREILEAVTVIETPPMVVVGVVGYVETPRGLRSLTTVWAEHLSEEVKRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       I  +LE++KKY  V+RVLAHTQIRK   L QKKAH
Sbjct: 121  NW--FKSKKKAFTKYAKKYAESTQSINRELERIKKYCSVVRVLAHTQIRKTP-LAQKKAH 177

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQVNGG++A KV++A   FEK V I + F+++EMID+IGVT+GKG EG   RWG  R
Sbjct: 178  LMEIQVNGGSVADKVEWAREHFEKTVDIKSTFEQNEMIDVIGVTRGKGNEGTTARWGTKR 237

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTHRGLRKVACIGAWHPA V +TVARAG  GY HRT+LN KIY++G  G +   A T
Sbjct: 238  LPRKTHRGLRKVACIGAWHPANVQWTVARAGNAGYMHRTQLNSKIYRIG-AGDDAKNAST 296

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
            +FD TEK ITPMGGF  YGVV++D++++ G   GP KRV+TLR+SLL  TSR ALE + L
Sbjct: 297  DFDATEKRITPMGGFVRYGVVENDFVMLNGATPGPVKRVLTLRKSLLTHTSRKALEPVSL 356

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            K+IDT+SKFGHGRFQT  E ++F G LK
Sbjct: 357  KWIDTASKFGHGRFQTPAEAKQFLGTLK 384



>gb:AE017351_1759487 Cryptococcus neoformans var. neoformans JEC21
            chromosome 11, complete sequence.
          Length = 390

 Score =  516 bits (1328), Expect = e-145
 Identities = 248/388 (63%), Positives = 298/388 (76%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRK+E PRHGSL FLP+KRA+R RG+ KAFPKDD  KP  LTA +GYKAGMTHIVR++
Sbjct: 1    MSHRKYEEPRHGSLAFLPKKRAARHRGRCKAFPKDDPKKPVHLTAVMGYKAGMTHIVRDL 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK+HK+E  EAVT++ETPPMV+VG VGYV+TPRGLR L TVWA+HL++E++RRFYK
Sbjct: 61   DRPGSKMHKREVVEAVTVIETPPMVVVGAVGYVETPRGLRSLTTVWAEHLSDEVKRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       +  +LE++KKY  V+RVLAHTQI K  GL+QKKAH
Sbjct: 121  NW-YRSKKKAFTRYAKKHSENSGASVARELERIKKYCTVVRVLAHTQISK-TGLQQKKAH 178

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQVNGG++A KVDFA   FEK V + +VF++DE IDIIGVTKG GYEGV  RWG TR
Sbjct: 179  LMEIQVNGGSVADKVDFARSHFEKTVDVGSVFEQDECIDIIGVTKGHGYEGVTARWGTTR 238

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTHRGLRKVACIGAWHP+ V F+VARAGQ GYH RT +N KIY++   G    +  T
Sbjct: 239  LPRKTHRGLRKVACIGAWHPSNVMFSVARAGQRGYHSRTSMNHKIYRIAN-GASGSSGST 297

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
            EFD T+KDITPMGGF  YGVVK+D+++IKG CVGP KR+VTLR++L   TSR   E++ L
Sbjct: 298  EFDLTKKDITPMGGFVRYGVVKNDFVMIKGTCVGPVKRIVTLRKALRTHTSRAHTEKVTL 357

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            KFIDTSS FGHGRFQ   EK  F G+LK
Sbjct: 358  KFIDTSSNFGHGRFQDAAEKNAFLGQLK 385



>gb:BTA238851_1436533 Bos taurus rpl3 gene for ribosomal protein L3,
            U43 snoRNA, U82 snoRNA, U83a snoRNA and U83b snoRNA
            genes.
          Length = 403

 Score =  514 bits (1325), Expect = e-144
 Identities = 254/394 (64%), Positives = 310/394 (78%), Gaps = 6/394 (1%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKF  PRHGSLGFLPRKR+SR RGKVK+FPKDDSSKP  LTAFLGYKAGMTHIVREV
Sbjct: 1    MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDSSKPVHLTAFLGYKAGMTHIVREV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK++KKE  EAVTIVETPPMVIVG+VGYV+TPRGLR   T++A+H+++E +RRFYK
Sbjct: 61   DRPGSKVNKKEVVEAVTIVETPPMVIVGIVGYVETPRGLRTFKTIFAEHISDECKRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       ++     +KKY  VIRV+AHTQ+R +  L+QKKAH
Sbjct: 121  NWHKSKKKAFTKYCKKWQDADGKKQLERDFSSMKKYCQVIRVIAHTQMRLLP-LRQKKAH 179

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +ME+QVNGGT+A+K+D+A    E+QVP+  VF +DEMID+IGVTKGKGY+GV +RW   +
Sbjct: 180  LMEVQVNGGTVAEKLDWARERLEQQVPVSQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKK 239

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG-----KVGQ-E 963
            LPRKTHRGLRKVACIGAWHPARV+F+VARAGQ GYHHRTE+NKKIYK+G     K G+  
Sbjct: 240  LPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLI 299

Query: 964  NHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVA 1143
             + A T++D ++K I P+GGF HYG V +D++++KG  VG KKRV+TLR+SLL QT R A
Sbjct: 300  KNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRA 359

Query: 1144 LEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            LEEI LKFIDT+SKFGHGRFQT +EK+ F G LK
Sbjct: 360  LEEIDLKFIDTTSKFGHGRFQTVEEKKAFMGPLK 393



>sp|P36584|RL3B_SCHPO 60S ribosomal protein L3-B.
          Length = 387

 Score =  514 bits (1325), Expect = e-144
 Identities = 254/387 (65%), Positives = 302/387 (78%)
 Frame = +1

Query: 85   SHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVE 264
            SH KFE PRHGSLGFLPRKRASRQRGKVKAFPKDD+SKP  LTAFLGYKAGMTHIVR+++
Sbjct: 1    SHCKFEQPRHGSLGFLPRKRASRQRGKVKAFPKDDASKPVHLTAFLGYKAGMTHIVRDLD 60

Query: 265  KPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKN 444
            +PGSK+HK+E  EAVTI+ETPPMV+VGVVGYV+TPRGLR L TVWA+HL+EE++RRFYKN
Sbjct: 61   RPGSKMHKREILEAVTIIETPPMVVVGVVGYVETPRGLRSLTTVWAEHLSEEVKRRFYKN 120

Query: 445  WCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHV 624
            W                       I  +LE++KKY  V+RVLAHTQIRK   L QKKAH+
Sbjct: 121  W--FKSKKKAFTKYAKKYAESTQSINRELERIKKYCSVVRVLAHTQIRKTP-LAQKKAHL 177

Query: 625  MEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 804
            MEIQVNGG++A KV++A   FEK V I + F+++EMID+IGVT+GKG EG   RWG  RL
Sbjct: 178  MEIQVNGGSVADKVEWAREHFEKTVDIKSTFEQNEMIDVIGVTRGKGNEGTTARWGTKRL 237

Query: 805  PRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTE 984
            PRKTHRGLRKVACIGAWHPA V +TVARAG  GY HRT+LN KIY++G  G +   A T+
Sbjct: 238  PRKTHRGLRKVACIGAWHPANVQWTVARAGNAGYMHRTQLNSKIYRIG-AGDDAKNASTD 296

Query: 985  FDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLK 1164
            FD TEK ITPMGGF  YGVV++D++++ G   GP KRV+TLR+SLL  TSR ALE + LK
Sbjct: 297  FDATEKRITPMGGFVRYGVVENDFVMLNGATPGPVKRVLTLRKSLLTHTSRKALEPVSLK 356

Query: 1165 FIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            +IDT+SKFGHGRFQT  E ++F G LK
Sbjct: 357  WIDTASKFGHGRFQTPAEAKQFLGTLK 383



>gb:MMJ1PRO_2116175 Murine mRNA for J1 protein, yeast ribosomal
            protein L3 homologue.
          Length = 403

 Score =  514 bits (1324), Expect = e-144
 Identities = 253/394 (64%), Positives = 311/394 (78%), Gaps = 6/394 (1%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKF  PRHGSLGFLPRKR+SR RGKVK+FPKDD+SKP  LTAFLGYKAGMTHIVREV
Sbjct: 1    MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDASKPVHLTAFLGYKAGMTHIVREV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK++KKE  EAVTIVETPPMV+VG+VGYV+TPRGLR   TV+A+H+++E +RRFYK
Sbjct: 61   DRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       ++     +KKY  VIR++AHTQ+R +  L+QKKAH
Sbjct: 121  NWHKSKKKAFTKYCKKWQDDTGKKQLEKDFNSMKKYCQVIRIIAHTQMRLLP-LRQKKAH 179

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQVNGGT+A+K+D+A    E+QVP++ VF +DEMID+IGVTKGKGY+GV +RW   +
Sbjct: 180  LMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKK 239

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG-----KVGQ-E 963
            LPRKTHRGLRKVACIGAWHPARV+FTVARAGQ GYHHRTE+NKKIYK+G     K G+  
Sbjct: 240  LPRKTHRGLRKVACIGAWHPARVAFTVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLI 299

Query: 964  NHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVA 1143
             + A T++D ++K I P+GGF HYG V +D++++KG  VG KKRV+TLR+SLL QT R A
Sbjct: 300  KNNASTDYDLSDKSINPLGGFVHYGEVTNDFIMLKGCVVGTKKRVLTLRKSLLVQTKRRA 359

Query: 1144 LEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            LE+I LKFIDT+SKFGHGRFQT +EK+ F G LK
Sbjct: 360  LEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLK 393



>sp|P40372|RL3A_SCHPO 60S ribosomal protein L3-A.
          Length = 387

 Score =  514 bits (1324), Expect = e-144
 Identities = 253/387 (65%), Positives = 302/387 (78%)
 Frame = +1

Query: 85   SHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVE 264
            SH KFE PRHGSLGFLPRKRASRQRGKVKAFPKDD+SKP  LTAFLGYKAGMTHIVR+++
Sbjct: 1    SHCKFEQPRHGSLGFLPRKRASRQRGKVKAFPKDDASKPVHLTAFLGYKAGMTHIVRDLD 60

Query: 265  KPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKN 444
            +PGSK+HK+E  EAVT++ETPPMV+VGVVGYV+TPRGLR L TVWA+HL+EE++RRFYKN
Sbjct: 61   RPGSKMHKREILEAVTVIETPPMVVVGVVGYVETPRGLRSLTTVWAEHLSEEVKRRFYKN 120

Query: 445  WCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHV 624
            W                       I  +LE++KKY  V+RVLAHTQIRK   L QKKAH+
Sbjct: 121  W--FKSKKKAFTKYAKKYAESTQSINRELERIKKYCSVVRVLAHTQIRKTP-LAQKKAHL 177

Query: 625  MEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 804
            MEIQVNGG++A KV++A   FEK V I + F+++EMID+IGVT+GKG EG   RWG  RL
Sbjct: 178  MEIQVNGGSVADKVEWAREHFEKTVDIKSTFEQNEMIDVIGVTRGKGNEGTTARWGTKRL 237

Query: 805  PRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTE 984
            PRKTHRGLRKVACIGAWHPA V +TVARAG  GY HRT+LN KIY++G  G +   A T+
Sbjct: 238  PRKTHRGLRKVACIGAWHPANVQWTVARAGNAGYMHRTQLNSKIYRIG-AGDDAKNASTD 296

Query: 985  FDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLK 1164
            FD TEK ITPMGGF  YGVV++D++++ G   GP KRV+TLR+SLL  TSR ALE + LK
Sbjct: 297  FDATEKRITPMGGFVRYGVVENDFVMLNGATPGPVKRVLTLRKSLLTHTSRKALEPVSLK 356

Query: 1165 FIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            +IDT+SKFGHGRFQT  E ++F G LK
Sbjct: 357  WIDTASKFGHGRFQTPAEAKQFLGTLK 383



>gb:AJ720292_2502479 Gallus gallus mRNA for hypothetical protein,
            clone 14e22.
          Length = 403

 Score =  514 bits (1323), Expect = e-144
 Identities = 252/394 (63%), Positives = 309/394 (78%), Gaps = 6/394 (1%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKF  PRHGSLGFLPRKR+SR RGKVK+FPKDD SKP  LTAFLGYKAGMTHIVREV
Sbjct: 1    MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK++KKE  EAVTIVETPPMVIVG+VGYV+TPRGLR   T++A+H+++E +RRFYK
Sbjct: 61   DRPGSKVNKKEVVEAVTIVETPPMVIVGIVGYVQTPRGLRSFKTIFAEHISDECKRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       ++     +KKY  VIRV+AHTQ+R +  L+QKK+H
Sbjct: 121  NWHKSKKKAFTKYCKKWQDEEGKKQLEKDFNSMKKYCQVIRVMAHTQMRLLP-LRQKKSH 179

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQVNGGT+A+KVD+A    E+QVP+ +VF +DEMID+IGVTKGKGY+GV +RW   +
Sbjct: 180  LMEIQVNGGTVAEKVDWAREKLEQQVPVSSVFGQDEMIDVIGVTKGKGYKGVTSRWHTKK 239

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQ------E 963
            LPRKTHRGLRKVACIGAWHPARV+F+VARAGQ GYHHRTE+NKKIYK+G+  Q       
Sbjct: 240  LPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYQIKDGKLI 299

Query: 964  NHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVA 1143
             + A T++D ++K I P+GGF HYG V +D++++KG  VG KKRV+TLR+SLL QT R A
Sbjct: 300  KNNASTDYDLSDKSINPLGGFVHYGEVTNDFIMLKGCVVGTKKRVLTLRKSLLVQTKRRA 359

Query: 1144 LEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            LE+I LKFIDT+SKFGHGRFQT +EK+ F G LK
Sbjct: 360  LEKIDLKFIDTTSKFGHGRFQTAEEKKSFMGPLK 393



>pir|S50221|S50221 ribosomal protein L3, cytosolic -
            bovine>gb:BT021012_1436370 Bos taurus ribosomal protein
            L3 (RPL3), mRNA, complete cds.>gb:BTRIPRL3_1437347
            B.taurus mRNA for ribosomal protein L3.
          Length = 403

 Score =  513 bits (1321), Expect = e-144
 Identities = 253/394 (64%), Positives = 310/394 (78%), Gaps = 6/394 (1%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKF  PRHGSLGFLPRKR+SR RGKVK+FPKDDSSKP  LTAFLGYKAGMTHIVREV
Sbjct: 1    MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDSSKPVHLTAFLGYKAGMTHIVREV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK++KKE  EAVTIVETPPMVIVG+VGYV+TPRGLR   T++A+H+++E +RRFYK
Sbjct: 61   DRPGSKVNKKEVVEAVTIVETPPMVIVGIVGYVETPRGLRTFKTIFAEHISDECKRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       ++     +KKY  VIRV+AHTQ+R +  L+QKKAH
Sbjct: 121  NWHKSKKKAFTKYCKKWQDADGKKQLERDFSSMKKYCQVIRVIAHTQMRLLP-LRQKKAH 179

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +ME+QVNGGT+A+K+D+A    E+QVP+  VF +DEMID+IGVTKGKGY+GV +RW   +
Sbjct: 180  LMEVQVNGGTVAEKLDWARERLEQQVPVSQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKK 239

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG-----KVGQ-E 963
            LPRKTHRGLRKVACIGAWHPARV+F+VARAGQ GYHHRTE+NKKIYK+G     K G+  
Sbjct: 240  LPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLI 299

Query: 964  NHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVA 1143
             + A T++D ++K I P+GGF HYG V +D++++KG  VG KKRV+TLR+SLL QT R A
Sbjct: 300  KNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRA 359

Query: 1144 LEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            LE+I LKFIDT+SKFGHGRFQT +EK+ F G LK
Sbjct: 360  LEKIDLKFIDTTSKFGHGRFQTVEEKKAFMGPLK 393



>gb:AY769270_1350421 Bombyx mori ribosomal protein L3 (RpL3) mRNA,
            complete cds.
          Length = 413

 Score =  513 bits (1320), Expect = e-144
 Identities = 248/394 (62%), Positives = 303/394 (76%), Gaps = 6/394 (1%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKF  PRHGS+GF P+KR+ R RGKVKAFPKDD SKP  LTAF+GYKAGMTH+VRE 
Sbjct: 1    MSHRKFSAPRHGSMGFYPKKRSRRHRGKVKAFPKDDPSKPVHLTAFIGYKAGMTHVVREP 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK++KKE  EAVTI+ETPPMV VGVVGY++TP GLR L TVWA+H++E+ RRRFYK
Sbjct: 61   DRPGSKINKKEIVEAVTIIETPPMVCVGVVGYIETPHGLRALLTVWAEHMSEDCRRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       I+   +K+ +Y  V+RV+AHTQ++ +K  +QKKAH
Sbjct: 121  NWYKCKKKAFTKASKKWQDELGRKSIEKDFKKMIRYCSVVRVIAHTQMKLLK-QRQKKAH 179

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQ+NGGTI  KV +A    EK +P+D+VF +DEMID IGVTKGKGY+GV +RW   +
Sbjct: 180  IMEIQLNGGTIEDKVKWAREHLEKPIPVDSVFAQDEMIDCIGVTKGKGYKGVTSRWHTKK 239

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG-----KVGQE- 963
            LPRKTH+GLRKVACIGAWHP+RVSFTVARAGQ GYHHRTE+NKKIY++G     K G+  
Sbjct: 240  LPRKTHKGLRKVACIGAWHPSRVSFTVARAGQKGYHHRTEMNKKIYRIGQGIHKKDGKVI 299

Query: 964  NHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVA 1143
             + A TE+D +EK ITPMGGFPHYG V +D+++IKG C+GPKKR++TLR+SL   T R A
Sbjct: 300  KNNASTEYDLSEKSITPMGGFPHYGEVNNDFVMIKGCCMGPKKRIITLRKSLRVHTKRAA 359

Query: 1144 LEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            LE+I LKFIDTSSKFGHGRFQT  +K  F G LK
Sbjct: 360  LEKINLKFIDTSSKFGHGRFQTPADKAAFMGTLK 393



>gb:AK088993_1175742 Mus musculus 2 days neonate thymus thymic cells
            cDNA, RIKEN full-length enriched library,
            clone:E430034L18 product:ribosomal protein L3, full
            insert sequence.>gb:BC009655_2090854 Mus musculus
            ribosomal protein L3, mRNA (cDNA clone MGC:6334
            IMAGE:3485069), complete cds.>gb:BC083134_2108538 Mus
            musculus ribosomal protein L3, mRNA (cDNA clone
            MGC:103388 IMAGE:6504713), complete
            cds.>gb:BC086257_2564830 Xenopus laevis hypothetical
            LOC495821, mRNA (cDNA clone MGC:98779 IMAGE:7201729),
            complete cds.
          Length = 403

 Score =  513 bits (1320), Expect = e-144
 Identities = 252/394 (63%), Positives = 311/394 (78%), Gaps = 6/394 (1%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKF  PRHGSLGFLPRKR+SR RGKVK+FPKDD+SKP  LTAFLGYKAGMTHIVREV
Sbjct: 1    MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDASKPVHLTAFLGYKAGMTHIVREV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK++KKE  EAVTIVETPPMV+VG+VGYV+TPRGLR   TV+A+H+++E +RRFYK
Sbjct: 61   DRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       ++     +KKY  VIR++AHTQ+R +  L+QKKAH
Sbjct: 121  NWHKSKKKAFTKYCKKWQDDTGKKQLEKDFNSMKKYCQVIRIIAHTQMRLLP-LRQKKAH 179

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQVNGGT+A+K+D+A    E+QVP++ VF +DEMID+IGVTKGKGY+GV +RW   +
Sbjct: 180  LMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKK 239

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG-----KVGQ-E 963
            LPRKTHRGLRKVACIGAWHPARV+F+VARAGQ GYHHRTE+NKKIYK+G     K G+  
Sbjct: 240  LPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLI 299

Query: 964  NHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVA 1143
             + A T++D ++K I P+GGF HYG V +D++++KG  VG KKRV+TLR+SLL QT R A
Sbjct: 300  KNNASTDYDLSDKSINPLGGFVHYGEVTNDFIMLKGCVVGTKKRVLTLRKSLLVQTKRRA 359

Query: 1144 LEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            LE+I LKFIDT+SKFGHGRFQT +EK+ F G LK
Sbjct: 360  LEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLK 393



>gb:BC042242_2548064 Xenopus laevis ribosomal protein L3, mRNA (cDNA
            clone MGC:53999 IMAGE:5571281), complete cds.
          Length = 403

 Score =  512 bits (1319), Expect = e-144
 Identities = 254/394 (64%), Positives = 309/394 (78%), Gaps = 6/394 (1%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKF  PRHGSLGFLPRKR  R RGKVK+FPKDD SKP  LTAFLGYKAGMTHIVREV
Sbjct: 1    MSHRKFSAPRHGSLGFLPRKRCKRHRGKVKSFPKDDPSKPIHLTAFLGYKAGMTHIVREV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK++KKE  EAVT+VETPPMVIVG+VGYV+TPRGLR L T++A+H+++E +RRFYK
Sbjct: 61   DRPGSKVNKKEVVEAVTVVETPPMVIVGIVGYVQTPRGLRSLKTIFAEHISDECKRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       ++     +KKY  VIRV+AHTQ+R +  L+QKK+H
Sbjct: 121  NWYKSKKKAFTKYCKKWQDEDGKKQLEKDFASMKKYCQVIRVIAHTQMRLLP-LRQKKSH 179

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQVNGGTIA+KVD+A    E+QV I  VF +DEMID+IGVTKGKGY+GV +RW   +
Sbjct: 180  LMEIQVNGGTIAEKVDWAREKLEQQVVIGGVFGQDEMIDVIGVTKGKGYKGVTSRWHTKK 239

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG-----KVGQ-E 963
            LPRKTHRGLRKVACIGAWHPARV+F+VARAGQ GYHHRTE+NKKIYK+G     K G+  
Sbjct: 240  LPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYHSKDGKLV 299

Query: 964  NHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVA 1143
             + A T++D ++K I P+GGF HYG VK+D++++KG  +G KKRV+TLR+SLL QTSR A
Sbjct: 300  KNNASTDYDLSDKSINPLGGFVHYGEVKNDFIMLKGCVIGTKKRVLTLRKSLLVQTSRRA 359

Query: 1144 LEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            LE+I LKFIDT+SKFGHGRFQT +EK+ F G LK
Sbjct: 360  LEKIDLKFIDTTSKFGHGRFQTVEEKKAFMGPLK 393



>sp|P27659|RL3_MOUSE 60S ribosomal protein L3 (J1 protein).
          Length = 402

 Score =  512 bits (1319), Expect = e-144
 Identities = 252/393 (64%), Positives = 310/393 (78%), Gaps = 6/393 (1%)
 Frame = +1

Query: 85   SHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVE 264
            SHRKF  PRHGSLGFLPRKR+SR RGKVK+FPKDD+SKP  LTAFLGYKAGMTHIVREV+
Sbjct: 1    SHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDASKPVHLTAFLGYKAGMTHIVREVD 60

Query: 265  KPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKN 444
            +PGSK++KKE  EAVTIVETPPMV+VG+VGYV+TPRGLR   TV+A+H+++E +RRFYKN
Sbjct: 61   RPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKN 120

Query: 445  WCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHV 624
            W                       ++     +KKY  VIR++AHTQ+R +  L+QKKAH+
Sbjct: 121  WHKSKKKAFTKYCKKWQDDTGKKQLEKDFNSMKKYCQVIRIIAHTQMRLLP-LRQKKAHL 179

Query: 625  MEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 804
            MEIQVNGGT+A+K+D+A    E+QVP++ VF +DEMID+IGVTKGKGY+GV +RW   +L
Sbjct: 180  MEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKL 239

Query: 805  PRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG-----KVGQ-EN 966
            PRKTHRGLRKVACIGAWHPARV+FTVARAGQ GYHHRTE+NKKIYK+G     K G+   
Sbjct: 240  PRKTHRGLRKVACIGAWHPARVAFTVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIK 299

Query: 967  HTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVAL 1146
            + A T++D ++K I P+GGF HYG V +D++++KG  VG KKRV+TLR+SLL QT R AL
Sbjct: 300  NNASTDYDLSDKSINPLGGFVHYGEVTNDFIMLKGCVVGTKKRVLTLRKSLLVQTKRRAL 359

Query: 1147 EEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            E+I LKFIDT+SKFGHGRFQT +EK+ F G LK
Sbjct: 360  EKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLK 392



>pir|JQ1536|R5RT3L ribosomal protein L3, cytosolic [validated] -
            rat>gb:BC058494_2103274 Rattus norvegicus ribosomal
            protein L3, mRNA (cDNA clone MGC:72934 IMAGE:6887923),
            complete cds.>gb:RRRPL3_2138205 R.rattus mRNA for
            ribosomal protein L3.
          Length = 403

 Score =  512 bits (1318), Expect = e-144
 Identities = 252/394 (63%), Positives = 310/394 (78%), Gaps = 6/394 (1%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKF  PRHGSLGFLPRKR+SR RGKVK+FPKDD SKP  LTAFLGYKAGMTHIVREV
Sbjct: 1    MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK++KKE  EAVTIVETPPMV+VG+VGYV+TPRGLR   TV+A+H+++E +RRFYK
Sbjct: 61   DRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       ++     +KKY  VIR++AHTQ+R +  L+QKKAH
Sbjct: 121  NWHKSKKKAFTKYCKKWQDDTGKKQLEKDFNSMKKYCQVIRIIAHTQMRLLP-LRQKKAH 179

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQVNGGT+A+K+D+A    E+QVP++ VF +DEMID+IGVTKGKGY+GV +RW   +
Sbjct: 180  LMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKK 239

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG-----KVGQ-E 963
            LPRKTHRGLRKVACIGAWHPARV+F+VARAGQ GYHHRTE+NKKIYK+G     K G+  
Sbjct: 240  LPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLI 299

Query: 964  NHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVA 1143
             + A T++D ++K I P+GGF HYG V +D++++KG  VG KKRV+TLR+SLL QT R A
Sbjct: 300  KNNASTDYDLSDKSINPLGGFVHYGEVTNDFIMLKGCVVGTKKRVLTLRKSLLVQTKRRA 359

Query: 1144 LEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            LE+I LKFIDT+SKFGHGRFQT +EK+ F G LK
Sbjct: 360  LEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLK 393



>pir|S34195|S34195 ribosomal protein L3, cytosolic -
            human>gb:AB062291_1868874 Homo sapiens OK/SW-cl.32 mRNA
            for ribosomal protein L3, complete
            cds.>gb:BC002408_1968088 Homo sapiens ribosomal protein
            L3, mRNA (cDNA clone MGC:8637 IMAGE:2961541), complete
            cds.>gb:BC006483_1970318 Homo sapiens ribosomal protein
            L3, mRNA (cDNA clone IMAGE:2905497), complete
            cds.>gb:BC008003_1971149 Homo sapiens ribosomal protein
            L3, mRNA (cDNA clone MGC:15830 IMAGE:3507481), complete
            cds.>gb:BC012146_1973473 Homo sapiens ribosomal protein
            L3, mRNA (cDNA clone MGC:20359 IMAGE:4549682), complete
            cds.>gb:BC012786_1973761 Homo sapiens ribosomal protein
            L3, mRNA (cDNA clone MGC:16463 IMAGE:3951917), complete
            cds.>gb:BC013674_1974169 Homo sapiens ribosomal protein
            L3, mRNA (cDNA clone MGC:17324 IMAGE:4152521), complete
            cds.>gb:BC014017_1974332 Homo sapiens ribosomal protein
            L3, mRNA (cDNA clone MGC:20304 IMAGE:4128023), complete
            cds.>gb:BC015032_1974915 Homo sapiens ribosomal protein
            L3, mRNA (cDNA clone IMAGE:3912046), complete
            cds.>gb:BC015767_1975297 Homo sapiens ribosomal protein
            L3, mRNA (cDNA clone MGC:23196 IMAGE:4861546), complete
            cds.>gb:BC063662_1986317 Homo sapiens ribosomal protein
            L3, mRNA (cDNA clone MGC:70878 IMAGE:3852576), complete
            cds.>gb:BC088373_1989980 Homo sapiens ribosomal protein
            L3, mRNA (cDNA clone MGC:111436 IMAGE:6195715), complete
            cds.>gb:CR456566_1992857 Homo sapiens RPL3 full length
            open reading frame (ORF) cDNA clone (cDNA clone
            C22ORF:pGEM.RPL3).>gb:HS333H23_1998117 Human DNA sequence
            from clone RP3-333H23 on chromosome 22q12.1-12.3 Contains
            the (possibly alternatively spliced) RPL3 gene for 60S
            Ribosomal Protein L3 and the threefold alternatively
            spliced gene for Synaptogyrin 1A, 1B and 1C (SYNGR1A,
            SYBGRIB, SYNGR1C), both genes downstream of a putative
            CpG island. Contains ESTs, an STS, GSSs, and a ca repeat
            (D22S1155) polymorphism, complete
            sequence.>gb:HSRPL3A_2020171 H.sapiens mRNA for ribosomal
            protein L3.
          Length = 403

 Score =  511 bits (1317), Expect = e-143
 Identities = 253/394 (64%), Positives = 310/394 (78%), Gaps = 6/394 (1%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKF  PRHGSLGFLPRKR+SR RGKVK+FPKDD SKP  LTAFLGYKAGMTHIVREV
Sbjct: 1    MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK++KKE  EAVTIVETPPMV+VG+VGYV+TPRGLR   TV+A+H+++E +RRFYK
Sbjct: 61   DRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       ++     +KKY  VIRV+AHTQ+R +  L+QKKAH
Sbjct: 121  NWHKSKKKAFTKYCKKWQDEDGKKQLEKDFSSMKKYCQVIRVIAHTQMRLLP-LRQKKAH 179

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQVNGGT+A+K+D+A    E+QVP++ VF +DEMID+IGVTKGKGY+GV +RW   +
Sbjct: 180  LMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKK 239

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG-----KVGQ-E 963
            LPRKTHRGLRKVACIGAWHPARV+F+VARAGQ GYHHRTE+NKKIYK+G     K G+  
Sbjct: 240  LPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLI 299

Query: 964  NHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVA 1143
             + A T++D ++K I P+GGF HYG V +D++++KG  VG KKRV+TLR+SLL QT R A
Sbjct: 300  KNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRA 359

Query: 1144 LEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            LE+I LKFIDT+SKFGHGRFQT +EK+ F G LK
Sbjct: 360  LEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLK 393



>sp|P39872|RL3_BOVIN 60S ribosomal protein L3.
          Length = 402

 Score =  511 bits (1316), Expect = e-143
 Identities = 252/393 (64%), Positives = 309/393 (78%), Gaps = 6/393 (1%)
 Frame = +1

Query: 85   SHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVE 264
            SHRKF  PRHGSLGFLPRKR+SR RGKVK+FPKDDSSKP  LTAFLGYKAGMTHIVREV+
Sbjct: 1    SHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDSSKPVHLTAFLGYKAGMTHIVREVD 60

Query: 265  KPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKN 444
            +PGSK++KKE  EAVTIVETPPMVIVG+VGYV+TPRGLR   T++A+H+++E +RRFYKN
Sbjct: 61   RPGSKVNKKEVVEAVTIVETPPMVIVGIVGYVETPRGLRTFKTIFAEHISDECKRRFYKN 120

Query: 445  WCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHV 624
            W                       ++     +KKY  VIRV+AHTQ+R +  L+QKKAH+
Sbjct: 121  WHKSKKKAFTKYCKKWQDADGKKQLERDFSSMKKYCQVIRVIAHTQMRLLP-LRQKKAHL 179

Query: 625  MEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 804
            ME+QVNGGT+A+K+D+A    E+QVP+  VF +DEMID+IGVTKGKGY+GV +RW   +L
Sbjct: 180  MEVQVNGGTVAEKLDWARERLEQQVPVSQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKL 239

Query: 805  PRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG-----KVGQ-EN 966
            PRKTHRGLRKVACIGAWHPARV+F+VARAGQ GYHHRTE+NKKIYK+G     K G+   
Sbjct: 240  PRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIK 299

Query: 967  HTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVAL 1146
            + A T++D ++K I P+GGF HYG V +D++++KG  VG KKRV+TLR+SLL QT R AL
Sbjct: 300  NNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRAL 359

Query: 1147 EEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            E+I LKFIDT+SKFGHGRFQT +EK+ F G LK
Sbjct: 360  EKIDLKFIDTTSKFGHGRFQTVEEKKAFMGPLK 392



>gb:BC008492_1971416 Homo sapiens ribosomal protein L3, mRNA (cDNA
            clone MGC:14821 IMAGE:4251511), complete cds.
          Length = 403

 Score =  511 bits (1315), Expect = e-143
 Identities = 253/394 (64%), Positives = 309/394 (78%), Gaps = 6/394 (1%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKF  PRHGSLGFLPRKR+SR RGKVK+FPKDD SKP  LTAFLGYKAGMTHIVREV
Sbjct: 1    MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK++KKE  EAVTIVETPPMV+VG+VGYV+TPRGLR   TV+A+H+++E +RRFYK
Sbjct: 61   DRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       ++     +KKY  VIRV+AHTQ+R +  L+QKKAH
Sbjct: 121  NWHKSKKKAFTKYCKKWQDEDGKKQLEKDFSSMKKYCQVIRVIAHTQMRLLP-LRQKKAH 179

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQVNGGT+A+K+D+A    E+QVP++ VF +DEMID+IGVTKGKGY+GV +RW   +
Sbjct: 180  LMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKK 239

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG-----KVGQ-E 963
            LPRKTHRGLRKVACIGAWHPARV+F+VARAGQ GYHHRTE+NKKIYK+G     K G+  
Sbjct: 240  LPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLI 299

Query: 964  NHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVA 1143
             + A T++D  +K I P+GGF HYG V +D++++KG  VG KKRV+TLR+SLL QT R A
Sbjct: 300  KNNASTDYDLPDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRA 359

Query: 1144 LEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            LE+I LKFIDT+SKFGHGRFQT +EK+ F G LK
Sbjct: 360  LEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLK 393



>pir|JC4382|JC4382 ribosomal protein L3.e, cytosolic - Toxocara
            canis>gb:TCU17358_1399870 Toxocara canis ribosomal
            protein L3 mRNA, complete cds.
          Length = 402

 Score =  510 bits (1313), Expect = e-143
 Identities = 246/391 (62%), Positives = 300/391 (76%), Gaps = 3/391 (0%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKF  PRHGS+GF P+KR+ R RGKVKAFPKDD +KP  LTAF+ +KAGMTHIVREV
Sbjct: 1    MSHRKFSAPRHGSMGFTPKKRSKRHRGKVKAFPKDDPTKPIHLTAFIAFKAGMTHIVREV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            +KPGSK++KKE  EAVTI E PPMVIVG+VGY+ TPRG R   TVWA+HL+E+ R RFYK
Sbjct: 61   DKPGSKVNKKEVVEAVTIFEAPPMVIVGIVGYIDTPRGPRQFKTVWAEHLSEDCRGRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       I++ L K+KKY   IRV+AHTQ++ MK  ++KKAH
Sbjct: 121  NWHTSKKKAFQKHAKKWQDEDGRKSIEADLNKMKKYCSKIRVIAHTQMKVMKH-REKKAH 179

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQ+NGGT+A+KVD+A    EKQVP+D+VF +DEMID IGVTKGKG++GV +RW   +
Sbjct: 180  IMEIQINGGTVAEKVDWAREHLEKQVPVDSVFAQDEMIDCIGVTKGKGFKGVTSRWHTKK 239

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGK---VGQENHT 972
            LPRKTH+GLRKVACIGAWHP+RV FTVARAGQ GYHHRTE+NKKIY+LGK     +    
Sbjct: 240  LPRKTHKGLRKVACIGAWHPSRVQFTVARAGQKGYHHRTEVNKKIYRLGKSCLTEEGKKN 299

Query: 973  ALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEE 1152
              T++D TEK + PMGGFPHYG+V  D+++I+G CVG KKR +TLR+SL+ QT R A E+
Sbjct: 300  GGTDYDITEKSVNPMGGFPHYGLVNQDFVMIRGCCVGSKKRPITLRKSLIVQTKRFAHEK 359

Query: 1153 IKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            I LK+IDTSSKFGHGRFQT  EK+ F G+LK
Sbjct: 360  INLKWIDTSSKFGHGRFQTHAEKRAFMGKLK 390



>sp|P21531|RL3_RAT 60S ribosomal protein L3 (L4).
          Length = 402

 Score =  510 bits (1313), Expect = e-143
 Identities = 251/393 (63%), Positives = 309/393 (78%), Gaps = 6/393 (1%)
 Frame = +1

Query: 85   SHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVE 264
            SHRKF  PRHGSLGFLPRKR+SR RGKVK+FPKDD SKP  LTAFLGYKAGMTHIVREV+
Sbjct: 1    SHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVD 60

Query: 265  KPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKN 444
            +PGSK++KKE  EAVTIVETPPMV+VG+VGYV+TPRGLR   TV+A+H+++E +RRFYKN
Sbjct: 61   RPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKN 120

Query: 445  WCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHV 624
            W                       ++     +KKY  VIR++AHTQ+R +  L+QKKAH+
Sbjct: 121  WHKSKKKAFTKYCKKWQDDTGKKQLEKDFNSMKKYCQVIRIIAHTQMRLLP-LRQKKAHL 179

Query: 625  MEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 804
            MEIQVNGGT+A+K+D+A    E+QVP++ VF +DEMID+IGVTKGKGY+GV +RW   +L
Sbjct: 180  MEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKL 239

Query: 805  PRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG-----KVGQ-EN 966
            PRKTHRGLRKVACIGAWHPARV+F+VARAGQ GYHHRTE+NKKIYK+G     K G+   
Sbjct: 240  PRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIK 299

Query: 967  HTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVAL 1146
            + A T++D ++K I P+GGF HYG V +D++++KG  VG KKRV+TLR+SLL QT R AL
Sbjct: 300  NNASTDYDLSDKSINPLGGFVHYGEVTNDFIMLKGCVVGTKKRVLTLRKSLLVQTKRRAL 359

Query: 1147 EEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            E+I LKFIDT+SKFGHGRFQT +EK+ F G LK
Sbjct: 360  EKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLK 392



>sp|P39023|RL3_HUMAN 60S ribosomal protein L3 (HIV-1 TAR RNA binding
            protein B) (TARBP-B).
          Length = 402

 Score =  509 bits (1312), Expect = e-143
 Identities = 252/393 (64%), Positives = 309/393 (78%), Gaps = 6/393 (1%)
 Frame = +1

Query: 85   SHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVE 264
            SHRKF  PRHGSLGFLPRKR+SR RGKVK+FPKDD SKP  LTAFLGYKAGMTHIVREV+
Sbjct: 1    SHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVD 60

Query: 265  KPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKN 444
            +PGSK++KKE  EAVTIVETPPMV+VG+VGYV+TPRGLR   TV+A+H+++E +RRFYKN
Sbjct: 61   RPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKN 120

Query: 445  WCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHV 624
            W                       ++     +KKY  VIRV+AHTQ+R +  L+QKKAH+
Sbjct: 121  WHKSKKKAFTKYCKKWQDEDGKKQLEKDFSSMKKYCQVIRVIAHTQMRLLP-LRQKKAHL 179

Query: 625  MEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 804
            MEIQVNGGT+A+K+D+A    E+QVP++ VF +DEMID+IGVTKGKGY+GV +RW   +L
Sbjct: 180  MEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKL 239

Query: 805  PRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG-----KVGQ-EN 966
            PRKTHRGLRKVACIGAWHPARV+F+VARAGQ GYHHRTE+NKKIYK+G     K G+   
Sbjct: 240  PRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIK 299

Query: 967  HTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVAL 1146
            + A T++D ++K I P+GGF HYG V +D++++KG  VG KKRV+TLR+SLL QT R AL
Sbjct: 300  NNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRAL 359

Query: 1147 EEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            E+I LKFIDT+SKFGHGRFQT +EK+ F G LK
Sbjct: 360  EKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLK 392



>sp|P49149|RL3_TOXCA 60S ribosomal protein L3.
          Length = 401

 Score =  508 bits (1308), Expect = e-142
 Identities = 245/390 (62%), Positives = 299/390 (76%), Gaps = 3/390 (0%)
 Frame = +1

Query: 85   SHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVE 264
            SHRKF  PRHGS+GF P+KR+ R RGKVKAFPKDD +KP  LTAF+ +KAGMTHIVREV+
Sbjct: 1    SHRKFSAPRHGSMGFTPKKRSKRHRGKVKAFPKDDPTKPIHLTAFIAFKAGMTHIVREVD 60

Query: 265  KPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKN 444
            KPGSK++KKE  EAVTI E PPMVIVG+VGY+ TPRG R   TVWA+HL+E+ R RFYKN
Sbjct: 61   KPGSKVNKKEVVEAVTIFEAPPMVIVGIVGYIDTPRGPRQFKTVWAEHLSEDCRGRFYKN 120

Query: 445  WCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHV 624
            W                       I++ L K+KKY   IRV+AHTQ++ MK  ++KKAH+
Sbjct: 121  WHTSKKKAFQKHAKKWQDEDGRKSIEADLNKMKKYCSKIRVIAHTQMKVMKH-REKKAHI 179

Query: 625  MEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 804
            MEIQ+NGGT+A+KVD+A    EKQVP+D+VF +DEMID IGVTKGKG++GV +RW   +L
Sbjct: 180  MEIQINGGTVAEKVDWAREHLEKQVPVDSVFAQDEMIDCIGVTKGKGFKGVTSRWHTKKL 239

Query: 805  PRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGK---VGQENHTA 975
            PRKTH+GLRKVACIGAWHP+RV FTVARAGQ GYHHRTE+NKKIY+LGK     +     
Sbjct: 240  PRKTHKGLRKVACIGAWHPSRVQFTVARAGQKGYHHRTEVNKKIYRLGKSCLTEEGKKNG 299

Query: 976  LTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEI 1155
             T++D TEK + PMGGFPHYG+V  D+++I+G CVG KKR +TLR+SL+ QT R A E+I
Sbjct: 300  GTDYDITEKSVNPMGGFPHYGLVNQDFVMIRGCCVGSKKRPITLRKSLIVQTKRFAHEKI 359

Query: 1156 KLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
             LK+IDTSSKFGHGRFQT  EK+ F G+LK
Sbjct: 360  NLKWIDTSSKFGHGRFQTHAEKRAFMGKLK 389



>gb:AE016817_1747590 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome IV, complete sequence.
          Length = 388

 Score =  508 bits (1307), Expect = e-142
 Identities = 245/388 (63%), Positives = 304/388 (78%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRK+E PRHG LGFLPRKRA+  RG+VKAFPKDD SKP  LT+FLGYKAGMT IVR++
Sbjct: 1    MSHRKYEAPRHGHLGFLPRKRAASIRGRVKAFPKDDKSKPVALTSFLGYKAGMTTIVRDL 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK HK+E  EAV++V+TPPMV+VGVVGY++TPRGLR L TVWA+HL++E++RRFYK
Sbjct: 61   DRPGSKFHKREIVEAVSVVDTPPMVVVGVVGYIETPRGLRSLTTVWAEHLSDEIKRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       I+ +L ++KKY+ V+RVLAHTQ+RK   L QKKAH
Sbjct: 121  NWYKSKKKAFTQVPPPSTAQDGAA-IERELARIKKYASVVRVLAHTQVRKTP-LVQKKAH 178

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            + EIQ+NGG++++KVD+A   FEK V +D+VF+++EMID+I VTKG G+EGV  RWG  +
Sbjct: 179  LAEIQLNGGSVSEKVDWAREHFEKTVSVDSVFEQNEMIDVIAVTKGHGFEGVTHRWGTKK 238

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTHRGLRKVACIGAWHPA V +TVARAGQNGYHHRT +N K+Y++GK G E + A T
Sbjct: 239  LPRKTHRGLRKVACIGAWHPAHVMWTVARAGQNGYHHRTSINHKVYRIGKGGDEGNAA-T 297

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
            EFDRT+K ITPMGGF HYG V +D++++KG   G +KRVVTLR+SL   TSR ALEE+ L
Sbjct: 298  EFDRTKKTITPMGGFVHYGAVNNDFVMVKGSIPGTRKRVVTLRKSLYTSTSRRALEEVNL 357

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            K+IDT+SKFG GRFQT  EK  F G LK
Sbjct: 358  KWIDTASKFGKGRFQTPAEKHAFMGTLK 385



>gb:AF464911_1802027 Aspergillus fumigatus large subunit ribosomal
            protein L3 mRNA, complete cds.
          Length = 392

 Score =  503 bits (1295), Expect = e-141
 Identities = 242/388 (62%), Positives = 302/388 (77%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRK+E PRHGSL FLPRKRA+R RGKVK+FPK D  KP  LTA +GYKAGMT +VR++
Sbjct: 1    MSHRKYEAPRHGSLAFLPRKRAARHRGKVKSFPKYDPKKPVHLTASMGYKAGMTTVVRDL 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PG+K+HKKE  EAVTI+ETPP+V VGVVGY++TPRGLR L TVWA+HL++E++RRFYK
Sbjct: 61   DRPGAKMHKKEIVEAVTIIETPPLVAVGVVGYIETPRGLRSLTTVWAEHLSDEVKRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       I  +LE++KKY  V+RVLAHTQIRK   LKQKKAH
Sbjct: 121  NW-YKSKKKAFTKYAKKHAEENGASITRELERIKKYCTVVRVLAHTQIRKTP-LKQKKAH 178

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQVNGG++A KVDFA   FEK + ID++F+KDEMID+I VTKG G++GV +RWG  +
Sbjct: 179  LMEIQVNGGSVADKVDFARNLFEKPIEIDSIFEKDEMIDVIAVTKGHGFQGVTSRWGTKK 238

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTH+GLRKVACIGAWHP+ V +TVARAGQ GYHHRT  N K++++GK G +   A T
Sbjct: 239  LPRKTHKGLRKVACIGAWHPSHVQWTVARAGQMGYHHRTSCNHKVFRIGK-GSDEGNAST 297

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
            +FD ++K ITPMGGF  YG VK+DY+++KG   G KKRV+TLR++L  QTSR A E+++L
Sbjct: 298  DFDISKKQITPMGGFVRYGEVKNDYIMVKGSVPGVKKRVMTLRKTLYPQTSRRATEKVEL 357

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            K+IDTSSKFGHG FQT +EK+ F G LK
Sbjct: 358  KWIDTSSKFGHGAFQTPEEKRAFMGTLK 385



>gb:AF526241_1279330 Chlamys farreri clone iolscfcl1ct2cn2 ribosomal
            protein L3 mRNA, partial cds.
          Length = 396

 Score =  503 bits (1294), Expect = e-141
 Identities = 248/393 (63%), Positives = 301/393 (76%), Gaps = 6/393 (1%)
 Frame = +1

Query: 85   SHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVE 264
            SHRKF  PRHGS GFLP+KRASR RGKVKAFP DD SKP  LTAF+GYKAGM+HIVR+V+
Sbjct: 3    SHRKFSAPRHGSKGFLPKKRASRHRGKVKAFPTDDKSKPVHLTAFIGYKAGMSHIVRDVD 62

Query: 265  KPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKN 444
            +PGSK +KKE  EAVTI+ETPPMVIVG+VGY++TP GLR   T++A+HLNE+ RRRFYKN
Sbjct: 63   RPGSKSNKKEIVEAVTIIETPPMVIVGLVGYIETPNGLRSFKTIFAEHLNEDCRRRFYKN 122

Query: 445  WCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHV 624
            W                      +I+   +K+KKY  VIRV+AHTQ + MK  +QKKAH+
Sbjct: 123  WYNCKKKAFTKYAKKWTDESGKKEIERDFQKMKKYCKVIRVIAHTQTKLMK-KRQKKAHI 181

Query: 625  MEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 804
            MEIQVNGGTIAQKVD+A    E  VP+ +VF  DE IDIIGVTKGKG +GV +RW   +L
Sbjct: 182  MEIQVNGGTIAQKVDWAREKMESSVPVGSVFAMDENIDIIGVTKGKGVKGVTSRWHTKKL 241

Query: 805  PRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG-----KVGQ-EN 966
            PRKTH+GLRKVACIGAWHP+RV FTVARAGQ GYHHRTE+N+KIY++G     K G+   
Sbjct: 242  PRKTHKGLRKVACIGAWHPSRVQFTVARAGQKGYHHRTEINEKIYRMGEGTHTKDGKLVK 301

Query: 967  HTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVAL 1146
            + A T+FD +EK+ITPMGGFPHYG V +D+++IKG  +GPKKR++TLR+SLL    +  +
Sbjct: 302  NNASTDFDPSEKNITPMGGFPHYGEVNNDFIMIKGCTMGPKKRILTLRKSLLPSFKKKQM 361

Query: 1147 EEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            E+I LKFIDT+SKFGHGRFQT +EK  F G LK
Sbjct: 362  EKINLKFIDTASKFGHGRFQTFEEKSNFMGPLK 394



>gb:BC080121_2561553 Xenopus laevis MGC84749 protein, mRNA (cDNA clone
            MGC:84749 IMAGE:6949842), complete cds.
          Length = 420

 Score =  502 bits (1292), Expect = e-141
 Identities = 250/412 (60%), Positives = 301/412 (73%), Gaps = 23/412 (5%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKF  PRHGS+GF P+KR+ R RGK KAFPKD  S P  LTAFLGYKAGMTH+VREV
Sbjct: 1    MSHRKFSAPRHGSMGFTPKKRSRRIRGKCKAFPKDRRSLPPHLTAFLGYKAGMTHVVREV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK+HK+E  E VTI+E PPMVIVG+VGY  T RGLR   TVWA+HL EE RRRFYK
Sbjct: 61   DRPGSKVHKREIVEPVTILECPPMVIVGMVGYAPTARGLRTFKTVWAEHLTEECRRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            +WC                     +I   L K+KKY  V+R +AHTQ+R MK  +QKKAH
Sbjct: 121  DWCKSKRKAFTKASKKWADEAGLKEINRDLRKIKKYCTVVRAIAHTQMRLMKH-RQKKAH 179

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQVNGGT+AQKVD+    FEKQ+P+  VF +DEMID+IGVTKGKG++GV +RW   +
Sbjct: 180  IMEIQVNGGTVAQKVDWIRQHFEKQIPVMNVFAQDEMIDVIGVTKGKGFKGVTSRWHTKK 239

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG----------- 948
            LPRKTH+GLRKVACIG+WHPARV  TVARAGQ GY HRTELNKKIY++G           
Sbjct: 240  LPRKTHKGLRKVACIGSWHPARVGSTVARAGQKGYFHRTELNKKIYRIGLGLQAQLEVAK 299

Query: 949  -KVGQENH-----------TALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKK 1092
             +  +E++            A TEFD T K+ITPMGGFPHYG V++DY++IKG C+GPKK
Sbjct: 300  SEAAKEDNKDKAALIKPKGNASTEFDLTAKNITPMGGFPHYGEVRNDYVMIKGCCMGPKK 359

Query: 1093 RVVTLRQSLLNQTSRVALEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLKA 1248
            RV+TLR+++L Q SR + E+I LKFIDTSSKFGHGRFQT  EK+   G LK+
Sbjct: 360  RVITLRKTILAQVSRRSKEKILLKFIDTSSKFGHGRFQTRAEKKAVMGPLKS 411



>gb:HUMRRL3A_2036426 Human ribosomal protein L3 mRNA, 3' end.
          Length = 398

 Score =  501 bits (1290), Expect = e-140
 Identities = 248/389 (63%), Positives = 305/389 (78%), Gaps = 6/389 (1%)
 Frame = +1

Query: 97   FEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPGS 276
            F  PRHGSLGFLPRKR+SR RGKVK+FPKDD SKP  LTAFLGYKAGMTHIVREV++PGS
Sbjct: 1    FSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPGS 60

Query: 277  KLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKNWCXX 456
            K++KKE  EAVTIVETPPMV+VG+VGYV+TPRGLR   TV+A+H+++E +RRFYKNW   
Sbjct: 61   KVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKNWHKS 120

Query: 457  XXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHVMEIQ 636
                                ++     +KKY  VIRV+AHTQ+R +  L+QKKAH+MEIQ
Sbjct: 121  KKKAFTKYCKKWQDEDGKKQLEKDFSSMKKYCQVIRVIAHTQMRLLP-LRQKKAHLMEIQ 179

Query: 637  VNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKT 816
            VNGGT+A+K+D+A    E+QVP++ VF +DEMID+IGVTKGKGY+GV +RW   +LPRKT
Sbjct: 180  VNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKT 239

Query: 817  HRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG-----KVGQ-ENHTAL 978
            HRGLRKVACIGAWHPARV+F+VARAGQ GYHHRTE+NKKIYK+G     K G+   + A 
Sbjct: 240  HRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNAS 299

Query: 979  TEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIK 1158
            T++D ++K I P+GGF HYG V +D++++KG  VG KKRV+TLR+SLL QT R ALE+I 
Sbjct: 300  TDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKID 359

Query: 1159 LKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            LKFIDT+SKFGHGRFQT +EK+ F G LK
Sbjct: 360  LKFIDTTSKFGHGRFQTMEEKKAFMGPLK 388



>gb:BT011339_1357821 Drosophila melanogaster RH62603 full insert cDNA.
          Length = 465

 Score =  501 bits (1290), Expect = e-140
 Identities = 244/397 (61%), Positives = 300/397 (75%), Gaps = 6/397 (1%)
 Frame = +1

Query: 73   RREMSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIV 252
            R +MSHRKF  PRHGS+ F P+KR++R RGKVKAFPKDD+SKP  LT F+GYKAGMTHIV
Sbjct: 9    RTDMSHRKFSAPRHGSMAFYPKKRSARHRGKVKAFPKDDASKPVHLTCFIGYKAGMTHIV 68

Query: 253  REVEKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRR 432
            RE ++PGSK++KKE  EAVT++ETPPM++VG VGY++TP GLR L  VWAQHL+EE RRR
Sbjct: 69   READRPGSKINKKEVVEAVTVLETPPMIVVGAVGYIETPFGLRALVNVWAQHLSEECRRR 128

Query: 433  FYKNWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQK 612
            FYKNW                       I++   K+ +Y  VIRV+AH+QIR +K  +QK
Sbjct: 129  FYKNWYKSKKKAFTKASKKWTDDLGKKSIENDFRKMLRYCKVIRVIAHSQIRLIK-QRQK 187

Query: 613  KAHVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWG 792
            KAHVMEIQ+NGG+I  KV +A    EK + +  VF +DEMID +GVTKGKG++GV +RW 
Sbjct: 188  KAHVMEIQLNGGSIEDKVKWAREHLEKPIQVSNVFGQDEMIDCVGVTKGKGFKGVTSRWH 247

Query: 793  VTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG-----KVG 957
              +LPRKTH+GLRKVACIGAWHP+RVS TVARAGQ GYHHRTE+NKKIY++G     K G
Sbjct: 248  TKKLPRKTHKGLRKVACIGAWHPSRVSTTVARAGQKGYHHRTEINKKIYRIGAGIHTKDG 307

Query: 958  QE-NHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTS 1134
            +   + A TE+D T+K ITPMGGFPHYG V +D+++IKG C+G KKR++TLR+SLL  T 
Sbjct: 308  KVIKNNASTEYDLTDKSITPMGGFPHYGEVNNDFVMIKGCCIGSKKRIITLRKSLLKHTK 367

Query: 1135 RVALEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            R ALE+IKLKFIDTSSK GHGRFQT  +K  F G LK
Sbjct: 368  RSALEQIKLKFIDTSSKMGHGRFQTPADKLAFMGPLK 404



>sp|P50880|RL3_CAEEL 60S ribosomal protein L3.>pir|T19771|T19771
            hypothetical protein F13B10.2 - Caenorhabditis
            elegans>gb:CEC36A4_1361030 Caenorhabditis elegans cosmid
            C36A4, complete sequence.>gb:CEF13B10_1362313
            Caenorhabditis elegans cosmid F13B10, complete
            sequence.>gb:CERPL3GN_1366930 C.elegans ribosomal protein
            L3 gene.>gb:CERPL3MR_1366931 C.elegans mRNA for ribosomal
            protein L3.
          Length = 401

 Score =  501 bits (1289), Expect = e-140
 Identities = 242/391 (61%), Positives = 297/391 (75%), Gaps = 3/391 (0%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKF  PRHG +GF P+KR+   RG++KAFPKDD SKP  LTAFLGYKAGMTHIVR+V
Sbjct: 1    MSHRKFSAPRHGHMGFTPKKRSRTYRGRIKAFPKDDKSKPIHLTAFLGYKAGMTHIVRDV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            +KPGSK++KKE  EAVTIVETPPMVI GV GYV TP+G R L T+WA+HL+EE RRRFY 
Sbjct: 61   DKPGSKVNKKEVVEAVTIVETPPMVIAGVTGYVDTPQGPRALTTIWAEHLSEEARRRFYS 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       I++   KLKKY   IRV+AHTQ++ ++  +QKKAH
Sbjct: 121  NWAKSKKKAFTKYAKKWQDEDGKKLIEADFAKLKKYCSSIRVIAHTQMKILR-RRQKKAH 179

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            ++EIQVNGGTI QKVD+A    EKQV +D VF +DEMID IGVT+G G++GV +RW   +
Sbjct: 180  LVEIQVNGGTIEQKVDWAREHLEKQVQVDTVFAQDEMIDTIGVTRGHGFKGVTSRWHTKK 239

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGK---VGQENHT 972
            LPRKTH+GLRKVACIGAWHP+RV+FTVARAGQ G+HHRT +N KIY++GK     +  + 
Sbjct: 240  LPRKTHKGLRKVACIGAWHPSRVAFTVARAGQKGFHHRTIINNKIYRIGKSALTEEGKNN 299

Query: 973  ALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEE 1152
              TEFD T+K ITPMGGFP YG+V  DY++++G  +GPKKR++TLR+SL+ QT RVA E+
Sbjct: 300  GSTEFDLTQKTITPMGGFPRYGIVNQDYIMLRGAVLGPKKRLITLRKSLITQTKRVAHEK 359

Query: 1153 IKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            I LK+IDTSSK GHGRFQTT EK+ F G+LK
Sbjct: 360  INLKWIDTSSKTGHGRFQTTAEKRAFMGKLK 390



>gb:AF401554_2491981 Ictalurus punctatus ribosomal protein L3 mRNA,
            complete cds.
          Length = 402

 Score =  500 bits (1288), Expect = e-140
 Identities = 251/397 (63%), Positives = 304/397 (76%), Gaps = 9/397 (2%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKF  PRHGSLGFLPRKRA+  RGKVK+FPKDD +KP  LTAFLGYKAGMTHIVREV
Sbjct: 1    MSHRKFSAPRHGSLGFLPRKRAA-SRGKVKSFPKDDPTKPVHLTAFLGYKAGMTHIVREV 59

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK++KKE  EAVTIVETPPM++VG+VGYV+TPRGLR   TV+A+H+++E RRRFYK
Sbjct: 60   DRPGSKVNKKEVVEAVTIVETPPMMVVGIVGYVETPRGLRSFKTVFAEHISDECRRRFYK 119

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       ++     +KKY  VIR++AHTQ+R +  L+QKK+H
Sbjct: 120  NWYKSKKKAFTKYSKKWQDDEGKKQLEKDFSSMKKYCKVIRIIAHTQMRLLP-LRQKKSH 178

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQ+NGGTI++KVD+A    E+ VPI+ VF +DEMID+IGVTKG GY+GV +RW   +
Sbjct: 179  LMEIQLNGGTISEKVDWAREKLEQAVPINNVFSQDEMIDVIGVTKGHGYKGVTSRWHTKK 238

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHT--- 972
            LPRKTHRGLRKVACIGAWHPARV+F+VARAGQ GYHHRTE+NKKIY   K+GQ  HT   
Sbjct: 239  LPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEVNKKIY---KIGQGYHTKDG 295

Query: 973  ------ALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTS 1134
                  A T++D + K I P+GGF HYG V +D+L++KG  VG KKRV+TLR+SLL QTS
Sbjct: 296  KVIKNNASTDYDLSNKSINPLGGFVHYGEVTNDFLMLKGCVVGTKKRVLTLRKSLLVQTS 355

Query: 1135 RVALEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            R ALE I LKFIDT+SKFGHGRFQT  EK+ F G LK
Sbjct: 356  RRALERIDLKFIDTTSKFGHGRFQTVDEKKAFMGPLK 392



>gb:AE014297_1138962 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003690_1220955 Drosophila melanogaster
            chromosome 3R, section 28 of 118 of the complete
            sequence.>gb:AF016835_1232849 Drosophila melanogaster
            ribosomal protein L3 (RpL3) mRNA, complete cds.
          Length = 416

 Score =  499 bits (1284), Expect = e-140
 Identities = 243/394 (61%), Positives = 298/394 (75%), Gaps = 6/394 (1%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKF  PRHGS+ F P+KR++R RGKVKAFPKDD+SKP  LT F+GYKAGMTHIVRE 
Sbjct: 1    MSHRKFSAPRHGSMAFYPKKRSARHRGKVKAFPKDDASKPVHLTCFIGYKAGMTHIVREA 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK++KKE  EAVT++ETPPM++VG VGY++TP GLR L  VWAQHL+EE RRRFYK
Sbjct: 61   DRPGSKINKKEVVEAVTVLETPPMIVVGAVGYIETPFGLRALVNVWAQHLSEECRRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       I++   K+ +Y  VIRV+AH+QIR +K  +QKKAH
Sbjct: 121  NWYKSKKKAFTKASKKWTDDLGKKSIENDFRKMLRYCKVIRVIAHSQIRLIK-QRQKKAH 179

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            VMEIQ+NGG+I  KV +A    EK + +  VF +DEMID +GVTKGKG++GV +RW   +
Sbjct: 180  VMEIQLNGGSIEDKVKWAREHLEKPIQVSNVFGQDEMIDCVGVTKGKGFKGVTSRWHTKK 239

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG-----KVGQE- 963
            LPRKTH+GLRKVACIGAWHP+RVS TVARAGQ GYHHRTE+NKKIY++G     K G+  
Sbjct: 240  LPRKTHKGLRKVACIGAWHPSRVSTTVARAGQKGYHHRTEINKKIYRIGAGIHTKDGKVI 299

Query: 964  NHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVA 1143
             + A TE+D T+K ITPMGGFPHYG V +D+++IKG C+G KKR++TLR+SLL  T R A
Sbjct: 300  KNNASTEYDLTDKSITPMGGFPHYGEVNNDFVMIKGCCIGSKKRIITLRKSLLKHTKRSA 359

Query: 1144 LEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            LE+IKLKFIDTSSK GHGRFQT  +K  F G LK
Sbjct: 360  LEQIKLKFIDTSSKMGHGRFQTPADKLAFMGPLK 393



>sp|P59671|RL3_NEUCR 60S ribosomal protein L3.>gb:NCB17B1_1689408
            Neurospora crassa DNA linkage group II BAC clone B17B1.
          Length = 392

 Score =  498 bits (1283), Expect = e-140
 Identities = 238/388 (61%), Positives = 302/388 (77%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRK+E PRHGSL +LPRKRA+R RGKVK+FPKDD+ KP  LTA +GYKAGMT IVR++
Sbjct: 1    MSHRKYEAPRHGSLAYLPRKRAARHRGKVKSFPKDDAKKPVHLTAAMGYKAGMTTIVRDL 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PG+K HKKE  EAVTI++TPPM++VG+VGY++TPRGLR L TVWA+HL++E++RRFYK
Sbjct: 61   DRPGAKAHKKEVVEAVTIIDTPPMIVVGLVGYIETPRGLRSLTTVWAEHLSDEVKRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       I  +LE++KKY  V+RVLAHTQIRK   LKQKKAH
Sbjct: 121  NWYKSKKKAFTKYVKKHSDNNGAA-ITRELERIKKYCTVVRVLAHTQIRKTP-LKQKKAH 178

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQ+NGG++A KV+F +G FEK V ID++F+KDE+ID+I VTKG G+ GV  RWG  +
Sbjct: 179  LMEIQINGGSVADKVEFGHGLFEKPVSIDSIFEKDEVIDVIAVTKGHGFTGVTARWGTKK 238

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTH+GLRKVACIGAWHP+ V +TVARAGQ GYHHRT +N KIY++GK G    +A T
Sbjct: 239  LPRKTHKGLRKVACIGAWHPSHVQWTVARAGQAGYHHRTSVNHKIYRIGK-GDAEDSAAT 297

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
            E D T+K ITPMGGF  YG + +D++++KG   G KKRV+TLR+S+   TSR ALE+++L
Sbjct: 298  EVDVTKKKITPMGGFVRYGEINNDFVMVKGSVPGVKKRVMTLRKSMFVHTSRKALEKVEL 357

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            K+IDTSS+FGHG FQT  EK++F G LK
Sbjct: 358  KWIDTSSEFGHGAFQTPAEKKQFQGTLK 385



>gb:AF198447_1776429 Emericella nidulans 60S ribosomal protein L3
            (rpl3) gene, complete cds.
          Length = 392

 Score =  498 bits (1281), Expect = e-139
 Identities = 237/388 (61%), Positives = 300/388 (77%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRK+E PRHGSL +LPRKRA+R RG+VK+FPKDD  KP  LTA +GYKAGMT +VR++
Sbjct: 1    MSHRKYEAPRHGSLAYLPRKRAARHRGRVKSFPKDDPKKPVHLTASMGYKAGMTTVVRDL 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PG+K+HKKE  EA T++ETPP++ VGVVGY++TPRGLR L TVWA+HL++E++RRFYK
Sbjct: 61   DRPGAKMHKKEIVEAATVIETPPLIAVGVVGYIETPRGLRSLATVWAEHLSDEVKRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       I   LE++KKY  V+RVLAHTQIRK   LKQKKAH
Sbjct: 121  NW-YKSKKKAFTKYAKKHSEENGASITRDLERIKKYCTVVRVLAHTQIRKTP-LKQKKAH 178

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQVNGG++A+KVDFA   FEK + ID +F+KDEMID+I VTKG G++GV +RWG  +
Sbjct: 179  LMEIQVNGGSVAEKVDFARNLFEKPIEIDTIFEKDEMIDVIAVTKGHGFQGVTSRWGTKK 238

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTH+GLRKVACIGAWHP+ V +TVARAGQ GYHHRT  N K++++GK G +   A T
Sbjct: 239  LPRKTHKGLRKVACIGAWHPSHVQWTVARAGQMGYHHRTSCNHKVFRIGK-GSDEANAST 297

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
            +FD ++K ITP+GGF  YG VK+D++L+KG   G KKRV+TLR++L  QTSR A E++ L
Sbjct: 298  DFDVSKKQITPLGGFVRYGEVKNDFILLKGSVPGVKKRVMTLRKTLYPQTSRRATEKVDL 357

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            K+IDTSSKFGHG FQT +EK+ F G LK
Sbjct: 358  KWIDTSSKFGHGAFQTPEEKRAFMGTLK 385



>gb:CR380953_1650705 Candida glabrata strain CBS138 chromosome G
            complete sequence.
          Length = 387

 Score =  497 bits (1280), Expect = e-139
 Identities = 241/388 (62%), Positives = 300/388 (77%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRK+E PRHG LGFLPRKRA+  RG+VK+FPKDD SKP  LT+FLGYKAGMT IVR++
Sbjct: 1    MSHRKYEAPRHGHLGFLPRKRAASVRGRVKSFPKDDKSKPVALTSFLGYKAGMTTIVRDL 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK HK+E  EAVT+V+TPP+V+VGVVGYV+TPRGLR L TVWA+HL++E++RRFYK
Sbjct: 61   DRPGSKFHKREIVEAVTVVDTPPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                      +I+ +L ++KKY+ V+RVL HTQ+RK   L QKKAH
Sbjct: 121  NW--YKSKKKAFTKYSAKYAQNGAEIERELARIKKYATVVRVLVHTQVRKTP-LVQKKAH 177

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            + EIQ+NGG+I++KVD+A   FEK V +D+VF+++EMID I VTKG G+EGV  RWG  +
Sbjct: 178  LAEIQLNGGSISEKVDWAREHFEKTVSVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKK 237

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTHRGLRKVACIGAWHPA V ++VARAGQ GYHHRT +N KIY++GK G +   A T
Sbjct: 238  LPRKTHRGLRKVACIGAWHPAHVMWSVARAGQRGYHHRTSINHKIYRIGK-GDDEGNAAT 296

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
             FDRT+K I PMGGF HYG+V +D++++KG   G KKRVVTLR+SL   TSR A+EE+ L
Sbjct: 297  NFDRTKKTINPMGGFVHYGMVNNDFVMVKGSIPGCKKRVVTLRKSLYTNTSRKAVEEVTL 356

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            K+IDT+SKFG GRFQT  EK  F G LK
Sbjct: 357  KWIDTASKFGKGRFQTPAEKHAFMGTLK 384



>gb:CR382134_1667020 Debaryomyces hansenii chromosome B of strain
            CBS767 of Debaryomyces hansenii.
          Length = 389

 Score =  497 bits (1279), Expect = e-139
 Identities = 240/388 (61%), Positives = 298/388 (76%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRK+E PRHGSLGFLPRKR++  RG+VK+FPKD  SKP  LTAFLGYKAGMT +VR++
Sbjct: 1    MSHRKYEAPRHGSLGFLPRKRSANIRGRVKSFPKDVKSKPVALTAFLGYKAGMTTVVRDL 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK+HK+E  EA T+V+TPP+V+VGVVGYV+TPRGLR L TVWA+HL+EE+RRRFYK
Sbjct: 61   DRPGSKMHKREIVEAATVVDTPPLVVVGVVGYVETPRGLRSLTTVWAEHLSEEVRRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       ++ +L ++KKY+ V+RVLAHTQI+K   L QKKAH
Sbjct: 121  NW--YKSKKKAFTKYSAKYAQDGAQVERELARIKKYASVVRVLAHTQIKKTP-LAQKKAH 177

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            + EIQVNGG+++ KVD+A   FEK V +D+VF+KDEM+D+  VTKG G+EGV  RWG  +
Sbjct: 178  LAEIQVNGGSVSDKVDWAKEHFEKTVSVDSVFEKDEMVDVAAVTKGHGFEGVTHRWGTKK 237

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTHRGLRKVACIGAWHPA V +TVARAGQNG+HHRT +N K+Y++G  G E+  A T
Sbjct: 238  LPRKTHRGLRKVACIGAWHPANVQWTVARAGQNGFHHRTSINHKVYRVGSAGDESSGA-T 296

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
            EFDRT+K I PMGGF  YG VK+D++L+KG   G KKR+VT+R+SL   TSR A E + L
Sbjct: 297  EFDRTKKTINPMGGFVRYGNVKNDFMLLKGSIPGVKKRIVTIRKSLYVDTSRRATENVNL 356

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            K+IDT+SKFG GRFQT  EK  F G LK
Sbjct: 357  KWIDTASKFGKGRFQTPAEKHAFLGTLK 384



>sp|O16797|RL3_DROME 60S ribosomal protein L3.
          Length = 415

 Score =  497 bits (1279), Expect = e-139
 Identities = 242/393 (61%), Positives = 297/393 (75%), Gaps = 6/393 (1%)
 Frame = +1

Query: 85   SHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVE 264
            SHRKF  PRHGS+ F P+KR++R RGKVKAFPKDD+SKP  LT F+GYKAGMTHIVRE +
Sbjct: 1    SHRKFSAPRHGSMAFYPKKRSARHRGKVKAFPKDDASKPVHLTCFIGYKAGMTHIVREAD 60

Query: 265  KPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKN 444
            +PGSK++KKE  EAVT++ETPPM++VG VGY++TP GLR L  VWAQHL+EE RRRFYKN
Sbjct: 61   RPGSKINKKEVVEAVTVLETPPMIVVGAVGYIETPFGLRALVNVWAQHLSEECRRRFYKN 120

Query: 445  WCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHV 624
            W                       I++   K+ +Y  VIRV+AH+QIR +K  +QKKAHV
Sbjct: 121  WYKSKKKAFTKASKKWTDDLGKKSIENDFRKMLRYCKVIRVIAHSQIRLIK-QRQKKAHV 179

Query: 625  MEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 804
            MEIQ+NGG+I  KV +A    EK + +  VF +DEMID +GVTKGKG++GV +RW   +L
Sbjct: 180  MEIQLNGGSIEDKVKWAREHLEKPIQVSNVFGQDEMIDCVGVTKGKGFKGVTSRWHTKKL 239

Query: 805  PRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG-----KVGQE-N 966
            PRKTH+GLRKVACIGAWHP+RVS TVARAGQ GYHHRTE+NKKIY++G     K G+   
Sbjct: 240  PRKTHKGLRKVACIGAWHPSRVSTTVARAGQKGYHHRTEINKKIYRIGAGIHTKDGKVIK 299

Query: 967  HTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVAL 1146
            + A TE+D T+K ITPMGGFPHYG V +D+++IKG C+G KKR++TLR+SLL  T R AL
Sbjct: 300  NNASTEYDLTDKSITPMGGFPHYGEVNNDFVMIKGCCIGSKKRIITLRKSLLKHTKRSAL 359

Query: 1147 EEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            E+IKLKFIDTSSK GHGRFQT  +K  F G LK
Sbjct: 360  EQIKLKFIDTSSKMGHGRFQTPADKLAFMGPLK 392



>gb:CR382126_1659086 Kluyveromyces lactis strain NRRL Y-1140
            chromosome F of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 387

 Score =  496 bits (1278), Expect = e-139
 Identities = 236/388 (60%), Positives = 299/388 (77%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRK+E PRHG LGFLPRKRA+  RG+VK+FPKDD +KP  LT+FLGYKAGM+ IVR++
Sbjct: 1    MSHRKYEAPRHGHLGFLPRKRAASVRGRVKSFPKDDQTKPVALTSFLGYKAGMSTIVRDL 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK HK+E  EAVT+V+TPP+V+VGVVGYV+TPRGLR L TVWA+HL++E++RRFYK
Sbjct: 61   DRPGSKFHKREVVEAVTVVDTPPIVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       +  +L ++KKY+ V+RVL HTQ+RK   L QKKAH
Sbjct: 121  NW--YKSKKKAFTKYSAKYAENGAQVDRELARIKKYASVVRVLVHTQVRKTP-LSQKKAH 177

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            + EIQ+NGG+++ KVD+A   FEK V +D+VF+++EMID++ VTKG G+EGV  RWG  +
Sbjct: 178  LAEIQLNGGSVSDKVDWAKEHFEKTVAVDSVFEQNEMIDVVAVTKGHGFEGVTHRWGTKK 237

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTHRGLRKVACIGAWHPA V ++VARAGQ GYHHRT +N K+Y++GK G +   A T
Sbjct: 238  LPRKTHRGLRKVACIGAWHPAHVMWSVARAGQRGYHHRTSINHKVYRVGK-GDDEANAAT 296

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
            EFDRT+K ITPMGGF HYG + +D++++KG   G +KRVVTLR+SL   TSR ALEE+ L
Sbjct: 297  EFDRTKKTITPMGGFVHYGAINNDFVILKGSIPGTRKRVVTLRKSLYTNTSRKALEEVTL 356

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            K+IDT+SKFG GRFQT  EK  F G LK
Sbjct: 357  KWIDTASKFGKGRFQTPAEKHAFLGTLK 384



>gb:BC082692_2562836 Xenopus laevis hypothetical LOC494722, mRNA (cDNA
            clone MGC:86190 IMAGE:6956294), complete cds.
          Length = 407

 Score =  495 bits (1274), Expect = e-138
 Identities = 241/394 (61%), Positives = 302/394 (76%), Gaps = 6/394 (1%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKF  PRHG LGFLP KR+ R RGKVK +PKDD SKP  LTAFLGYKAGMTH +RE+
Sbjct: 1    MSHRKFSAPRHGHLGFLPHKRSHRHRGKVKTWPKDDPSKPVHLTAFLGYKAGMTHTLREI 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
             +PG K+ K+E  EAVTI+ETPP+V+VG+VGYV+TPRGLR L T++A+H+++E +RRFY+
Sbjct: 61   HRPGLKISKREEVEAVTIIETPPLVVVGIVGYVETPRGLRSLKTIFAEHISDECKRRFYR 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       ++     +KKY  VIRV+ HTQ+ K+  L+QKKAH
Sbjct: 121  NWYKSKKKSFTKYCKKWQDEEGKKQLEKDFSAMKKYCKVIRVIIHTQM-KLLPLRQKKAH 179

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            VMEIQ+NGGT+A+KVD+A+   EKQVPI+ VF +DEMID+IGVTKGKG  GV +RW   +
Sbjct: 180  VMEIQLNGGTVAEKVDWAHEKLEKQVPINTVFCQDEMIDVIGVTKGKGVRGVTSRWHTKK 239

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGK-VGQEN---- 966
            LPRKTH+GLRKVACIGAWHPARV++T+ARAGQ GYHHRTE+NKKIY++GK +  E+    
Sbjct: 240  LPRKTHKGLRKVACIGAWHPARVAYTIARAGQKGYHHRTEINKKIYRIGKGIHLEDGKVV 299

Query: 967  -HTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVA 1143
             + A T++D T+K ITP+GGFPHYG V +DY+++KG  +G KKRV+TLR+SLL  TSR A
Sbjct: 300  KNNAATQYDITDKSITPLGGFPHYGQVNNDYVMLKGCVMGTKKRVLTLRKSLLVHTSRRA 359

Query: 1144 LEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            LE I+LKFIDT+SKFGHG FQT QEK+ F G  K
Sbjct: 360  LEAIELKFIDTTSKFGHGCFQTDQEKRAFMGSQK 393



>gb:AY561514_2537704 Danio rerio ribosomal protein L3 (rpl3) mRNA,
            complete cds.
          Length = 403

 Score =  494 bits (1271), Expect = e-138
 Identities = 244/395 (61%), Positives = 299/395 (75%), Gaps = 7/395 (1%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKF  P HGSLGFLPRKR  R RGKVK+FPKDD SKP  LTAFLGYKAGMTHIVREV
Sbjct: 1    MSHRKFSAPLHGSLGFLPRKRCKRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK++KKE  EAVT+VETPPM++VGVVGYV TPRGLR   T++A+H+++E +RRFYK
Sbjct: 61   DRPGSKVNKKEVVEAVTVVETPPMIVVGVVGYVMTPRGLRSFKTIFAEHISDECKRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       ++     +KKY  +IR++AHTQ+R +   +QKK+H
Sbjct: 121  NWYKSKKKAFTKYCKRWQDEEGKKQLEKDFSSMKKYCQIIRIIAHTQMRLLPH-RQKKSH 179

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQ+NGGTI+ KVD+A    E+ +PI  VF +DEMID+IGVTKG G +GV +RW   +
Sbjct: 180  LMEIQLNGGTISDKVDWAREKLEQSIPIANVFSQDEMIDVIGVTKGHGCKGVTSRWHTKK 239

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQEN----- 966
            LPRKTHRGLRKVACIGAWHPARV+F+VARAGQ GYHHRTE+NKKIYK+G VG  N     
Sbjct: 240  LPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIG-VGYHNKDGKL 298

Query: 967  --HTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRV 1140
              + A T++D + K I P+GGF HYG V +D+L++KG  VG KKRV+TLR+SLL QTSR 
Sbjct: 299  VKNNASTDYDLSNKSINPLGGFVHYGEVTNDFLMLKGCVVGTKKRVLTLRKSLLVQTSRR 358

Query: 1141 ALEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            A E+I LKFIDT+SKFGHGRFQT +EK+ F G LK
Sbjct: 359  AQEKIDLKFIDTTSKFGHGRFQTIEEKKTFMGPLK 393



>gb:CR382129_1662172 Yarrowia lipolytica chromosome C of strain CLIB99
            of Yarrowia lipolytica.
          Length = 387

 Score =  494 bits (1271), Expect = e-138
 Identities = 242/388 (62%), Positives = 294/388 (75%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRK+E PRHG LGFLPRKR ++ RGK K+FPKDD SKP  LTAFLGYKAGMT IVR++
Sbjct: 1    MSHRKYEQPRHGHLGFLPRKRCTKSRGKAKSFPKDDKSKPVALTAFLGYKAGMTTIVRDL 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++ GSK+ K+E  EA T+V+TPPMV+VGVVGYV TPRGLR L TVWA+HL+EE+RRRFYK
Sbjct: 61   DRRGSKMDKREIVEAATVVDTPPMVVVGVVGYVATPRGLRSLTTVWAEHLSEEVRRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       +Q +LE++KKY  V+RVLAHTQ  K+  LKQKKAH
Sbjct: 121  NW--YKSKKTAFTKYAKQYEGDAAQVQKELERIKKYCTVVRVLAHTQ-PKLTPLKQKKAH 177

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            + EIQ+NGG++A KV++A   FEK V ID VF++DEMID I +TKGKGYEG   RWG  +
Sbjct: 178  LAEIQINGGSVADKVEWAQQHFEKTVTIDTVFEQDEMIDAIAITKGKGYEGTTHRWGTKK 237

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTHRGLRKVACIGAWHPA V +TVAR+GQ+GYHHRT  N K+Y++GK G E++ + T
Sbjct: 238  LPRKTHRGLRKVACIGAWHPANVQYTVARSGQDGYHHRTSANHKVYRVGKGGDESNGS-T 296

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
            EFDRT K ITPMGGF  YG V +D+L++KG   G KKRV+TLR+S+   TSR  LE+ +L
Sbjct: 297  EFDRTPKTITPMGGFVRYGEVNNDFLILKGSIPGVKKRVITLRKSMWLHTSRRDLEKTQL 356

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            K+IDT+SKFG GRFQT  EK  F G LK
Sbjct: 357  KWIDTASKFGKGRFQTPAEKTAFMGTLK 384



>gb:AY223152_1176616 Schistosoma japonicum clone ZZD1512 mRNA
            sequence.
          Length = 419

 Score =  493 bits (1268), Expect = e-138
 Identities = 245/410 (59%), Positives = 295/410 (71%), Gaps = 22/410 (5%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKF  PRHGSLGF P+KR  R RGK KAFP+D  S P  LTAF+GYKAGMTHIVREV
Sbjct: 1    MSHRKFSAPRHGSLGFTPKKRCRRIRGKCKAFPRDRRSLPPHLTAFMGYKAGMTHIVREV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK+HK+E  E VTI+E PPMVIVG+VGY  T +GLR   TVWA+HL EE RRRFYK
Sbjct: 61   DRPGSKVHKREVVEPVTIMECPPMVIVGMVGYAPTAKGLRTFKTVWAEHLTEECRRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            +WC                      I   L+K+KKY  V+R +AHTQ+R MK  +QKKAH
Sbjct: 121  DWCKSKKKAFTKASRKWADEAGLALINRDLKKIKKYCTVVRAIAHTQMRLMKH-RQKKAH 179

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQVNGGTI+QKVD+    FEKQ+P+  VF +DEMID+IGVTKGKG++GV +RW   +
Sbjct: 180  IMEIQVNGGTISQKVDWIRQHFEKQIPVSNVFSQDEMIDVIGVTKGKGFKGVTSRWHTKK 239

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGK---------- 951
            LPRKTH+GLRKVACIGAWHPARV+ +VARAGQ GY HRTELNKKIY++G           
Sbjct: 240  LPRKTHKGLRKVACIGAWHPARVARSVARAGQKGYFHRTELNKKIYRIGMGLQAQLEVAK 299

Query: 952  ------------VGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKR 1095
                        + +    A TEFD T K+ITP+GGFPHYG V++DY++IKG C+GP+KR
Sbjct: 300  AEAAKDDRDKNVLPKPKGNASTEFDLTAKNITPIGGFPHYGEVRNDYVMIKGCCMGPRKR 359

Query: 1096 VVTLRQSLLNQTSRVALEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            V+TLR++L+ Q    + E+I LKFIDTSSKFGHGRFQT  EKQ   G LK
Sbjct: 360  VITLRKTLIPQIKPRSKEKIVLKFIDTSSKFGHGRFQTRAEKQAIMGPLK 409



>pir|S66946|R5BY4E ribosomal protein L3.e, cytosolic - yeast
            (Saccharomyces cerevisiae)>gb:SCXV55KB_1710984
            S.cerevisiae chromosome XV DNA, 54.7 kb
            region.>gb:SCYOR063W_1714288 S.cerevisiae chromosome XV
            reading frame ORF YOR063w.
          Length = 387

 Score =  492 bits (1266), Expect = e-138
 Identities = 240/388 (61%), Positives = 297/388 (76%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRK+E PRHG LGFLPRKRA+  R +VKAFPKDD SKP  LT+FLGYKAGMT IVR++
Sbjct: 1    MSHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDL 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK HK+E  EAVT+V+TPP+V+VGVVGYV+TPRGLR L TVWA+HL++E++RRFYK
Sbjct: 61   DRPGSKFHKREVVEAVTVVDTPPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       I+ +L ++KKY+ V+RVL HTQIRK   L QKKAH
Sbjct: 121  NW--YKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVLVHTQIRKTP-LAQKKAH 177

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            + EIQ+NGG+I++KVD+A   FEK V +D+VF+++EMID I VTKG G+EGV  RWG  +
Sbjct: 178  LAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKK 237

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTHRGLRKVACIGAWHPA V ++VARAGQ GYH RT +N KIY++GK G +     T
Sbjct: 238  LPRKTHRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGK-GDDEANGAT 296

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
             FDRT+K ITPMGGF HYG +K+D++++KG   G +KR+VTLR+SL   TSR ALEE+ L
Sbjct: 297  SFDRTKKTITPMGGFVHYGEIKNDFIMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSL 356

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            K+IDT+SKFG GRFQT  EK  F G LK
Sbjct: 357  KWIDTASKFGKGRFQTPAEKHAFMGTLK 384



>pir|JC4254|JC4254 ribosomal protein L3.e, cytosolic - slime mold
            (Dictyostelium discoideum)>gb:DDIL3A_1377111
            Dictyostelium discoideum ribosomal protein (L3) gene,
            complete cds.
          Length = 398

 Score =  491 bits (1263), Expect = e-137
 Identities = 239/394 (60%), Positives = 298/394 (75%), Gaps = 5/394 (1%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKFE PRHG+LGF PRKRA+R +GKVK+FPKDD ++   LTAF+GYKAGMTH+VR++
Sbjct: 1    MSHRKFEAPRHGNLGFRPRKRAARHQGKVKSFPKDDRTQKVHLTAFMGYKAGMTHVVRDL 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            EKPGSK+HKKE  EAVTI+E PPM IVG+VGYV+T +GL+   TVWAQHL++  RRR YK
Sbjct: 61   EKPGSKMHKKEIVEAVTIIECPPMYIVGLVGYVETAQGLKTYKTVWAQHLSDNFRRRLYK 120

Query: 442  NWC-XXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKA 618
            NW                        I++ L+ +KK   V+RV+AHTQ+ K+K L QKKA
Sbjct: 121  NWYKSKSKKAFTKYVKQYETEEGKKSIEASLQAIKKRCSVVRVIAHTQVHKLK-LTQKKA 179

Query: 619  HVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVT 798
            HV+EIQVNGG+I +KV+FA   FEK V +  VF ++E+ID+IGVTKGKG+ GV+ RWGV 
Sbjct: 180  HVLEIQVNGGSIVEKVNFAVANFEKTVNVTGVFAENELIDVIGVTKGKGFNGVIKRWGVR 239

Query: 799  RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKV----GQEN 966
            +LPRKTH+GLRKVACIGAWHP+RVS TV RAGQ GYHHR E NKKIY++G+     G++ 
Sbjct: 240  KLPRKTHKGLRKVACIGAWHPSRVSTTVPRAGQLGYHHRVERNKKIYRIGQAQPEDGKQI 299

Query: 967  HTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVAL 1146
             T  TEFD TEK I PMGGF HYG+VK ++L++KG   GP+KR +TLR+S+  QT R AL
Sbjct: 300  STGKTEFDLTEKTINPMGGFAHYGMVKHEFLMLKGCVAGPRKRALTLRKSITTQTGRAAL 359

Query: 1147 EEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLKA 1248
            E+I LKFIDTSSKFGHG  QT ++K K+FG  K+
Sbjct: 360  EKITLKFIDTSSKFGHGLHQTAEDKTKYFGVKKS 393



>sp|P14126|RL3_YEAST 60S ribosomal protein L3 (YL1) (RP1)
            (Trichodermin resistance protein).
          Length = 386

 Score =  490 bits (1261), Expect = e-137
 Identities = 239/387 (61%), Positives = 296/387 (76%)
 Frame = +1

Query: 85   SHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVE 264
            SHRK+E PRHG LGFLPRKRA+  R +VKAFPKDD SKP  LT+FLGYKAGMT IVR+++
Sbjct: 1    SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDLD 60

Query: 265  KPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKN 444
            +PGSK HK+E  EAVT+V+TPP+V+VGVVGYV+TPRGLR L TVWA+HL++E++RRFYKN
Sbjct: 61   RPGSKFHKREVVEAVTVVDTPPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYKN 120

Query: 445  WCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHV 624
            W                       I+ +L ++KKY+ V+RVL HTQIRK   L QKKAH+
Sbjct: 121  W--YKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVLVHTQIRKTP-LAQKKAHL 177

Query: 625  MEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 804
             EIQ+NGG+I++KVD+A   FEK V +D+VF+++EMID I VTKG G+EGV  RWG  +L
Sbjct: 178  AEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKL 237

Query: 805  PRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTE 984
            PRKTHRGLRKVACIGAWHPA V ++VARAGQ GYH RT +N KIY++GK G +     T 
Sbjct: 238  PRKTHRGLRKVACIGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGK-GDDEANGATS 296

Query: 985  FDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLK 1164
            FDRT+K ITPMGGF HYG +K+D++++KG   G +KR+VTLR+SL   TSR ALEE+ LK
Sbjct: 297  FDRTKKTITPMGGFVHYGEIKNDFIMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSLK 356

Query: 1165 FIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            +IDT+SKFG GRFQT  EK  F G LK
Sbjct: 357  WIDTASKFGKGRFQTPAEKHAFMGTLK 383



>sp|P34113|RL3_DICDI 60S ribosomal protein L3.
          Length = 397

 Score =  489 bits (1258), Expect = e-137
 Identities = 238/393 (60%), Positives = 297/393 (75%), Gaps = 5/393 (1%)
 Frame = +1

Query: 85   SHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVE 264
            SHRKFE PRHG+LGF PRKRA+R +GKVK+FPKDD ++   LTAF+GYKAGMTH+VR++E
Sbjct: 1    SHRKFEAPRHGNLGFRPRKRAARHQGKVKSFPKDDRTQKVHLTAFMGYKAGMTHVVRDLE 60

Query: 265  KPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKN 444
            KPGSK+HKKE  EAVTI+E PPM IVG+VGYV+T +GL+   TVWAQHL++  RRR YKN
Sbjct: 61   KPGSKMHKKEIVEAVTIIECPPMYIVGLVGYVETAQGLKTYKTVWAQHLSDNFRRRLYKN 120

Query: 445  WC-XXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            W                        I++ L+ +KK   V+RV+AHTQ+ K+K L QKKAH
Sbjct: 121  WYKSKSKKAFTKYVKQYETEEGKKSIEASLQAIKKRCSVVRVIAHTQVHKLK-LTQKKAH 179

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            V+EIQVNGG+I +KV+FA   FEK V +  VF ++E+ID+IGVTKGKG+ GV+ RWGV +
Sbjct: 180  VLEIQVNGGSIVEKVNFAVANFEKTVNVTGVFAENELIDVIGVTKGKGFNGVIKRWGVRK 239

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKV----GQENH 969
            LPRKTH+GLRKVACIGAWHP+RVS TV RAGQ GYHHR E NKKIY++G+     G++  
Sbjct: 240  LPRKTHKGLRKVACIGAWHPSRVSTTVPRAGQLGYHHRVERNKKIYRIGQAQPEDGKQIS 299

Query: 970  TALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALE 1149
            T  TEFD TEK I PMGGF HYG+VK ++L++KG   GP+KR +TLR+S+  QT R ALE
Sbjct: 300  TGKTEFDLTEKTINPMGGFAHYGMVKHEFLMLKGCVAGPRKRALTLRKSITTQTGRAALE 359

Query: 1150 EIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLKA 1248
            +I LKFIDTSSKFGHG  QT ++K K+FG  K+
Sbjct: 360  KITLKFIDTSSKFGHGLHQTAEDKTKYFGVKKS 392



>gb:YSCRP13_1730487 S.cerevisiae ribosomal protein L3 (tcm1) gene.
          Length = 387

 Score =  487 bits (1253), Expect = e-136
 Identities = 239/388 (61%), Positives = 296/388 (76%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRK+E PRHG LGFLPRKRA+  R +VKAFPKDD SKP  LT+FLGYKAGMT IVR++
Sbjct: 1    MSHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKAGMTTIVRDL 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK HK+E  EAVT+V+TPP+V+VGVVGYV+TPRGLR L TVWA+HL++E++RRFYK
Sbjct: 61   DRPGSKFHKREVVEAVTVVDTPPVVVVGVVGYVETPRGLRSLTTVWAEHLSDEVKRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       I+ +L ++KKY+ V+RVL HTQIRK   L QKKAH
Sbjct: 121  NW--YKSKKKAFTKYSAKYAQDGAGIERELARIKKYASVVRVLVHTQIRKTP-LAQKKAH 177

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            + EIQ+NGG+I++KVD+A   FEK V +D+VF+++EMID I VTKG G+EGV  RWG  +
Sbjct: 178  LAEIQLNGGSISEKVDWAREHFEKTVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKK 237

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTHRGLRKVACIGA HPA V ++VARAGQ GYH RT +N KIY++GK G +     T
Sbjct: 238  LPRKTHRGLRKVACIGACHPAHVMWSVARAGQRGYHSRTSINHKIYRVGK-GDDEANGAT 296

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
             FDRT+K ITPMGGF HYG +K+D++++KG   G +KR+VTLR+SL   TSR ALEE+ L
Sbjct: 297  SFDRTKKTITPMGGFVHYGEIKNDFIMVKGCIPGNRKRIVTLRKSLYTNTSRKALEEVSL 356

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            K+IDT+SKFG GRFQT  EK  F G LK
Sbjct: 357  KWIDTASKFGKGRFQTPAEKHAFMGTLK 384



>gb:AE014185_937848 Plasmodium falciparum 3D7 chromosome 10 complete
            sequence.>gb:AE014833_1228582 Plasmodium falciparum 3D7
            chromosome 10 section 5 of 7 of the complete sequence.
          Length = 386

 Score =  476 bits (1226), Expect = e-133
 Identities = 230/388 (59%), Positives = 289/388 (74%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKFE PRHGSLGFLPRKR  R RGK+++FPKDD  KP   TAF+GYKAGMTHIVREV
Sbjct: 1    MSHRKFERPRHGSLGFLPRKRCKRLRGKIRSFPKDDKEKPPHFTAFMGYKAGMTHIVREV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            +KPGSKLHKKE  EA TI+E  PMV+VG+VGY +TP+GLR L+TVWA H+++E RRR+YK
Sbjct: 61   DKPGSKLHKKEIVEACTIIECAPMVVVGIVGYRETPKGLRILSTVWANHVSDEFRRRYYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                           L++++KY  V+R + HTQ  K   L+ KKAH
Sbjct: 121  NWYKSEKKAFTKSLNVPEATK-----NCLLKRIEKYCTVLRAICHTQPSKTP-LRMKKAH 174

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +ME+Q+NGG++ +K++F     EK +P+  VF  +EMID+I VTKG G +GVV+R+GV R
Sbjct: 175  IMEVQINGGSMKEKLEFVKEMLEKNLPVSTVFNPNEMIDVISVTKGHGTKGVVSRYGVKR 234

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTHRGLRKVACIGAWHPARV F + R GQ GY HRTE NKKIY++G +  + ++A T
Sbjct: 235  LPRKTHRGLRKVACIGAWHPARVQFQIPRHGQKGYFHRTERNKKIYRIG-LKTDKNSAST 293

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
            + D TEK ITPMGGFPHYGVV +D+LL+KG   G KKR +TLR++++ Q SR AL ++ L
Sbjct: 294  DADITEKKITPMGGFPHYGVVNEDFLLLKGCVAGTKKRPITLRKNIVPQVSRDALAQVSL 353

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            KFIDTSSK GHGRFQT++EK K++G LK
Sbjct: 354  KFIDTSSKIGHGRFQTSEEKVKYYGPLK 381



>gb:AE014297_1138964 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE014297_1138965 Drosophila melanogaster
            chromosome 3R, complete sequence.>gb:AE003690_1220957
            Drosophila melanogaster chromosome 3R, section 28 of 118
            of the complete sequence.>gb:AE003690_1220958 Drosophila
            melanogaster chromosome 3R, section 28 of 118 of the
            complete sequence.
          Length = 403

 Score =  475 bits (1223), Expect = e-133
 Identities = 232/381 (60%), Positives = 287/381 (75%), Gaps = 6/381 (1%)
 Frame = +1

Query: 121  LGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKETC 300
            + F P+KR++R RGKVKAFPKDD+SKP  LT F+GYKAGMTHIVRE ++PGSK++KKE  
Sbjct: 1    MAFYPKKRSARHRGKVKAFPKDDASKPVHLTCFIGYKAGMTHIVREADRPGSKINKKEVV 60

Query: 301  EAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKNWCXXXXXXXXXX 480
            EAVT++ETPPM++VG VGY++TP GLR L  VWAQHL+EE RRRFYKNW           
Sbjct: 61   EAVTVLETPPMIVVGAVGYIETPFGLRALVNVWAQHLSEECRRRFYKNWYKSKKKAFTKA 120

Query: 481  XXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHVMEIQVNGGTIAQ 660
                        I++   K+ +Y  VIRV+AH+QIR +K  +QKKAHVMEIQ+NGG+I  
Sbjct: 121  SKKWTDDLGKKSIENDFRKMLRYCKVIRVIAHSQIRLIK-QRQKKAHVMEIQLNGGSIED 179

Query: 661  KVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVA 840
            KV +A    EK + +  VF +DEMID +GVTKGKG++GV +RW   +LPRKTH+GLRKVA
Sbjct: 180  KVKWAREHLEKPIQVSNVFGQDEMIDCVGVTKGKGFKGVTSRWHTKKLPRKTHKGLRKVA 239

Query: 841  CIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG-----KVGQE-NHTALTEFDRTEK 1002
            CIGAWHP+RVS TVARAGQ GYHHRTE+NKKIY++G     K G+   + A TE+D T+K
Sbjct: 240  CIGAWHPSRVSTTVARAGQKGYHHRTEINKKIYRIGAGIHTKDGKVIKNNASTEYDLTDK 299

Query: 1003 DITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLKFIDTSS 1182
             ITPMGGFPHYG V +D+++IKG C+G KKR++TLR+SLL  T R ALE+IKLKFIDTSS
Sbjct: 300  SITPMGGFPHYGEVNNDFVMIKGCCIGSKKRIITLRKSLLKHTKRSALEQIKLKFIDTSS 359

Query: 1183 KFGHGRFQTTQEKQKFFGRLK 1245
            K GHGRFQT  +K  F G LK
Sbjct: 360  KMGHGRFQTPADKLAFMGPLK 380



>gb:BC050413_1984326 Homo sapiens ribosomal protein L3-like, mRNA
            (cDNA clone MGC:54082 IMAGE:6204847), complete
            cds.>gb:HSU65581_2025514 Human ribosomal protein L3-like
            mRNA, complete cds.
          Length = 407

 Score =  472 bits (1215), Expect = e-132
 Identities = 231/394 (58%), Positives = 288/394 (73%), Gaps = 6/394 (1%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKF  PRHG LGFLP KR+ R RGKVK +P+DD S+P  LTAFLGYKAGMTH +REV
Sbjct: 1    MSHRKFSAPRHGHLGFLPHKRSHRHRGKVKTWPRDDPSQPVHLTAFLGYKAGMTHTLREV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
             +PG K+ K+E  EAVTIVETPP+V+VGVVGYV TPRGLR   T++A+HL++E RRRFYK
Sbjct: 61   HRPGLKISKREEVEAVTIVETPPLVVVGVVGYVATPRGLRSFKTIFAEHLSDECRRRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            +W                       +Q     +KKY  VIRV+ HTQ+ K+   +QKKAH
Sbjct: 121  DWHKSKKKAFTKACKRWRDTDGKKQLQKDFAAMKKYCKVIRVIVHTQM-KLLPFRQKKAH 179

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            +MEIQ+NGGT+A+KV +A    EKQVP+ +VF + E+ID+I VTKG+G +GV +RW   +
Sbjct: 180  IMEIQLNGGTVAEKVAWAQARLEKQVPVHSVFSQSEVIDVIAVTKGRGVKGVTSRWHTKK 239

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQ------E 963
            LPRKTH+GLRKVACIGAWHPARV  ++ARAGQ GYHHRTELNKKI+++G+          
Sbjct: 240  LPRKTHKGLRKVACIGAWHPARVGCSIARAGQKGYHHRTELNKKIFRIGRGPHMEDGKLV 299

Query: 964  NHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVA 1143
             + A T +D T K ITP+GGFPHYG V +D++++KG   G KKRV+TLR+SLL   SR A
Sbjct: 300  KNNASTSYDVTAKSITPLGGFPHYGEVNNDFVMLKGCIAGTKKRVITLRKSLLVHHSRQA 359

Query: 1144 LEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            +E I+LKFIDT+SKFGHGRFQT QEK+ F G  K
Sbjct: 360  VENIELKFIDTTSKFGHGRFQTAQEKRAFMGPQK 393



>gb:TTH012585_1401136 Tetrahymena thermophila macronuclear gene
            encoding ribosomal protein L3, exons 1-2.
          Length = 391

 Score =  470 bits (1210), Expect = e-131
 Identities = 228/389 (58%), Positives = 291/389 (74%), Gaps = 3/389 (0%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKFE PRHGSLGF PR+R    RG+ ++FPKDD SK   LTAF G+KAGMTHI+REV
Sbjct: 1    MSHRKFEAPRHGSLGFRPRRRTRHHRGRCRSFPKDDPSKKPHLTAFTGFKAGMTHILREV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++ GS+ +KKE  EAVT++E PPM IVGVVGY+ TPRGLR L TVWA+ ++   ++RFYK
Sbjct: 61   DRSGSRHNKKEVVEAVTVIECPPMTIVGVVGYIDTPRGLRALTTVWAKTIDNNTKKRFYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQ---LEKLKKYSCVIRVLAHTQIRKMKGLKQK 612
            NW                      D ++Q   L++++KY  V+RV+AHT + K+  L+QK
Sbjct: 121  NW-------ANSNKKAFTHHEKNFDQKAQDLLLKRIEKYCSVVRVIAHTNMSKL-NLRQK 172

Query: 613  KAHVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWG 792
            K H++EIQVNGG +A+KV FA    EK+V +D++F ++EM+D++GVTKGKG+ GV+ R+G
Sbjct: 173  KNHILEIQVNGGKVAEKVAFAKSLLEKEVKVDSIFAENEMLDVLGVTKGKGFAGVIKRFG 232

Query: 793  VTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHT 972
            V  L +KTHRG RKV CIGAWHP+R+ FTV RAGQ GYHHRTE NKK+Y++GK G +   
Sbjct: 233  VKHLQKKTHRGYRKVGCIGAWHPSRIRFTVPRAGQLGYHHRTETNKKVYRVGK-GDDASN 291

Query: 973  ALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEE 1152
            A T  D T+K ITP+GGFPHYGVVK+D+++IKG CVGPKKRV+TLR+S++ QT   A E 
Sbjct: 292  ASTAGDVTDKAITPLGGFPHYGVVKNDFIMIKGCCVGPKKRVLTLRKSIIPQTHGAAKEI 351

Query: 1153 IKLKFIDTSSKFGHGRFQTTQEKQKFFGR 1239
            I LKFIDTSSK GHGRFQT +EK KFFGR
Sbjct: 352  INLKFIDTSSKIGHGRFQTVEEKDKFFGR 380



>sp|Q92901|RL3L_HUMAN 60S ribosomal protein
            L3-like.>gb:AE006640_1875685 Homo sapiens 16p13.3
            sequence section 8 of 8.
          Length = 406

 Score =  470 bits (1210), Expect = e-131
 Identities = 230/393 (58%), Positives = 287/393 (73%), Gaps = 6/393 (1%)
 Frame = +1

Query: 85   SHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVE 264
            SHRKF  PRHG LGFLP KR+ R RGKVK +P+DD S+P  LTAFLGYKAGMTH +REV 
Sbjct: 1    SHRKFSAPRHGHLGFLPHKRSHRHRGKVKTWPRDDPSQPVHLTAFLGYKAGMTHTLREVH 60

Query: 265  KPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKN 444
            +PG K+ K+E  EAVTIVETPP+V+VGVVGYV TPRGLR   T++A+HL++E RRRFYK+
Sbjct: 61   RPGLKISKREEVEAVTIVETPPLVVVGVVGYVATPRGLRSFKTIFAEHLSDECRRRFYKD 120

Query: 445  WCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHV 624
            W                       +Q     +KKY  VIRV+ HTQ+ K+   +QKKAH+
Sbjct: 121  WHKSKKKAFTKACKRWRDTDGKKQLQKDFAAMKKYCKVIRVIVHTQM-KLLPFRQKKAHI 179

Query: 625  MEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 804
            MEIQ+NGGT+A+KV +A    EKQVP+ +VF + E+ID+I VTKG+G +GV +RW   +L
Sbjct: 180  MEIQLNGGTVAEKVAWAQARLEKQVPVHSVFSQSEVIDVIAVTKGRGVKGVTSRWHTKKL 239

Query: 805  PRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQ------EN 966
            PRKTH+GLRKVACIGAWHPARV  ++ARAGQ GYHHRTELNKKI+++G+           
Sbjct: 240  PRKTHKGLRKVACIGAWHPARVGCSIARAGQKGYHHRTELNKKIFRIGRGPHMEDGKLVK 299

Query: 967  HTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVAL 1146
            + A T +D T K ITP+GGFPHYG V +D++++KG   G KKRV+TLR+SLL   SR A+
Sbjct: 300  NNASTSYDVTAKSITPLGGFPHYGEVNNDFVMLKGCIAGTKKRVITLRKSLLVHHSRQAV 359

Query: 1147 EEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            E I+LKFIDT+SKFGHGRFQT QEK+ F G  K
Sbjct: 360  ENIELKFIDTTSKFGHGRFQTAQEKRAFMGPQK 392



>gb:BC022790_1977977 Homo sapiens, clone IMAGE:3538792, mRNA, partial
            cds.
          Length = 374

 Score =  460 bits (1184), Expect = e-128
 Identities = 228/365 (62%), Positives = 284/365 (77%), Gaps = 6/365 (1%)
 Frame = +1

Query: 169  KAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKETCEAVTIVETPPMVIVGV 348
            K+FPKDD SKP  LTAFLGYKAGMTHIVREV++PGSK++KKE  EAVTIVETPPMV+VG+
Sbjct: 1    KSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMVVVGI 60

Query: 349  VGYVKTPRGLRCLNTVWAQHLNEELRRRFYKNWCXXXXXXXXXXXXXXXXXXXXXDIQSQ 528
            VGYV+TPRGLR   TV+A+H+++E +RRFYKNW                       ++  
Sbjct: 61   VGYVETPRGLRTFKTVFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDEDGKKQLEKD 120

Query: 529  LEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHVMEIQVNGGTIAQKVDFAYGFFEKQVPID 708
               +KKY  VIRV+AHTQ+R +  L+QKKAH+MEIQVNGGT+A+K+D+A    E+QVP++
Sbjct: 121  FSSMKKYCQVIRVIAHTQMRLLP-LRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVN 179

Query: 709  AVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVAR 888
             VF +DEMID+IGVTKGKGY+GV +RW   +LPRKTHRGLRKVACIGAWHPARV+F+VAR
Sbjct: 180  QVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVAR 239

Query: 889  AGQNGYHHRTELNKKIYKLG-----KVGQ-ENHTALTEFDRTEKDITPMGGFPHYGVVKD 1050
            AGQ GYHHRTE+NKKIYK+G     K G+   + A T++D ++K I P+GGF HYG V +
Sbjct: 240  AGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTN 299

Query: 1051 DYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLKFIDTSSKFGHGRFQTTQEKQKF 1230
            D++++KG  VG KKRV+TLR+SLL QT R ALE+I LKFIDT+SKFGHGRFQT +EK+ F
Sbjct: 300  DFVMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAF 359

Query: 1231 FGRLK 1245
             G LK
Sbjct: 360  MGPLK 364



>gb:AF225211_1252646 Trypanoplasma borreli ribosomal protein L3,
            genomic sequence.
          Length = 416

 Score =  457 bits (1177), Expect = e-127
 Identities = 223/391 (57%), Positives = 284/391 (72%), Gaps = 3/391 (0%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSH KFEHPRHG LGFLPRKR+ + RG+ ++FPKDD S+   LT+F+ +KAGMTHIVR++
Sbjct: 1    MSHCKFEHPRHGHLGFLPRKRSRQIRGRCRSFPKDDPSQKPHLTSFMVFKAGMTHIVRDL 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            ++PGSK++KKE  E VTI+E PPM IVGV GY +T  G +C+ TVWA H+++E RRR+YK
Sbjct: 61   DRPGSKMNKKEVVEPVTILEAPPMAIVGVTGYRETAVGYKCIGTVWAHHVSQEFRRRYYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLK--QKK 615
            NW                        Q  L+ LK  + VIRV+AHTQ+RK++  +   KK
Sbjct: 121  NWKQSAQLAFTKRKSFIRSKNGKVAEQRVLKALKDKATVIRVIAHTQLRKLRNHRVGNKK 180

Query: 616  AHVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGV 795
            AH+ EIQVNGGTI  K+  A    EK+V ID++FQ+ E  D+  VTKG G+EGVV RWGV
Sbjct: 181  AHIQEIQVNGGTIEAKLKMAKDLLEKEVRIDSIFQQSETCDVCAVTKGHGFEGVVHRWGV 240

Query: 796  TRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQ-ENHT 972
              LPRK+HRGLRKVACIGAWHPARV +TVARAGQNGYHHRT LNKKIY++G+    +   
Sbjct: 241  ACLPRKSHRGLRKVACIGAWHPARVMYTVARAGQNGYHHRTHLNKKIYRIGRSSSVDPKQ 300

Query: 973  ALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEE 1152
            A T +D TEK ITPMGGF  YG V++D++++KG   GP++RVVTLR+ +  QTSR   E+
Sbjct: 301  ATTTYDLTEKVITPMGGFVGYGTVRNDFIMLKGSVAGPRRRVVTLRRPMAPQTSRALTEK 360

Query: 1153 IKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            I LKFIDTS+K GHGRFQT +EK ++FG +K
Sbjct: 361  IVLKFIDTSAKMGHGRFQTKKEKSQWFGPMK 391



>gb:AB008848_1510560 Cucumis sativus Csf-3 mRNA, complete cds.
          Length = 219

 Score =  427 bits (1097), Expect = e-118
 Identities = 201/219 (91%), Positives = 215/219 (98%)
 Frame = +1

Query: 592  MKGLKQKKAHVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYE 771
            MKGLKQKKAH+MEIQVNGG+IAQK D+AYGFFEKQVP++AVFQKDEMID+IGVTKGKGYE
Sbjct: 1    MKGLKQKKAHLMEIQVNGGSIAQKXDYAYGFFEKQVPVEAVFQKDEMIDLIGVTKGKGYE 60

Query: 772  GVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGK 951
            GVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTE+NKK+YK+GK
Sbjct: 61   GVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTEMNKKVYKIGK 120

Query: 952  VGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQT 1131
             GQE+HTA+TEFDRTEKDITPMGGFPHYG+VK DYL+IKGGCVGPKKRV+TLRQSLL QT
Sbjct: 121  TGQESHTAITEFDRTEKDITPMGGFPHYGIVKSDYLMIKGGCVGPKKRVITLRQSLLKQT 180

Query: 1132 SRVALEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLKA 1248
            SRVALEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLKA
Sbjct: 181  SRVALEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLKA 219



>gb:CEC36A4_1361032 Caenorhabditis elegans cosmid C36A4, complete
            sequence.>gb:CEF13B10_1362315 Caenorhabditis elegans
            cosmid F13B10, complete sequence.
          Length = 353

 Score =  426 bits (1096), Expect = e-118
 Identities = 214/391 (54%), Positives = 259/391 (66%), Gaps = 3/391 (0%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            MSHRKF  PRHG +GF P+KR+   RG++KAFPKDD SKP  LTAFLGYKAGMTHIVR+V
Sbjct: 1    MSHRKFSAPRHGHMGFTPKKRSRTYRGRIKAFPKDDKSKPIHLTAFLGYKAGMTHIVRDV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            +KPGSK++KKE  EAVTIVETPPMVI GV GYV TP+G R L T+WA+HL+EE RRRFY 
Sbjct: 61   DKPGSKVNKKEVVEAVTIVETPPMVIAGVTGYVDTPQGPRALTTIWAEHLSEEARRRFYS 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                       I++   KLKKY   IRV+AHTQ             
Sbjct: 121  NWAKSKKKAFTKYAKKWQDEDGKKLIEADFAKLKKYCSSIRVIAHTQ------------- 167

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
                                                MID IGVT+G G++GV +RW   +
Sbjct: 168  ------------------------------------MIDTIGVTRGHGFKGVTSRWHTKK 191

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVG---QENHT 972
            LPRKTH+GLRKVACIGAWHP+RV+FTVARAGQ G+HHRT +N KIY++GK     +  + 
Sbjct: 192  LPRKTHKGLRKVACIGAWHPSRVAFTVARAGQKGFHHRTIINNKIYRIGKSALTEEGKNN 251

Query: 973  ALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEE 1152
              TEFD T+K ITPMGGFP YG+V  DY++++G  +GPKKR++TLR+SL+ QT RVA E+
Sbjct: 252  GSTEFDLTQKTITPMGGFPRYGIVNQDYIMLRGAVLGPKKRLITLRKSLITQTKRVAHEK 311

Query: 1153 IKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            I LK+IDTSSK GHGRFQTT EK+ F G+LK
Sbjct: 312  INLKWIDTSSKTGHGRFQTTAEKRAFMGKLK 342



>gb:AY389725_1178336 Hyacinthus orientalis ribosomal protein L3 mRNA,
            partial cds.
          Length = 263

 Score =  416 bits (1068), Expect = e-115
 Identities = 204/245 (83%), Positives = 223/245 (91%)
 Frame = +1

Query: 514  DIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHVMEIQVNGGTIAQKVDFAYGFFEK 693
            +IQ+QL+K+KKY+ VIRVLAHTQ+RKMKGLKQKKAH+MEIQVNGGTIA+KVD+AYGFFEK
Sbjct: 20   EIQTQLDKMKKYATVIRVLAHTQLRKMKGLKQKKAHLMEIQVNGGTIAEKVDYAYGFFEK 79

Query: 694  QVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVS 873
            Q+P+DAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVS
Sbjct: 80   QIPVDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVS 139

Query: 874  FTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDD 1053
            +TVARAGQNGYHHRTE+NKKIY+LGK G E+H A+TEFDRTEKDITPMGGFPHYGVV DD
Sbjct: 140  YTVARAGQNGYHHRTEMNKKIYRLGKSGDESHQAVTEFDRTEKDITPMGGFPHYGVVNDD 199

Query: 1054 YLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLKFIDTSSKFGHGRFQTTQEKQKFF 1233
            Y+LI G CVGPKKRVVTLRQSLL QTSR+ALEEIKLKFIDTSS       +   E Q   
Sbjct: 200  YILINGCCVGPKKRVVTLRQSLLKQTSRLALEEIKLKFIDTSSNLVMAASRPPGEAQ-VS 258

Query: 1234 GRLKA 1248
            GRLKA
Sbjct: 259  GRLKA 263



>gb:HSA238852_2000762 Homo sapiens partial rpl3 gene for ribosomal
            protein L3, U82 snoRNA, U83a snoRNA and U83b snoRNA
            genes.
          Length = 343

 Score =  414 bits (1065), Expect = e-114
 Identities = 206/339 (60%), Positives = 261/339 (76%), Gaps = 6/339 (1%)
 Frame = +1

Query: 247  IVREVEKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELR 426
            IVREV++PGSK++KKE  EAVTIVETPPMV+VG+VGYV+TPRGLR   TV+A+H+++E +
Sbjct: 1    IVREVDRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECK 60

Query: 427  RRFYKNWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLK 606
            RRFYKNW                       ++     +KKY  VIRV+AHTQ+R +  L+
Sbjct: 61   RRFYKNWHKSKKKAFTKYCKKWQDEDGKKQLEKDFSSMKKYCQVIRVIAHTQMRLLP-LR 119

Query: 607  QKKAHVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTR 786
            QKKAH+MEIQVNGGT+A+K+D+A    E+QVP++ VF +DEMID+IGVTKGKGY+GV +R
Sbjct: 120  QKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSR 179

Query: 787  WGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG-----K 951
            W   +LPRKTHRGLRKVACIGAWHPARV+F+VARAGQ GYHHRTE+NKKIYK+G     K
Sbjct: 180  WHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQGYLIK 239

Query: 952  VGQ-ENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQ 1128
             G+   + A T++D ++K I P+GGF HYG V +D++++KG  VG KKRV+TLR+SLL Q
Sbjct: 240  DGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQ 299

Query: 1129 TSRVALEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            T R ALE+I LKFIDT+SKFGHGRFQT +EK+ F G LK
Sbjct: 300  TKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLK 338



>pir|D90134|D90134 60S ribosomal protein L3 [imported] - Guillardia
            theta nucleomorph>gb:AF083031_1766837 Guillardia theta
            nucleomorph chromosome 3, complete sequence.
          Length = 375

 Score =  413 bits (1061), Expect = e-114
 Identities = 198/384 (51%), Positives = 276/384 (71%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            M+HRKFE PRHGSL FLP+KR  R  GK+K+FPKDD  + C LT  +GYK+GMTH+ R V
Sbjct: 1    MAHRKFEAPRHGSLQFLPKKRCRRTVGKIKSFPKDDICQSCHLTGSIGYKSGMTHVERLV 60

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            + P SK++K+E  +AVTI+ETPP++IVG VGY+KTP+G+R LNTVW   ++E ++R +YK
Sbjct: 61   DLPNSKMNKREVIDAVTILETPPILIVGFVGYIKTPKGIRSLNTVWIDEVDESIKRNYYK 120

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
            NW                      +++   E   KY  ++R +  ++I+K+ G K++K+ 
Sbjct: 121  NW-------YKSKKKSFTHYNKIVNLKKFKETYFKYCSILRCIISSEIKKI-GFKKRKSK 172

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            ++EIQ+NGG    K+D+      K++ ID +F ++E++DIIG++KGKG++GVV+RWGVT+
Sbjct: 173  ILEIQLNGGKPEHKLDYIEKILGKKITIDQIFSENELVDIIGISKGKGFQGVVSRWGVTK 232

Query: 802  LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT 981
            LPRKTHRG RKVAC+G+WHP+RVSFTVARAGQ+GYHHRT LN KIY +GK G  ++  LT
Sbjct: 233  LPRKTHRGARKVACVGSWHPSRVSFTVARAGQSGYHHRTSLNIKIYAIGKDGFISNHILT 292

Query: 982  EFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
              +++   I PMGGFP YG+VK D+L++KGG VG KKR + LR+S+    ++   E I L
Sbjct: 293  N-NKSNFSINPMGGFPFYGLVKSDFLILKGGIVGSKKRGLILRKSI--HKNKNFKENINL 349

Query: 1162 KFIDTSSKFGHGRFQTTQEKQKFF 1233
             FIDTSSK+GHG+FQ + EK+ FF
Sbjct: 350  TFIDTSSKWGHGKFQDSNEKKSFF 373



>gb:AF346004_1789932 Lolium perenne L3 ribosomal protein mRNA, partial
            cds.
          Length = 220

 Score =  408 bits (1048), Expect = e-112
 Identities = 194/220 (88%), Positives = 207/220 (94%)
 Frame = +1

Query: 589  KMKGLKQKKAHVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGY 768
            KM GLKQKKAH+MEIQ+NGGTIA KVD+ Y FFEK+VPIDAVFQKDEMIDIIGVTKGKGY
Sbjct: 1    KMNGLKQKKAHLMEIQINGGTIADKVDYGYNFFEKEVPIDAVFQKDEMIDIIGVTKGKGY 60

Query: 769  EGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG 948
            EGVVTRWGVTRLPRKTHRGL KVACIGAWHPARVS+TVARAGQNGYHHRTE+NKK+YK+G
Sbjct: 61   EGVVTRWGVTRLPRKTHRGLPKVACIGAWHPARVSYTVARAGQNGYHHRTEMNKKVYKIG 120

Query: 949  KVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQ 1128
            KVGQE H A TEFDRTEKDITPMGGFPHYGVVK DYL+IKG CVGPKKRVVTLRQSLL Q
Sbjct: 121  KVGQETHDASTEFDRTEKDITPMGGFPHYGVVKGDYLMIKGCCVGPKKRVVTLRQSLLKQ 180

Query: 1129 TSRVALEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLKA 1248
            TSR+ALEEIKLKF+D SSKFGHGRFQTT EKQKF+G+LKA
Sbjct: 181  TSRLALEEIKLKFVDPSSKFGHGRFQTTDEKQKFYGKLKA 220



>gb:HUMTAPR_2036827 Homo sapiens HIV-1 TAR RNA binding protein
           (TARBP-b) mRNA, complete cds.
          Length = 277

 Score =  384 bits (985), Expect = e-105
 Identities = 184/278 (66%), Positives = 220/278 (79%)
 Frame = +1

Query: 82  MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
           MSHRKF  PRHGSLGFLPRKR SR RGKVK+FPKDD SKP  LTAFLGYKAGMTHIVREV
Sbjct: 1   MSHRKFSAPRHGSLGFLPRKRTSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREV 60

Query: 262 EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
           ++PGSK++KKE  EAVTIVETPPMV+VG+VGYV+TPRGLR   TV+A+H+++E +RRFYK
Sbjct: 61  DRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYK 120

Query: 442 NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
           NW                       ++     +KKY  VIRV+AHTQ+R +  L+QKKAH
Sbjct: 121 NWHKSKKKAFTKYCKKWQDEDGKKQLEKDFSSMKKYCQVIRVIAHTQMRLLP-LRQKKAH 179

Query: 622 VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
           +MEIQVNGGT+A+K+D+A    E+QVP++ VF +DEMID+IGVTKGKGY+GV +RW   +
Sbjct: 180 LMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKK 239

Query: 802 LPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHR 915
           LPRKTHRGLRKVACIGAWHP RV+F+VARAGQ GYHHR
Sbjct: 240 LPRKTHRGLRKVACIGAWHPVRVAFSVARAGQKGYHHR 277



>gb:CNS07EGA_1373031 chromosome III of strain GB-M1 of Encephalitozoon
            cuniculi (Microspora).>gb:CNS07EGI_1374489 chromosome IX
            of strain GB-M1 of Encephalitozoon cuniculi (Microspora).
          Length = 383

 Score =  378 bits (970), Expect = e-103
 Identities = 199/390 (51%), Positives = 265/390 (67%), Gaps = 1/390 (0%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVR-E 258
            MS RKF  PRHGSL F PRKR+   R    AFP DD S+P  LT F+ YKAGMTH+VR +
Sbjct: 1    MSCRKFNAPRHGSLQFCPRKRSKTIRPAAGAFPADDRSQPVHLTGFMAYKAGMTHVVRTK 60

Query: 259  VEKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFY 438
             +   +K   +E  +AVT++E PPMV+ G+VGY KT  GLR L  V A ++++ + RR +
Sbjct: 61   TQVAKNKQLSREIMDAVTVLEAPPMVVYGIVGYEKTVTGLRRLPIVTAAYVSDGVLRRMF 120

Query: 439  KNWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKA 618
             N                         +S++E +K+ +  +RVL  TQ   +KGL  KKA
Sbjct: 121  GN--------RYASKESAGQFCKGSVCESRVEMIKERAHCVRVLVQTQPTLIKGLGLKKA 172

Query: 619  HVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVT 798
            H+ EIQVNGG+I++KV++A G  EK++ I  VF  +E ID IGVTKGKG++G V R+GV 
Sbjct: 173  HIAEIQVNGGSISEKVEWALGRLEKEIAIGEVFGVNENIDTIGVTKGKGFQGTVKRFGVR 232

Query: 799  RLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTAL 978
            + PRK+ +G+RKVACIGAWHP+RV +++ARAGQ G+H RTE NK++Y +G  G  N    
Sbjct: 233  KQPRKSRKGIRKVACIGAWHPSRVMYSIARAGQMGFHRRTEKNKRVYMIGN-GSSN--IK 289

Query: 979  TEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIK 1158
            TEFD TEK I+PMGGFPHYG V++D++++KG  VG +KRVVTLR+SLL Q    A EE+ 
Sbjct: 290  TEFDLTEKPISPMGGFPHYGEVRNDFIMVKGAVVGARKRVVTLRKSLLRQR---AGEELV 346

Query: 1159 LKFIDTSSKFGHGRFQTTQEKQKFFGRLKA 1248
            +KF+DTSSK GHGRFQT+ EK+ F+G  KA
Sbjct: 347  IKFVDTSSKIGHGRFQTSAEKKAFYGARKA 376



>gb:BC004323_1969175 Homo sapiens ribosomal protein L3, mRNA (cDNA
            clone IMAGE:3628762), partial cds.
          Length = 292

 Score =  330 bits (846), Expect = 4e-89
 Identities = 166/283 (58%), Positives = 210/283 (74%), Gaps = 6/283 (2%)
 Frame = +1

Query: 415  EELRRRFYKNWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKM 594
            +E +RRFYKNW                       ++     +KKY  VIRV+AHTQ+R +
Sbjct: 1    DECKRRFYKNWHKSKKKAFTKYCKKWQDEDGKKQLEKDFSSMKKYCQVIRVIAHTQMRLL 60

Query: 595  KGLKQKKAHVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEG 774
              L+QKKAH+MEIQVNGGT+A+K+D+A    E+QVP++ VF +DEMID+IGVTKGKGY+G
Sbjct: 61   P-LRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKG 119

Query: 775  VVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG-- 948
            V +RW   +LPRKTHRGLRKVACIGAWHPARV+F+VARAGQ GYHHRTE+NKKIYK+G  
Sbjct: 120  VTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQG 179

Query: 949  ---KVGQ-ENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQS 1116
               K G+   + A T++D ++K I P+GGF HYG V +D++++KG  VG KKRV+TLR+S
Sbjct: 180  YLIKDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKS 239

Query: 1117 LLNQTSRVALEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            LL QT R ALE+I LKFIDT+SKFGHGRFQT +EK+ F G LK
Sbjct: 240  LLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLK 282



>gb:AY829782_1180181 Lonomia obliqua ribosomal protein 24 mRNA,
            partial cds.
          Length = 280

 Score =  319 bits (818), Expect = 8e-86
 Identities = 158/249 (63%), Positives = 194/249 (77%), Gaps = 6/249 (2%)
 Frame = +1

Query: 517  IQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHVMEIQVNGGTIAQKVDFAYGFFEKQ 696
            I+   +K+ +Y  VIR++AHTQ++ +K  +QKKAH+MEIQ+NGG I  KV++A    E Q
Sbjct: 13   IEKDFKKMIRYCSVIRIIAHTQMKLLKQ-RQKKAHIMEIQINGGKIEDKVNWAREHLENQ 71

Query: 697  VPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSF 876
             P+  VF +DEMID IGVTKGKGY+GV +RW   +LPRKTH+GLRKVACIGAWHP+RVSF
Sbjct: 72   FPLTRVFAQDEMIDCIGVTKGKGYKGVTSRWHTKKLPRKTHKGLRKVACIGAWHPSRVSF 131

Query: 877  TVARAGQNGYHHRTELNKKIYKLG-----KVGQE-NHTALTEFDRTEKDITPMGGFPHYG 1038
            TVARAGQ GYHHRTE+NKKIY+LG     K G+   + A TE+D +EK ITPMGGFPHYG
Sbjct: 132  TVARAGQKGYHHRTEMNKKIYRLGQGIHTKDGKVIKNNASTEYDFSEKSITPMGGFPHYG 191

Query: 1039 VVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLKFIDTSSKFGHGRFQTTQE 1218
             V +D+++IKG C+GPKKRV+TLR+SL   T R ALE+I LKFIDTSSKFGHGRFQT  +
Sbjct: 192  EVNNDFVMIKGCCMGPKKRVITLRKSLRVHTKRAALEKINLKFIDTSSKFGHGRFQTPAD 251

Query: 1219 KQKFFGRLK 1245
            K  F G LK
Sbjct: 252  KAAFMGVLK 260



>gb:CEC36A4_1361031 Caenorhabditis elegans cosmid C36A4, complete
            sequence.>gb:CEF13B10_1362314 Caenorhabditis elegans
            cosmid F13B10, complete sequence.
          Length = 303

 Score =  318 bits (816), Expect = 1e-85
 Identities = 153/246 (62%), Positives = 195/246 (79%), Gaps = 3/246 (1%)
 Frame = +1

Query: 517  IQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHVMEIQVNGGTIAQKVDFAYGFFEKQ 696
            I++   KLKKY   IRV+AHTQ++ ++  +QKKAH++EIQVNGGTI QKVD+A    EKQ
Sbjct: 48   IEADFAKLKKYCSSIRVIAHTQMKILRR-RQKKAHLVEIQVNGGTIEQKVDWAREHLEKQ 106

Query: 697  VPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSF 876
            V +D VF +DEMID IGVT+G G++GV +RW   +LPRKTH+GLRKVACIGAWHP+RV+F
Sbjct: 107  VQVDTVFAQDEMIDTIGVTRGHGFKGVTSRWHTKKLPRKTHKGLRKVACIGAWHPSRVAF 166

Query: 877  TVARAGQNGYHHRTELNKKIYKLGK---VGQENHTALTEFDRTEKDITPMGGFPHYGVVK 1047
            TVARAGQ G+HHRT +N KIY++GK     +  +   TEFD T+K ITPMGGFP YG+V 
Sbjct: 167  TVARAGQKGFHHRTIINNKIYRIGKSALTEEGKNNGSTEFDLTQKTITPMGGFPRYGIVN 226

Query: 1048 DDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLKFIDTSSKFGHGRFQTTQEKQK 1227
             DY++++G  +GPKKR++TLR+SL+ QT RVA E+I LK+IDTSSK GHGRFQTT EK+ 
Sbjct: 227  QDYIMLRGAVLGPKKRLITLRKSLITQTKRVAHEKINLKWIDTSSKTGHGRFQTTAEKRA 286

Query: 1228 FFGRLK 1245
            F G+LK
Sbjct: 287  FMGKLK 292



 Score = 51.2 bits (121), Expect = 5e-05
 Identities = 21/34 (61%), Positives = 26/34 (76%)
 Frame = +1

Query: 82  MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPK 183
           MSHRKF  PRHG +GF P+KR+   RG++KAF K
Sbjct: 1   MSHRKFSAPRHGHMGFTPKKRSRTYRGRIKAFTK 34



>sp|Q9NBK4|RL3_CAEBR 60S ribosomal protein L3
           (Fragment).>gb:AF247847_1255288 Caenorhabditis briggsae
           ribosomal protein L3 (rpl-3) gene, partial cds,
           alternatively spliced.
          Length = 246

 Score =  305 bits (780), Expect = 2e-81
 Identities = 145/247 (58%), Positives = 182/247 (73%)
 Frame = +1

Query: 82  MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
           MSHRKF  PRHG +GF P+KR+   RG++KAFPKDD+SKP  LTAFLGYKAGMTHIVR+V
Sbjct: 1   MSHRKFSAPRHGHMGFTPKKRSRTYRGRIKAFPKDDASKPIHLTAFLGYKAGMTHIVRDV 60

Query: 262 EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
           +KPGSK++KKE  EAV+I+ETPPMVI GV GY+ TP+G R L T+WA+HL+EE RRRFY 
Sbjct: 61  DKPGSKVNKKEVVEAVSIIETPPMVIAGVTGYIDTPQGPRALTTIWAEHLSEEARRRFYS 120

Query: 442 NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
           NW                       I++   KLKKY   IRV+AHTQ++ ++  +QKKAH
Sbjct: 121 NWAKSKKKAFTKYAKKWQDEDGKKLIEADFAKLKKYCSSIRVIAHTQMKILR-RRQKKAH 179

Query: 622 VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
           ++EIQ+NGGTI QKVD+A    EKQ+ +D VF +DEMID IGVTKG G++GV +RW   +
Sbjct: 180 LVEIQINGGTIEQKVDWAREHLEKQIQVDTVFSQDEMIDTIGVTKGHGFKGVTSRWHTKK 239

Query: 802 LPRKTHR 822
           LPRKTH+
Sbjct: 240 LPRKTHK 246



>gb:AF526233_1279329 Argopecten irradians isolate
            iolsaicl555ct596cn620 ribosomal protein L3 mRNA, partial
            cds.
          Length = 254

 Score =  302 bits (773), Expect = 1e-80
 Identities = 154/240 (64%), Positives = 187/240 (77%), Gaps = 6/240 (2%)
 Frame = +1

Query: 544  KYSCVIRVLAHTQIRKMKGLKQKKAHVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQK 723
            KY  VIR  AHTQ + +K  +QKKAH+MEIQVNGGTI+QKVD+A    E  VP+ +VF  
Sbjct: 9    KYCKVIRY-AHTQTKLLKK-RQKKAHIMEIQVNGGTISQKVDWAREKMESSVPVGSVFAM 66

Query: 724  DEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNG 903
            DE IDIIGVTKGKG +GV +RW   +LPRKTH+GLRKVACIGAWHP+RV FTVARAGQ G
Sbjct: 67   DENIDIIGVTKGKGVKGVTSRWHTKKLPRKTHKGLRKVACIGAWHPSRVQFTVARAGQKG 126

Query: 904  YHHRTELNKKIYKLG-----KVGQ-ENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLI 1065
            YHHRTE+NKKIY++G     K G+   + A T+FD +EK+ITPMGGFPHYG V +D+++I
Sbjct: 127  YHHRTEINKKIYRMGEGTHTKDGKLVKNNASTDFDPSEKNITPMGGFPHYGEVNNDFVMI 186

Query: 1066 KGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            KG  +GPKKRV+TLR+SLL    +  +E+I LKFIDT+SKFGHGRFQT +EK  F G LK
Sbjct: 187  KGCTMGPKKRVLTLRKSLLPSFKKKQMEKINLKFIDTASKFGHGRFQTFEEKNNFMGPLK 246



>gb:BC085243_2109126 Mus musculus ribosomal protein L3-like, mRNA
            (cDNA clone IMAGE:30292612), partial cds.
          Length = 281

 Score =  299 bits (765), Expect = 1e-79
 Identities = 147/249 (59%), Positives = 189/249 (75%), Gaps = 6/249 (2%)
 Frame = +1

Query: 517  IQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHVMEIQVNGGTIAQKVDFAYGFFEKQ 696
            +Q     +KKY  VIRV+ HTQ+ K+   +QKKAH+MEIQ+NGGT+A+KV +     EKQ
Sbjct: 20   LQKDFAAMKKYCKVIRVIVHTQM-KLLPFRQKKAHIMEIQLNGGTVAEKVAWVQARMEKQ 78

Query: 697  VPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSF 876
            VP+ +VF + E+ID+I VTKG+G +GV +RW   +LPRKTH+GLRKVACIGAWHPARV  
Sbjct: 79   VPVHSVFSQSEVIDVIAVTKGRGVKGVTSRWHTKKLPRKTHKGLRKVACIGAWHPARVGC 138

Query: 877  TVARAGQNGYHHRTELNKKIYKLGK-VGQEN-----HTALTEFDRTEKDITPMGGFPHYG 1038
            ++ARAGQ GYHHRTELNKKIY++G+ +  E+     + A T +D T+K ITP+GGFPHYG
Sbjct: 139  SIARAGQKGYHHRTELNKKIYRIGRGLHMEDGKMVRNNASTSYDVTDKSITPLGGFPHYG 198

Query: 1039 VVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLKFIDTSSKFGHGRFQTTQE 1218
             V +D++++KG   G KKRV+TLR+SLL   SR ALE I+LKFIDT+SKFGHG FQT QE
Sbjct: 199  EVNNDFIMLKGCIAGTKKRVITLRKSLLVHHSRRALENIELKFIDTTSKFGHGCFQTAQE 258

Query: 1219 KQKFFGRLK 1245
            K+ F G  K
Sbjct: 259  KRAFMGPQK 267



>gb:AK002393_1151169 Mus musculus adult male kidney cDNA, RIKEN
            full-length enriched library, clone:0610009G15
            product:similar to 60S RIBOSOMAL PROTEIN L3 (FRAGMENT)
            [Sus scrofa], full insert sequence.>gb:AK004280_1152299
            Mus musculus 18-day embryo whole body cDNA, RIKEN
            full-length enriched library, clone:1110057H16
            product:similar to 60S RIBOSOMAL PROTEIN L3 (FRAGMENT)
            [Sus scrofa], full insert sequence.
          Length = 240

 Score =  281 bits (719), Expect = 2e-74
 Identities = 136/225 (60%), Positives = 174/225 (77%), Gaps = 6/225 (2%)
 Frame = +1

Query: 589  KMKGLKQKKAHVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGY 768
            K+   +QKKAH+MEIQ+NGGT+A+KV +     EKQVP+ +VF + E+ID+I VTKG+G 
Sbjct: 2    KLLPFRQKKAHIMEIQLNGGTVAEKVAWVQARMEKQVPVHSVFSQSEVIDVIAVTKGRGV 61

Query: 769  EGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG 948
            +GV +RW   +LPRKTH+GLRKVACIGAWHPARV  ++ARAGQ GYHHRTELNKKIY++G
Sbjct: 62   KGVTSRWHTKKLPRKTHKGLRKVACIGAWHPARVGCSIARAGQKGYHHRTELNKKIYRIG 121

Query: 949  K-VGQEN-----HTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLR 1110
            + +  E+     + A T +D T+K ITP+GGFPHYG V +D++++KG   G KKRV+TLR
Sbjct: 122  RGLHMEDGKMVRNNASTSYDVTDKSITPLGGFPHYGEVNNDFIMLKGCIAGTKKRVITLR 181

Query: 1111 QSLLNQTSRVALEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            +SLL   SR ALE I+LKFIDT+SKFGHG FQT QEK+ F G  K
Sbjct: 182  KSLLVHHSRRALENIELKFIDTTSKFGHGCFQTAQEKRAFMGPQK 226



>gb:CR926481_1185638 Pongo pygmaeus mRNA; cDNA DKFZp468G0827 (from
           clone DKFZp468G0827).
          Length = 202

 Score =  258 bits (660), Expect = 2e-67
 Identities = 126/198 (63%), Positives = 153/198 (77%)
 Frame = +1

Query: 82  MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
           MSHRKF  PRHGSLGFLPRKR+SR RGKVK+FPKDD SKP  LTAFLGYKAGMTHIVREV
Sbjct: 1   MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREV 60

Query: 262 EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
           ++PGSK++KKE  EAVTIVETPPMV+VG+VGYV+TPRGLR   TV+A+H+++E +RRFYK
Sbjct: 61  DRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYK 120

Query: 442 NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
           NW                       ++     +KKY  VIRV+AHTQ+R +  L+QKKAH
Sbjct: 121 NWHKSKKKAFTKYCKKWQDEDGKKQLEKDFSSMKKYCQVIRVIAHTQMRLLP-LRQKKAH 179

Query: 622 VMEIQVNGGTIAQKVDFA 675
           +MEIQVNGGT+A+K+D+A
Sbjct: 180 LMEIQVNGGTVAEKLDWA 197



>gb:AX885973_1481426 Sequence 1836 from Patent EP1033401.
          Length = 194

 Score =  219 bits (558), Expect = 1e-55
 Identities = 110/183 (60%), Positives = 136/183 (74%), Gaps = 1/183 (0%)
 Frame = +1

Query: 130 LPRKRA-SRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKETCEA 306
           LP   A SR RGKVK+FPKDD SKP  LTAFLGYKAGMTHIVREV++PGSK++KKE  EA
Sbjct: 7   LPASEAXSRHRGKVKSFPKDDPSKPVHLTAFLGYKAGMTHIVREVDRPGSKVNKKEVVEA 66

Query: 307 VTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKNWCXXXXXXXXXXXX 486
           VTIVETPPMV+VG+VGYV+TPRGLR   TV+A+H+++E +RRFYKNW             
Sbjct: 67  VTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISDECKRRFYKNWHKSKKKAFTKYCK 126

Query: 487 XXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHVMEIQVNGGTIAQKV 666
                     ++     +KKY  VIRV+AHTQ+R +  L+QKKAH+MEIQVNGGT+A+K+
Sbjct: 127 KWQDEDGKKQLEKDFSSMKKYCQVIRVIAHTQMRLLP-LRQKKAHLMEIQVNGGTVAEKL 185

Query: 667 DFA 675
           D+A
Sbjct: 186 DWA 188



>sp|O28354|RL3_ARCFU 50S ribosomal protein L3P.>pir|D69490|D69490 LSU
            ribosomal protein L3P (rpl3P) homolog - Archaeoglobus
            fulgidus>gb:AE000971_30017 Archaeoglobus fulgidus DSM
            4304 section 136 of 172 of the complete
            genome.>gb:AE000782_975801 Archaeoglobus fulgidus DSM
            4304 complete genome.
          Length = 331

 Score =  218 bits (556), Expect = 2e-55
 Identities = 125/368 (33%), Positives = 199/368 (54%), Gaps = 2/368 (0%)
 Frame = +1

Query: 94   KFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPG 273
            K+  PR GSL F PRKRA     +++A+P+ D     R+  F GYKAGMTH+V   ++  
Sbjct: 2    KYHRPRRGSLAFSPRKRAKSIVPRIRAWPECDR---VRMQGFAGYKAGMTHVVMIDDRKN 58

Query: 274  SKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKNWCX 453
            S  + +E    VT++ETPPM +  V  Y KT  G++    VW+ +L++ L RR       
Sbjct: 59   SPTYGEEVVVPVTVIETPPMKVAAVRVYKKTQYGMQIAAEVWSNNLDDFLDRRL------ 112

Query: 454  XXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHVMEI 633
                                D++     ++  +  +RV+ +TQ   + G+ +K   VME 
Sbjct: 113  -------------NLPKKEPDVEKLKAAVENGASEVRVVTYTQPYLITGVPKKVPDVMEH 159

Query: 634  QVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRK 813
            ++ GG + + +D+A     K++ +  VF +  +ID+I VTKGKG++G V RWGV  L  K
Sbjct: 160  RI-GGNVEEALDYAISKLGKEISVSEVFDEGAIIDVIAVTKGKGFQGPVKRWGVITLDAK 218

Query: 814  THRGL--RKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEF 987
              R    R+V  +G W+P  V +TV +AGQ G+H RTE NK++ K+G+ G+E        
Sbjct: 219  HARSSKHRRVGNLGPWNPHHVRWTVPQAGQMGFHQRTEYNKRLIKIGENGEE-------- 270

Query: 988  DRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLKF 1167
                  ITP GGF HYGV++  Y+L+ G   GP KR++ +R ++  +  +   + + + +
Sbjct: 271  ------ITPKGGFLHYGVIRTQYVLVTGSVPGPVKRLIRMRDAI--RPPKAHFDGVNIVY 322

Query: 1168 IDTSSKFG 1191
            + T+SK G
Sbjct: 323  VSTTSKQG 330



>sp|Q9UWG2|RL3_METVA 50S ribosomal protein L3P.
          Length = 334

 Score =  217 bits (552), Expect = 5e-55
 Identities = 136/369 (36%), Positives = 195/369 (52%), Gaps = 2/369 (0%)
 Frame = +1

Query: 94   KFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPG 273
            K   PR GSL F PRKRA +   K++++P D   K   L AF  YKAG TH +     P 
Sbjct: 4    KKNRPRRGSLAFSPRKRAKKLVPKIRSWPAD---KKVGLQAFPVYKAGTTHALLVENNPK 60

Query: 274  SKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKNWCX 453
            S  + +E    VT++ETP + + G+  Y KT +GL+ L  VWA+  ++EL R+       
Sbjct: 61   SPNNGQEVFSPVTVLETPEITVAGIRAYGKTTKGLKALTEVWAKQQDKELGRKL------ 114

Query: 454  XXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHVMEI 633
                                 + + LEK    +  +RV+ HT   K  G+ +KK  V+EI
Sbjct: 115  --------TVTKKEEIKTVESLDAVLEK----TVDLRVIVHTN-PKTTGIPKKKPEVVEI 161

Query: 634  QVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGV-TRLPR 810
            +V G ++A+K+ +A     K + I+ VF+  E ID + VTKGKG++G V RWGV  +  +
Sbjct: 162  RVGGSSVAEKLAYAKDILGKTLSINDVFETGEFIDTLAVTKGKGFQGPVKRWGVKIQFGK 221

Query: 811  KTHRGL-RKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEF 987
               +G+ R+   IG W P RV +TV  AGQ G+H RTE NK+I KLG  G E        
Sbjct: 222  HQRKGVGRQTGSIGPWRPKRVMWTVPLAGQMGFHQRTEYNKRILKLGSEGAE-------- 273

Query: 988  DRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLKF 1167
                  ITP GGF +YG VK+ Y+++KG   GP KR+V LR ++     +  L E+   +
Sbjct: 274  ------ITPKGGFLNYGAVKNGYVVVKGTVQGPAKRLVVLRGAVRPAEDKFGLPEV--TY 325

Query: 1168 IDTSSKFGH 1194
            I   SK G+
Sbjct: 326  ISKESKQGN 334



>sp|P54014|RL3_METJA 50S ribosomal protein L3P.>pir|A64322|A64322
            ribosomal protein L3.eR - Methanococcus
            jannaschii>gb:U67474_206265 Methanocaldococcus jannaschii
            DSM 2661 section 16 of 150 of the complete
            genome.>gb:L77117_1099023 Methanocaldococcus jannaschii
            DSM 2661, complete genome.
          Length = 335

 Score =  216 bits (549), Expect = 1e-54
 Identities = 132/365 (36%), Positives = 202/365 (55%), Gaps = 3/365 (0%)
 Frame = +1

Query: 106  PRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPGSKLH 285
            PR GSL F PRKRA R   +++++P++D+    RL AF  YKAGM+H   + + P S   
Sbjct: 8    PRRGSLAFSPRKRAKRPVPRIRSWPEEDT---VRLQAFPVYKAGMSHAFIKEDNPKSPNA 64

Query: 286  KKETCEAVTIVETPPMVIVGVVGYVKTPRG-LRCLNTVWAQHLNEELRRRFYKNWCXXXX 462
             +E    +TI+E PP+ +  +  Y +  R  L  L  VWA +L++EL R+          
Sbjct: 65   GQEVFTPITILEAPPINVCAIRVYGRNERNYLTTLTEVWADNLDKELERKI--------- 115

Query: 463  XXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHVMEIQVN 642
                             D+++  +K++     +RVL HT   K+  L +KK  ++EI++ 
Sbjct: 116  -----KLPKKEDRKTVEDLEALKDKIED----VRVLVHTN-PKLTCLPKKKPEILEIRIG 165

Query: 643  GGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGV-TRLPRKTH 819
            G  I +++++A     KQ+ I  VFQ+ E++D IGVTKGKG++G V RWGV  +  +   
Sbjct: 166  GKDIEERLNYAKEILGKQLNITDVFQEGELVDTIGVTKGKGFQGQVKRWGVKIQFGKHAR 225

Query: 820  RGL-RKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRT 996
            +G+ R V  IG W P  V ++V   GQ GYH RTE NK+I K+G  G E           
Sbjct: 226  KGVGRHVGSIGPWQPKMVMWSVPMPGQMGYHQRTEYNKRILKIGNNGDE----------- 274

Query: 997  EKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLKFIDT 1176
               ITP GGF HYGV++++Y+++KG   GP KR++ LR+++  Q   + + EI   +I T
Sbjct: 275  ---ITPKGGFLHYGVIRNNYVVLKGSVQGPAKRLIVLRRAIRPQEPLIKVPEI--TYIST 329

Query: 1177 SSKFG 1191
            +SK G
Sbjct: 330  TSKQG 334



>gb:AB024901_1194294 Bombyx mori RPL3 mRNA for ribosomal protein L3,
           partial cds.
          Length = 171

 Score =  215 bits (548), Expect = 2e-54
 Identities = 100/169 (59%), Positives = 124/169 (73%)
 Frame = +1

Query: 82  MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
           MSHRKF  PRHGS+GF P+KR+ R RGKVKAFPKDD SKP  LTAF+GYKAGMTH+VRE 
Sbjct: 1   MSHRKFSAPRHGSMGFYPKKRSRRHRGKVKAFPKDDPSKPVHLTAFIGYKAGMTHVVREP 60

Query: 262 EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
           ++PGSK++KKE  EAVTI+ETPPMV VGVVGY++TP GLR L TVWA+H++E+ RRRFYK
Sbjct: 61  DRPGSKINKKEIVEAVTIIETPPMVCVGVVGYIETPHGLRALLTVWAEHMSEDCRRRFYK 120

Query: 442 NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIR 588
           NW                       I+   +K+ +Y  V+RV+AHTQ++
Sbjct: 121 NWYKCKKKAFTKASKKWQDELGRKSIEKDFKKMIRYCSVVRVIAHTQMK 169



>gb:BX957223_844796 Methanococcus maripaludis S2 complete genome;
            segment 5/5.
          Length = 334

 Score =  214 bits (544), Expect = 4e-54
 Identities = 133/369 (36%), Positives = 192/369 (52%), Gaps = 2/369 (0%)
 Frame = +1

Query: 94   KFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPG 273
            K   PR GSL F PRKRA +   K++++P D   K   L AF  YKAG TH +     P 
Sbjct: 4    KKNRPRRGSLAFSPRKRAKKLVPKIRSWPAD---KKVGLQAFPVYKAGTTHALLIENNPK 60

Query: 274  SKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKNWCX 453
            S    +E    VT++ETP + + G+  Y KT +GL+ L  VWA+ L+ +L R+       
Sbjct: 61   SPNSSQEVFTPVTVLETPDVTVAGIRLYEKTTKGLKALTEVWAEQLDSDLGRKL------ 114

Query: 454  XXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHVMEI 633
                                 + + LEK  +    +R + HT   K  G+ +KK  V+EI
Sbjct: 115  --------TLAKKEEKKTVDALDAVLEKATE----VRAIVHTN-PKTTGIPKKKPEVVEI 161

Query: 634  QVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGV-TRLPR 810
            ++ G ++A+++ +A     K + I  VF+  E+ID + +TKGKG++G V RWG+  +  +
Sbjct: 162  RIGGSSVAERLAYAKEILGKTLAISDVFEAGEIIDTLAITKGKGFQGSVKRWGIKVQFGK 221

Query: 811  KTHRGL-RKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEF 987
               +G+ R    IG W P RV +TV   GQ G+H RTE NK+I KLG  G E        
Sbjct: 222  HQRKGVGRHTGSIGPWRPRRVMWTVPLPGQMGFHQRTEYNKRILKLGSEGAE-------- 273

Query: 988  DRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLKF 1167
                  ITP GGF +YG VK+ Y+++KG   GP KR+V LR S+     +  L EI   +
Sbjct: 274  ------ITPKGGFLNYGAVKNGYVVVKGTVQGPAKRLVVLRGSVRAAEDKFGLPEI--AY 325

Query: 1168 IDTSSKFGH 1194
            I T SK G+
Sbjct: 326  ISTESKQGN 334



>gb:AP006878_576694 Thermococcus kodakaraensis strain KOD1 DNA,
            complete genome.
          Length = 346

 Score =  211 bits (538), Expect = 2e-53
 Identities = 134/371 (36%), Positives = 192/371 (51%), Gaps = 7/371 (1%)
 Frame = +1

Query: 94   KFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPG 273
            K   PR GSL + PRKRA     +++++PKD      R+  F GYKAGMTHI+   + PG
Sbjct: 3    KIHRPRRGSLAYSPRKRAKSIVPRIRSWPKDSE---VRMLGFAGYKAGMTHILMIDDSPG 59

Query: 274  SKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFY---KN 444
                 KE    VTIVE PP+ + G+  Y +   GL     VW   L++ + RR     KN
Sbjct: 60   LT-KGKEIFVPVTIVEVPPLFVYGIRAYKQGYLGLETATEVWFHDLHKNVARRIKTLPKN 118

Query: 445  WCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCV--IRVLAHTQIRKMKGLKQKKA 618
            +                          QLE L     +  +R+L HTQ   + GLK KK 
Sbjct: 119  YNEEAFQAKL----------------GQLEDLVNDGEIADVRLLVHTQ-PWLIGLK-KKP 160

Query: 619  HVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVT 798
             VME  + G  +  K D+A     K++    V  + E++D+I VTKGKG +G V RWGV 
Sbjct: 161  EVMEYAIGGDDVKAKFDYAKEKIGKELRAGEVLHEGELLDVIAVTKGKGTQGPVKRWGVK 220

Query: 799  RLPRKTHRGL--RKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHT 972
                K  R    R +  +G WHPARV +TV +AGQ G+HHRTE NK++  +G+ G+    
Sbjct: 221  VQFHKAQRAGKGRHIGNLGPWHPARVMWTVPQAGQMGFHHRTEFNKRLIAIGENGK---- 276

Query: 973  ALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEE 1152
                 D  E +ITP GGFPHYG+V+ D+L+I+G   G  KR++ +R ++     +  +E 
Sbjct: 277  --LVLDGNEIEITPKGGFPHYGIVRSDFLMIEGTIPGSFKRIIRVRPAIRPPKKKPPVER 334

Query: 1153 IKLKFIDTSSK 1185
             ++ ++   SK
Sbjct: 335  PQITYVSRESK 345



>sp|Q8TY90|RL3_METKA 50S ribosomal protein L3P.>gb:AE010337_262047
            Methanopyrus kandleri AV19 section 36 of 157 of the
            complete genome.>gb:AE009439_902828 Methanopyrus kandleri
            AV19, complete genome.
          Length = 361

 Score =  210 bits (535), Expect = 5e-53
 Identities = 127/343 (37%), Positives = 187/343 (54%), Gaps = 5/343 (1%)
 Frame = +1

Query: 106  PRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPGSKLH 285
            PR GSL F PRKRASR   +++++P ++     R+  F GYKAGMTH +   + P S   
Sbjct: 12   PRRGSLAFSPRKRASRPVPRIRSWPDEER---VRVQGFAGYKAGMTHAIMIDDWPNSPTE 68

Query: 286  KKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNE-ELRRRFYKNWCXXXX 462
             +E    VTI++ PPM +  +  Y  TP G RC+   WA+   E E+ R F         
Sbjct: 69   GEEISVPVTILDAPPMYVAAIRAYAPTPDGYRCVTEAWAEIPEELEMDRVF--------- 119

Query: 463  XXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCV--IRVLAHTQIRKMKGLKQKKAHVMEIQ 636
                             D+  ++E+L     V  IRV+  TQ +K  G+ +KK  VME +
Sbjct: 120  --------TVPKDGEAGDLD-KIEELVDEGIVEEIRVIVATQPKKA-GVPKKKPDVMEYR 169

Query: 637  VNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKT 816
            + G  + ++ ++A     +++    VF + E++D+  +TKGKG++GVV RWGVT   RKT
Sbjct: 170  IGGKDVRERFEYAVEILSEEIRAKDVFDEGEIVDVSAITKGKGFQGVVKRWGVTIQDRKT 229

Query: 817  HRGL--RKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFD 990
             R    R +  IG   P+RV +TV  AGQ GYH RTE NK+I K+G+ G+E         
Sbjct: 230  QRKQKGRHIGSIGPITPSRVRWTVPMAGQVGYHQRTEHNKRILKIGEDGEE--------- 280

Query: 991  RTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSL 1119
                 +TP GGF +YGVV+ DY++I G   GPKKR++ +R ++
Sbjct: 281  -----VTPRGGFVNYGVVRGDYIMIHGTVPGPKKRLIRVRPAV 318



>sp|Q8TZZ8|RL3_PYRFU 50S ribosomal protein L3P.>gb:AE010278_261392
            Pyrococcus furiosus DSM 3638, section 153 of 173 of the
            complete genome.>gb:AE009950_902173 Pyrococcus furiosus
            DSM 3638, complete genome.
          Length = 365

 Score =  209 bits (531), Expect = 1e-52
 Identities = 128/376 (34%), Positives = 192/376 (51%), Gaps = 12/376 (3%)
 Frame = +1

Query: 94   KFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPG 273
            K   PR GSLGF PRKRA     +++++PK+      R+  F GYKAGMTHI+   ++PG
Sbjct: 3    KVHRPRRGSLGFSPRKRAKSIVPRIRSWPKETE---VRMLGFAGYKAGMTHILMIDDEPG 59

Query: 274  SKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHL---NEELRRR---- 432
               + KE    VTI+ETPP+ + G+  Y     GL     V        N   + R    
Sbjct: 60   LT-NGKEIFMPVTIIETPPLRVFGIRAYRMGYLGLETATEVIVPDFPLDNYPAKERKGKP 118

Query: 433  -----FYKNWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMK 597
                 FYK                            QLE + K   ++ V A    +   
Sbjct: 119  KPKMTFYK-----LLERRIATLPKNYTQEMFEQKLGQLEDMIKEGEIVDVRAIVATQPWV 173

Query: 598  GLKQKKAHVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGV 777
               +KK  VME  + G ++ +K ++      K++ +  V ++ E++D+I VTKGKG +G 
Sbjct: 174  IKLKKKPEVMEYAIGGTSVEEKFNYIKEKLGKELRVGEVLKEGELLDVIAVTKGKGTQGP 233

Query: 778  VTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVG 957
            V RWG+     K  +G RKV  IG WHPARV +TV  AGQ G+HHRTELNK++  +G+ G
Sbjct: 234  VKRWGIKLRAHKDSKGRRKVGSIGPWHPARVMWTVPMAGQMGFHHRTELNKRLIAIGENG 293

Query: 958  QENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSR 1137
            +     L   + TE +ITP GGFPHYG+V+ D+++I G   G  KR++ +R ++     +
Sbjct: 294  K-----LKLDENTEIEITPKGGFPHYGIVRSDFMMIAGSVPGAIKRIIRVRPAIRPPKKK 348

Query: 1138 VALEEIKLKFIDTSSK 1185
              ++  ++ ++   SK
Sbjct: 349  PPVQRPQITYVSVESK 364



>sp|O26110|RL3_METTH 50S ribosomal protein L3P.>pir|C69124|C69124
            ribosomal protein L3 - Methanobacterium
            thermoautotrophicum  (strain Delta H)>gb:AE000795_27707
            Methanobacterium thermoautotrophicum from bases 1 to
            10208 (section 1 of 148) of the complete
            genome.>gb:AE000666_924789 Methanobacterium
            thermoautotrophicum str. Delta H complete genome.
          Length = 337

 Score =  209 bits (531), Expect = 1e-52
 Identities = 130/372 (34%), Positives = 194/372 (52%), Gaps = 6/372 (1%)
 Frame = +1

Query: 94   KFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPG 273
            +   PR GS+ F PRKRA+R+  +VK++P+ D      L A  GYKAGMTH++    +  
Sbjct: 3    RHHQPRKGSVAFSPRKRAARETPRVKSWPQVDEPG---LLALAGYKAGMTHVMMVDNQKN 59

Query: 274  SKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKNWCX 453
            S     E    VTI+E PP+ ++ V  Y KT RGL+ L  V A    ++LRR+       
Sbjct: 60   SPTEGMEVSTPVTILEVPPLTVMAVRTYEKTSRGLKTLGEVLATETKDDLRRKL------ 113

Query: 454  XXXXXXXXXXXXXXXXXXXXDIQSQLEKLK---KYSCVIRVLAHTQIRKMKGLKQKKAHV 624
                                D ++ +EK++   +Y   +RV+ HT  R +  + +KK  V
Sbjct: 114  -------------TPPADDYDQEAAIEKIRSNMEYVADVRVIVHTNPR-LASVPKKKPEV 159

Query: 625  MEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 804
             E  + G T  +K ++A     K V    +F +   +D I VTKGKG++G V RWG+   
Sbjct: 160  FECGLGGKTPEEKFEYALEILGKDVRASEIFSEGAFVDAIAVTKGKGFQGPVKRWGIRIQ 219

Query: 805  PRKTHRGL--RKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTAL 978
              K  R    R +  +G W P+R  +TV +AGQ GYH RTE NK+I K+G          
Sbjct: 220  YGKAARSSKGRHIGSLGPWTPSRTMWTVPQAGQMGYHRRTEYNKQILKIG---------- 269

Query: 979  TEFDRTEKD-ITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEI 1155
               D +E D + P GGF  YG+V++DY++IKG   GP KR+V LR+++  + +    E  
Sbjct: 270  ---DASEADLVNPDGGFVRYGLVRNDYVMIKGSVPGPTKRLVVLRKAI--RAAGKQEEAP 324

Query: 1156 KLKFIDTSSKFG 1191
            ++ +I T+SK G
Sbjct: 325  QINYISTASKQG 336



>sp|Q9V1T5|RL3_PYRAB 50S ribosomal protein L3P.>pir|A75148|A75148 lsu
            ribosomal protein l3p (rpl3p) PAB2120 - Pyrococcus abyssi
            (strain Orsay)>gb:CNSPAX02_849103 Pyrococcus abyssi
            complete genome; segment 2/6.
          Length = 361

 Score =  206 bits (524), Expect = 9e-52
 Identities = 125/370 (33%), Positives = 193/370 (52%), Gaps = 6/370 (1%)
 Frame = +1

Query: 94   KFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPG 273
            K   PR GSL F PRKRA     +++++PK+      R+  F GYKAGMTHI+   ++PG
Sbjct: 3    KVHRPRRGSLAFSPRKRAKSIVPRIRSWPKETE---VRMLGFAGYKAGMTHILMIDDEPG 59

Query: 274  SKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLN-EELRRRFYKNWC 450
               + KE    VTI+ETPP+ + G+  Y +   GL     V       +    +  K   
Sbjct: 60   LT-NGKEIFMPVTIIETPPLRVFGIRAYRQGYLGLETATEVIVPDFELDNYVSKKAKGRK 118

Query: 451  XXXXXXXXXXXXXXXXXXXXXDIQSQL----EKLKKYSCV-IRVLAHTQIRKMKGLKQKK 615
                                 D + +L    + +K+   V +R L  TQ   +K   +KK
Sbjct: 119  FTFYQLLKRRIATLPKNYTKDDFEQKLGNLEDMIKEGEIVEVRALVATQPWVIK--LKKK 176

Query: 616  AHVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGV 795
              VME  + G ++ +K ++      K++ +  V ++ E++D+I VTKGKG +G V RWG+
Sbjct: 177  PEVMEYAIGGTSVEEKFNYIKEKLGKELRVGEVLKEGELLDVIAVTKGKGTQGPVKRWGI 236

Query: 796  TRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTA 975
                 K  +G RKV  IG WHPARV +TV  AGQ G+HHRTELNK++  +G+ G+     
Sbjct: 237  KLRAHKDSKGRRKVGSIGPWHPARVMWTVPMAGQMGFHHRTELNKRLIAIGENGK----- 291

Query: 976  LTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEI 1155
                D  E +ITP GGFPHYG+V+ D+++I G   G  KR++ +R ++     +  ++  
Sbjct: 292  -LVIDGNEIEITPKGGFPHYGIVRSDFMMIAGSVPGAIKRIIRVRPAIRPPKKKPPVQRP 350

Query: 1156 KLKFIDTSSK 1185
            ++ ++   SK
Sbjct: 351  QITYVSVESK 360



>sp|O59418|RL3_PYRHO 50S ribosomal protein L3P.>pir|H71187|H71187
            probable ribosomal protein L3 - Pyrococcus
            horikoshii>gb:BA000001_650457 Pyrococcus horikoshii OT3
            DNA, complete genome.
          Length = 362

 Score =  206 bits (523), Expect = 1e-51
 Identities = 125/371 (33%), Positives = 194/371 (52%), Gaps = 7/371 (1%)
 Frame = +1

Query: 94   KFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPG 273
            K   PR GSL F PRKRA     +++++PK+      R+  F GYKAGMTHI+   ++PG
Sbjct: 3    KIHRPRKGSLAFSPRKRAKSIVPRIRSWPKETE---VRMLGFAGYKAGMTHILMIDDEPG 59

Query: 274  SKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQ--HLNEELRRRFYKNW 447
               + KE    VTI+ETPP+ + G+  Y +   GL     V      L+     +  K  
Sbjct: 60   LT-NGKEIFMPVTIIETPPLRVFGIRAYRQGYLGLETAGEVIVPDFELDNYTPSKKGKGR 118

Query: 448  CXXXXXXXXXXXXXXXXXXXXXDIQSQL----EKLKKYSCV-IRVLAHTQIRKMKGLKQK 612
                                  + + +L    + +K+   V +R L  TQ   +K   +K
Sbjct: 119  KFTFYQFLGRRIATLPKDYTQEEFEQKLGALEDMIKEGEIVEVRALVSTQPWVIK--LKK 176

Query: 613  KAHVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWG 792
            K  VME  + G ++ +K ++      K++ +  V ++ E++D+I VTKGKG +G V RWG
Sbjct: 177  KPEVMEYAIGGTSVEEKFNYIKEKLGKEIRVGEVLKEGELLDVIAVTKGKGTQGPVKRWG 236

Query: 793  VTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHT 972
            +     K  +G RKV  IG WHPARV +TV  AGQ G+HHRTELNK++  +G+ G+    
Sbjct: 237  IKLRAHKDSKGRRKVGSIGPWHPARVMWTVPMAGQMGFHHRTELNKRLIAIGENGK---- 292

Query: 973  ALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEE 1152
                 D  E +ITP GGFPHYG+V+ D+++I G   G  KR++ +R ++     +  ++ 
Sbjct: 293  --LVIDGNEIEITPKGGFPHYGIVRGDFMMIAGSVPGAIKRIIRVRPAIRPPKKKPPVQR 350

Query: 1153 IKLKFIDTSSK 1185
             ++ ++   SK
Sbjct: 351  PQITYVSVESK 361



>gb:AY534910_626197 Uncultured marine group II euryarchaeote
            DeepAnt-JyKC7 clone cosmid DeepAnt-JyKC7, complete
            sequence.
          Length = 358

 Score =  202 bits (513), Expect = 2e-50
 Identities = 119/368 (32%), Positives = 195/368 (52%), Gaps = 6/368 (1%)
 Frame = +1

Query: 106  PRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPGSKLH 285
            P+ GS+GF PRKRA R  G++ ++P+ +SS+  R+  F G+KAGMTH++     P S   
Sbjct: 7    PKRGSMGFSPRKRAIRPFGRITSWPETESSE-IRVQGFAGWKAGMTHVLMRDTNPHSTSA 65

Query: 286  KKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLN--EELRRRFYKNWCXXX 459
             +E  +AVT+VE PPM ++ V GY  TP G++    +WA   +  + L  RF        
Sbjct: 66   GQEIRKAVTVVEVPPMKVLAVRGYHMTPYGMQTAGEIWADSSSGPDGLMPRFANQTRGDR 125

Query: 460  XXXXXXXXXXXXXXXXXXDIQSQLEKLKKYS----CVIRVLAHTQIRKMKGLKQKKAHVM 627
                              +     + L   +    C +R++  TQ   +K +  K   +M
Sbjct: 126  DIEEGRKPAKRAGRIPVREGGMNGDALAALTDSNLCEVRLIVATQPALVKSVPSKTPVIM 185

Query: 628  EIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP 807
            E+ + GG    K+++A+     ++ ID V++  + +D++G+TKGKG++GV+ R+GV  L 
Sbjct: 186  EVGLVGGDTGAKLEWAHERLGGEIGIDDVYEAGKELDVVGITKGKGWQGVIKRFGVKLLS 245

Query: 808  RKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEF 987
             K  +  R++  +G +    V  T+ +AGQ GYH RTELNK+I ++   G          
Sbjct: 246  HKNSKRRRQIGNMGDFGTGYVRKTIRQAGQMGYHKRTELNKRILRISNPG---------- 295

Query: 988  DRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLKF 1167
               E D+TP GGF HYG V + Y++++G   GP KR++  R  +   T+   + ++ L +
Sbjct: 296  ---ESDVTPAGGFLHYGEVTNPYMVLEGSLPGPAKRLLRFRDPVRPHTN---VFDVDLTY 349

Query: 1168 IDTSSKFG 1191
            + TSSK G
Sbjct: 350  VSTSSKQG 357



>sp|Q8ZW52|RL3_PYRAE 50S ribosomal protein L3P.>gb:AE009850_256475
            Pyrobaculum aerophilum strain IM2 section 105 of 201 of
            the complete genome.>gb:AE009441_899101 Pyrobaculum
            aerophilum strain IM2 complete genome.
          Length = 338

 Score =  198 bits (503), Expect = 3e-49
 Identities = 128/347 (36%), Positives = 183/347 (52%), Gaps = 8/347 (2%)
 Frame = +1

Query: 94   KFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPG 273
            K   PR GS+G  PRKRA+    +V+ +P+ +  KP  L  F  YKAGM H V   ++P 
Sbjct: 4    KINRPRRGSMGVYPRKRAADIVPRVRTWPEVNLGKPA-LLGFAAYKAGMLHAVVVDDRPT 62

Query: 274  SKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRG--LRCLNTVWAQHLNEELRRRFYKNW 447
            S L+ KE  +AVT+++ PP+ + G   Y   P     R +  VWA  L + L R      
Sbjct: 63   SPLYGKEVVKAVTVLDAPPLYVWGFRLYTLDPTNGYKRAVAEVWASELPKFLHR------ 116

Query: 448  CXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCV---IRVLAHTQIRKMKGLKQKKA 618
                                  D+  QL+K++++  V   +R L  TQ   + G+ +K  
Sbjct: 117  --------------VLTLPEKLDVDKQLKKVEEFRDVAVDVRALVATQPH-LSGIGKKTP 161

Query: 619  HVMEIQVNG-GTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGV 795
             ++EI + G  ++ ++++FA     K V    VF   +++D+I VTKGKGY+GV+ R+GV
Sbjct: 162  ELLEIPIGGVPSVDERINFAISLLGKTVSPKDVFTPGQLVDVIAVTKGKGYQGVIKRFGV 221

Query: 796  TRLPR--KTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENH 969
            T LPR  K  +G R+   IG   PA V FT  R GQ G+H RTE NK++ K+G+ G E  
Sbjct: 222  TILPRWHKHRKGHRRTGTIGPQAPA-VMFTQPRPGQMGFHQRTEYNKRLLKIGENGAE-- 278

Query: 970  TALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLR 1110
                        ITP  GFPHYGVVK  Y+LI+G   G +KR+V LR
Sbjct: 279  ------------ITPKSGFPHYGVVKGPYILIQGSVPGARKRLVVLR 313



>gb:AE014297_1138963 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003690_1220956 Drosophila melanogaster
           chromosome 3R, section 28 of 118 of the complete
           sequence.
          Length = 161

 Score =  197 bits (502), Expect = 3e-49
 Identities = 88/122 (72%), Positives = 105/122 (86%)
 Frame = +1

Query: 82  MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
           MSHRKF  PRHGS+ F P+KR++R RGKVKAFPKDD+SKP  LT F+GYKAGMTHIVRE 
Sbjct: 1   MSHRKFSAPRHGSMAFYPKKRSARHRGKVKAFPKDDASKPVHLTCFIGYKAGMTHIVREA 60

Query: 262 EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
           ++PGSK++KKE  EAVT++ETPPM++VG VGY++TP GLR L  VWAQHL+EE RRRFYK
Sbjct: 61  DRPGSKINKKEVVEAVTVLETPPMIVVGAVGYIETPFGLRALVNVWAQHLSEECRRRFYK 120

Query: 442 NW 447
           NW
Sbjct: 121 NW 122



>sp|Q9YFM2|RL3_AERPE 50S ribosomal protein L3P.>pir|A72780|A72780
            probable ribosomal protein L3 APE0227 - Aeropyrum pernix 
            (strain K1)>gb:BA000002_650918 Aeropyrum pernix K1 DNA,
            complete genome.
          Length = 344

 Score =  196 bits (497), Expect = 1e-48
 Identities = 134/378 (35%), Positives = 198/378 (52%), Gaps = 8/378 (2%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            M  RK   PR GSLGF PRKRASR   +VK +P+ D  KP  L AFLGY+AGMTH+    
Sbjct: 1    MGARKKRAPRRGSLGFSPRKRASRLVPRVKRWPEVDIGKPVPL-AFLGYRAGMTHVFMVD 59

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTP-RGLRCLNTVWAQHLNE-ELRRRF 435
            ++PG     KE    VTIVETPPM +  V  Y   P RG   L   WAQ   E EL+RR 
Sbjct: 60   DRPGRPTSGKEIFVPVTIVETPPMFVAAVRLYGYDPNRGRYSLGEAWAQPPPELELQRRI 119

Query: 436  YKNWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKK 615
                                       ++ +L+K +     +R++A +Q +   GL +KK
Sbjct: 120  -------------STLGSFDTDKMLKSLEERLDKAED----VRLIAASQPKLAGGLSKKK 162

Query: 616  AHVMEIQVNGGTIAQKV-DFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWG 792
              ++EI+V G +   K+ D+A       + ++ VF++ +++D+I VTKGKG++GV+ RWG
Sbjct: 163  PDLLEIKVGGVSDVTKLFDYAKDVLGNLIAVNDVFEEGQLVDVIAVTKGKGFQGVIKRWG 222

Query: 793  VTRLPR--KTHRGLRKVACIGAWHPARVSF-TVARAGQNGYHHRTELNKKIYKLGKVGQE 963
            V  LPR  K  +G R+   IGA    R +F    +AGQ G+H RTE NK+I  +   G +
Sbjct: 223  VKELPRWHKHRKGSRR---IGARSHGRSTFWETPQAGQTGFHRRTEYNKRILMIDDDGYK 279

Query: 964  NHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLL--NQTSR 1137
                          +TP GGF  YGVV+  ++++ G   G  KR + +R ++       +
Sbjct: 280  --------------VTPAGGFLRYGVVRSTFVMLSGSIPGTPKRPIVMRWAIRPPEWYLK 325

Query: 1138 VALEEIKLKFIDTSSKFG 1191
            + + + ++ +I  +SK G
Sbjct: 326  LGVRKPEITYISLASKQG 343



>sp|Q9HPD4|RL3_HALN1 50S ribosomal protein L3P.>pir|D84321|D84321 50S
            ribosomal protein L13P [imported] - Halobacterium sp.
            NRC-1>gb:AE005077_63096 Halobacterium sp. NRC-1 section
            108 of 170 of the complete genome.>gb:AE004437_888015
            Halobacterium sp. NRC-1 complete genome.
          Length = 335

 Score =  194 bits (493), Expect = 4e-48
 Identities = 131/368 (35%), Positives = 181/368 (49%), Gaps = 6/368 (1%)
 Frame = +1

Query: 106  PRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPGSKLH 285
            PR GS+GF PRKRA  +  +  ++P DD      L  F GYKAGMTH+V   +K  +   
Sbjct: 7    PRKGSMGFSPRKRAESEVPRFNSWPADDGE--VGLQGFAGYKAGMTHVVLVDDKANAPTE 64

Query: 286  KKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKNWCXXXXX 465
              ET   VT+VETPPM    V  Y  TP G + L  VWA   +E L R            
Sbjct: 65   GMETTVPVTVVETPPMRAAAVRLYEDTPYGKKPLTEVWADDTHESLDRTL---------- 114

Query: 466  XXXXXXXXXXXXXXXXDIQSQLEKLKKYSCV-IRVLAHTQIRKMKGLKQKKAHVMEIQVN 642
                            D    +E L       IRV+ HT      G+ +K   VME +V 
Sbjct: 115  ---------SVPDEGGDTDELIEALDTEEIADIRVITHTVPGDTAGVPKKNPDVMETRVG 165

Query: 643  GGTIAQKVDFAYGFFEKQV--PIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKT 816
            GGT+A +++FA    E         VF+  E  D  G+TKGKG +G V RWGV +   K 
Sbjct: 166  GGTLADRLEFAADLIEDGGVHAFGDVFRAGEFTDAAGITKGKGTQGPVKRWGVQKRKGKH 225

Query: 817  HRG--LRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFD 990
             R    R++  +G W+P+RV  TV + GQ GYH RTELNK++  +   G E         
Sbjct: 226  ARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIND-GDEP-------- 276

Query: 991  RTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLL-NQTSRVALEEIKLKF 1167
                  TP GGFP+YG V   Y L+KG   GP++R+V  R ++  N++ R+   + ++++
Sbjct: 277  ------TPDGGFPNYGEVDGPYTLVKGSVPGPEQRLVRFRPAVRPNESPRL---DPEVRY 327

Query: 1168 IDTSSKFG 1191
            + T+S  G
Sbjct: 328  VSTASNQG 335



>sp|Q975I1|RL3_SULTO 50S ribosomal protein L3P.>gb:BA000023_691002
            Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 343

 Score =  193 bits (491), Expect = 6e-48
 Identities = 126/373 (33%), Positives = 196/373 (52%), Gaps = 3/373 (0%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            M HRK   PR GS G  PRKRAS      +++P   S++P +L  F+GYK GM+HI    
Sbjct: 1    MGHRKLASPRRGSAGVRPRKRASEILPTPRSWPTIQSNEP-KLLGFVGYKVGMSHIFMID 59

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYK 441
            +KP S  + KE    V+++ETPP++ + +  YV  P+G     T +   ++E+L +   +
Sbjct: 60   DKPTSPNYGKEIYVPVSVIETPPVIPLAIRAYVMGPKGEPTTLTEYWGDISEDLLKLIQQ 119

Query: 442  NWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAH 621
                                    +I ++L  +      +RVL  TQ + +  L +KK  
Sbjct: 120  R------KVTRLKIDKEKMKGKLDEINNKLNDI----LYLRVLIATQPKLVPSLGKKKPE 169

Query: 622  VMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTR 801
            ++E+QV GG I  ++++      K + +  VF++ ++IDIIGVTKGKG++GVV R+GV  
Sbjct: 170  IVEVQVGGGDIKSQLNYVLNILGKPLSVKDVFKEGQLIDIIGVTKGKGFQGVVKRYGVVE 229

Query: 802  LPR--KTHRGLRKVACIGAWHPA-RVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHT 972
            LPR  K  +G RKV   GA  P+      V + GQ GYH RTE NK+I K+         
Sbjct: 230  LPRWHKHRKGSRKV---GARGPSFSTPSYVPQPGQMGYHRRTEYNKRILKISD------- 279

Query: 973  ALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEE 1152
                      +I P GGF +YG+V++ YL+I+G  +G KKR + LR  +  + S +    
Sbjct: 280  -------DPNEINPKGGFVNYGIVRNTYLIIEGSIIGAKKRPLFLRYPI--RPSWIPQSA 330

Query: 1153 IKLKFIDTSSKFG 1191
             K+ +++  S+ G
Sbjct: 331  PKITYVNLYSQQG 343



>gb:AY383698_1178121 Rattus norvegicus LRRGT00043 mRNA, complete cds.
          Length = 867

 Score =  188 bits (478), Expect(2) = 2e-47
 Identities = 92/165 (55%), Positives = 125/165 (75%), Gaps = 6/165 (3%)
 Frame = +1

Query: 646  GTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRG 825
            GT+A+K+D+A        P++ VF + EMID++G+TKGKGY+GV +RW   + PRKTH+G
Sbjct: 327  GTVAEKLDWAREAAGAAGPLNQVFGQGEMIDVMGMTKGKGYKGVTSRWHTKKPPRKTHQG 386

Query: 826  LRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG-----KVGQ-ENHTALTEF 987
            LRKVACIGAW PA V+F+VARAGQ GYHH+TE NKKIYK+G     K G+   + A T++
Sbjct: 387  LRKVACIGAWLPAHVAFSVARAGQKGYHHQTETNKKIYKIGQGYLIKDGKLTKNNASTDY 446

Query: 988  DRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLL 1122
            D +++ I P+GGF HYG V +D+L+++G  VG KKRV+TLR+SLL
Sbjct: 447  DLSDRSINPLGGFVHYGEVTNDFLMLEGCVVGTKKRVLTLRKSLL 491



 Score = 25.0 bits (53), Expect(2) = 2e-47
 Identities = 9/15 (60%), Positives = 12/15 (80%)
 Frame = +3

Query: 600 VEAEEGSCDGNPG*W 644
           V+ EEG+ DG+PG W
Sbjct: 312 VDGEEGTPDGDPGEW 326



>gb:AJ606030_1811944 Triticum aestivum partial mRNA for putative
           ribosomal protein (rpl3 gene).
          Length = 98

 Score =  188 bits (477), Expect = 3e-46
 Identities = 88/96 (91%), Positives = 93/96 (96%)
 Frame = +1

Query: 568 LAHTQIRKMKGLKQKKAHVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIG 747
           +AHTQIRKMKGLKQKKAH+MEIQ+NGGTIA KVD+ Y FFEK+VPIDAVFQKDEMIDIIG
Sbjct: 1   IAHTQIRKMKGLKQKKAHLMEIQINGGTIADKVDYGYSFFEKEVPIDAVFQKDEMIDIIG 60

Query: 748 VTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAW 855
           VTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAW
Sbjct: 61  VTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAW 96



>gb:AE017261_419657 Picrophilus torridus DSM 9790, complete genome.
          Length = 329

 Score =  185 bits (470), Expect = 2e-45
 Identities = 109/363 (30%), Positives = 181/363 (49%)
 Frame = +1

Query: 103  HPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPGSKL 282
            H R GS+ + PR RA R +G ++++P+ +     ++ AF GYK GMTHI     +  S  
Sbjct: 6    HSRRGSMAYYPRVRAKRIQGDIRSWPEIEGQT--KVQAFAGYKVGMTHIQMVDYRKNSVT 63

Query: 283  HKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKNWCXXXX 462
              +     VT+VE PP+ ++ +  Y +   GL  ++  WA+++++++ RR  K       
Sbjct: 64   AGQVIMAPVTVVEVPPLTVMSIRYYARGDNGLEVISEEWAENIDKDVLRRINK------- 116

Query: 463  XXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHVMEIQVN 642
                             D+             +R++ HT  + + G+  K   + EI++ 
Sbjct: 117  ------INRHKKGIEVKDVDD-----------VRLMVHTNPQLVSGVPSKTPEIFEIRIG 159

Query: 643  GGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHR 822
            G TI  ++ +A       +      +    +D+I VTKGKG++GVV R+GV  LPRK  +
Sbjct: 160  GSTIENRIKYAKERLGSNISFSDFSKPGNFVDVIAVTKGKGFQGVVKRFGVKLLPRKNRK 219

Query: 823  GLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEK 1002
              R +  +G WHP  V  TV +AGQ G+H RT  N +I K      ++H           
Sbjct: 220  HRRMIGTLGPWHPDWVRNTVPQAGQVGFHQRTIHNIRIIKF---DTKDHV---------D 267

Query: 1003 DITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLKFIDTSS 1182
            DI   GGF +YG+V++DY+L+ G   GP KR++ +R     + +R A+E I++ ++   S
Sbjct: 268  DINVKGGFLNYGIVRNDYVLLFGSVPGPAKRLIKMRDPA--RQTRPAVESIEVTYVSRES 325

Query: 1183 KFG 1191
            K G
Sbjct: 326  KQG 328



>sp|Q8TRU7|RL3_METAC 50S ribosomal protein L3P.>gb:AE010775_266433
            Methanosarcina acetivorans str. C2A, section 120 of 534
            of the complete genome.>gb:AE010299_906992 Methanosarcina
            acetivorans str. C2A, complete genome.
          Length = 337

 Score =  185 bits (470), Expect = 2e-45
 Identities = 114/366 (31%), Positives = 183/366 (50%), Gaps = 4/366 (1%)
 Frame = +1

Query: 106  PRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPGSKLH 285
            P+ GSL F PRKRA     + +A+P  +++   +L +F GYK GMTH++   +   S   
Sbjct: 7    PKRGSLAFSPRKRAKSHIPRFRAWP--EATGEPKLQSFAGYKVGMTHVIMVDDTKNSLTQ 64

Query: 286  KKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKNWCXXXXX 465
              E    VT++ETP + +  +  Y +   G + +  VWA  L+ EL+RR           
Sbjct: 65   GMEISVPVTVIETPAIRVAAIRAYAEDSTGEKAIAEVWAADLDPELKRRI---------- 114

Query: 466  XXXXXXXXXXXXXXXXDIQSQLEKLKKYSCV--IRVLAHTQIRKMKGLKQKKAHVMEIQV 639
                            +    + KL +   V  +R + +T  + + G+ +K   +ME  +
Sbjct: 115  -------PIPAAGNQAEALENIGKLIEEGRVSDVRAVIYTLPKSLTGVPKKVPDIMESGI 167

Query: 640  NGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTH 819
            +   +  K +++       V +  VF+   ++D   +T GKG +G V RWG+  +  K  
Sbjct: 168  SARDLGTKFEYSKTILGTLVSVTDVFKNGTLVDTAAITIGKGTQGPVKRWGIQLMKGKHS 227

Query: 820  R--GLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDR 993
            R   LR+V  +GA++P+RVS+ V + GQ GYH RTE NK+I K+G  G+E          
Sbjct: 228  RQGSLRQVGTLGAFNPSRVSWRVPQMGQMGYHQRTEFNKRILKIGSDGEE---------- 277

Query: 994  TEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLKFID 1173
                +TP GGF +YG+V+ DY+LIKG   GP KR++ LR  +  +  +  L E  + +I 
Sbjct: 278  ----VTPEGGFINYGLVRGDYILIKGSVPGPSKRLIRLRDPI--RAKKADLGEPNILYIS 331

Query: 1174 TSSKFG 1191
              SK G
Sbjct: 332  RESKQG 337



>gb:AY596297_632992 Haloarcula marismortui ATCC 43049 chromosome I,
            complete sequence.
          Length = 338

 Score =  184 bits (466), Expect = 5e-45
 Identities = 119/347 (34%), Positives = 172/347 (49%), Gaps = 9/347 (2%)
 Frame = +1

Query: 106  PRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPGSKLH 285
            PR GSLGF PRKR++ +  +  ++P DD     +   F GYKAGMTH+V   ++P S   
Sbjct: 7    PRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQ--GFAGYKAGMTHVVLVNDEPNSPRE 64

Query: 286  KKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKNWCXXXXX 465
              E    VT++ETPPM  V +  Y  TP G R L  VW    + EL R            
Sbjct: 65   GMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTL---------- 114

Query: 466  XXXXXXXXXXXXXXXXDIQSQLEKLKKYSCV-----IRVLAHTQIRKMKGLKQKKAHVME 630
                            D  +  E+++          +R++ HT    +  + +KK  VME
Sbjct: 115  ----------DVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVME 164

Query: 631  IQVNGGTIAQKVDFAYGFFEK--QVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 804
             +V GG+++ ++D A    E   +  ++ +F+  E  D+ GVTKGKG +G V RWGV + 
Sbjct: 165  TRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKR 224

Query: 805  PRKTHRG--LRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTAL 978
              K  R    R++  +G W+P+RV  TV + GQ GYH RTELNK++  +G+ G E     
Sbjct: 225  KGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGE-GDEP---- 279

Query: 979  TEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSL 1119
                      T  GGF +YG V   Y L+KG   GP KR+V  R ++
Sbjct: 280  ----------TVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAV 316



>pir|C35063|R5HS3L ribosomal protein L3 [similarity] - Haloarcula
            marismortui>gb:HALRGHM_136634 Halobacterium marismortui
            ribosomal protein gene cluster.
          Length = 338

 Score =  184 bits (466), Expect = 5e-45
 Identities = 119/347 (34%), Positives = 172/347 (49%), Gaps = 9/347 (2%)
 Frame = +1

Query: 106  PRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPGSKLH 285
            PR GSLGF PRKR++ +  +  ++P DD     +   F GYKAGMTH+V   ++P S   
Sbjct: 7    PRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQ--GFAGYKAGMTHVVLVNDEPNSPRE 64

Query: 286  KKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKNWCXXXXX 465
              E    VT++ETPPM  V +  Y  TP G R L  VW    + EL R            
Sbjct: 65   GMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTL---------- 114

Query: 466  XXXXXXXXXXXXXXXXDIQSQLEKLKKYSCV-----IRVLAHTQIRKMKGLKQKKAHVME 630
                            D  +  E+++          +R++ HT    +  + +KK  VME
Sbjct: 115  ----------DVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVME 164

Query: 631  IQVNGGTIAQKVDFAYGFFEK--QVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 804
             +V GG+++ ++D A    E   +  ++ +F+  E  D+ GVTKGKG +G V RWGV + 
Sbjct: 165  TRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKR 224

Query: 805  PRKTHRG--LRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTAL 978
              K  R    R++  +G W+P+RV  TV + GQ GYH RTELNK++  +G+ G E     
Sbjct: 225  KGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGE-GDEP---- 279

Query: 979  TEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSL 1119
                      T  GGF +YG V   Y L+KG   GP KR+V  R ++
Sbjct: 280  ----------TVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVPFRPAV 316



>pir|T43816|T43816 ribosomal protein L3.eR [similarity] -
            Halobacterium salinarum>gb:AB006961_1043 Halobacterium
            halobium gene for ribosomal proteins, partial and
            complete cds.
          Length = 330

 Score =  183 bits (465), Expect = 6e-45
 Identities = 129/366 (35%), Positives = 181/366 (49%), Gaps = 4/366 (1%)
 Frame = +1

Query: 106  PRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPGSKLH 285
            PR GS+GF PRKRA  +  +  ++P DD      L AF GYKAGMTH+V   +K  +   
Sbjct: 7    PRKGSMGFSPRKRAESEVPRFNSWPADDGE--VGLQAFAGYKAGMTHVVLVDDKANAPTE 64

Query: 286  KKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKNWCXXXXX 465
              ET   VT VETPPM  V +  Y  TP G + L  VWA   +E L R            
Sbjct: 65   GMETTVPVT-VETPPMRAVRL--YEDTPYGKKPLTEVWADDTHESLDRTL---------- 111

Query: 466  XXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHVMEIQVNG 645
                            D +   +        IRV+ HT      G+ +K   VME +V G
Sbjct: 112  -SVPTRRVTDELIEALDTEEIAD--------IRVITHTVPGDHAGVPKKNPDVMETRVGG 162

Query: 646  GTIAQKVDFAYGFFEKQV--PIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTH 819
            GT+A +++FA    E         VF+  E  D  G+TKGKG +G V RWGV +   K  
Sbjct: 163  GTLADRLEFAADLIEDGGVHAFGDVFRAGEFADAAGITKGKGTQGPVKRWGVQKRKGKHA 222

Query: 820  RGL-RKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRT 996
            R + R++  +G W+P+RV  TV + GQ GYH RTELNK++  +   G E           
Sbjct: 223  RHVARRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIND-GDEP---------- 271

Query: 997  EKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLL-NQTSRVALEEIKLKFID 1173
                +P GGFP+YG V   Y L+KG   GP++R+V  R  +  N++ R+   + +++++ 
Sbjct: 272  ----SPDGGFPNYGEVDGPYTLVKGSVPGPEQRLVRFRLGVRPNESPRL---DPEVRYVS 324

Query: 1174 TSSKFG 1191
            T+S  G
Sbjct: 325  TASNQG 330



>sp|Q06844|RL3_HALSA 50S ribosomal protein L3P.
          Length = 329

 Score =  183 bits (465), Expect = 6e-45
 Identities = 129/366 (35%), Positives = 181/366 (49%), Gaps = 4/366 (1%)
 Frame = +1

Query: 106  PRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPGSKLH 285
            PR GS+GF PRKRA  +  +  ++P DD      L AF GYKAGMTH+V   +K  +   
Sbjct: 6    PRKGSMGFSPRKRAESEVPRFNSWPADDGE--VGLQAFAGYKAGMTHVVLVDDKANAPTE 63

Query: 286  KKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKNWCXXXXX 465
              ET   VT VETPPM  V +  Y  TP G + L  VWA   +E L R            
Sbjct: 64   GMETTVPVT-VETPPMRAVRL--YEDTPYGKKPLTEVWADDTHESLDRTL---------- 110

Query: 466  XXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHVMEIQVNG 645
                            D +   +        IRV+ HT      G+ +K   VME +V G
Sbjct: 111  -SVPTRRVTDELIEALDTEEIAD--------IRVITHTVPGDHAGVPKKNPDVMETRVGG 161

Query: 646  GTIAQKVDFAYGFFEKQV--PIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTH 819
            GT+A +++FA    E         VF+  E  D  G+TKGKG +G V RWGV +   K  
Sbjct: 162  GTLADRLEFAADLIEDGGVHAFGDVFRAGEFADAAGITKGKGTQGPVKRWGVQKRKGKHA 221

Query: 820  RGL-RKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRT 996
            R + R++  +G W+P+RV  TV + GQ GYH RTELNK++  +   G E           
Sbjct: 222  RHVARRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIND-GDEP---------- 270

Query: 997  EKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLL-NQTSRVALEEIKLKFID 1173
                +P GGFP+YG V   Y L+KG   GP++R+V  R  +  N++ R+   + +++++ 
Sbjct: 271  ----SPDGGFPNYGEVDGPYTLVKGSVPGPEQRLVRFRLGVRPNESPRL---DPEVRYVS 323

Query: 1174 TSSKFG 1191
            T+S  G
Sbjct: 324  TASNQG 329



>sp|P20279|RL3_HALMA 50S ribosomal protein L3P (Hmal3) (Hl1).
          Length = 338

 Score =  183 bits (464), Expect = 8e-45
 Identities = 121/371 (32%), Positives = 181/371 (48%), Gaps = 9/371 (2%)
 Frame = +1

Query: 106  PRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPGSKLH 285
            PR GSLGF PRKR++ +  +  ++P DD     +   F GYKAGMTH+V   ++P S   
Sbjct: 6    PRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQ--GFAGYKAGMTHVVLVNDEPNSPRE 63

Query: 286  KKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKNWCXXXXX 465
              E    VT++ETPPM  V +  Y  TP G R L  VW    + EL R            
Sbjct: 64   GMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTL---------- 113

Query: 466  XXXXXXXXXXXXXXXXDIQSQLEKLKKYSCV-----IRVLAHTQIRKMKGLKQKKAHVME 630
                            D  +  E+++          +R++ HT    +  + +KK  VME
Sbjct: 114  ----------DVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVME 163

Query: 631  IQVNGGTIAQKVDFAYGFFEK--QVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRL 804
             +V GG+++ ++D A    E   +  ++ +F+  E  D+ GVTKGKG +G V RWGV + 
Sbjct: 164  TRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKR 223

Query: 805  PRKTHRG--LRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTAL 978
              K  R    R++  +G W+P+RV  TV + GQ GYH RTELNK++  +G+ G E     
Sbjct: 224  KGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGE-GDEP---- 278

Query: 979  TEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIK 1158
                      T  GGF +YG V   Y L+KG   GP KR+V   +  +    +  L+  +
Sbjct: 279  ----------TVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVPFFRPAVRPNDQPRLDP-E 327

Query: 1159 LKFIDTSSKFG 1191
            ++++   S  G
Sbjct: 328  VRYVSNESNQG 338



>sp|Q8PV50|RL3_METMA 50S ribosomal protein L3P.>gb:AE013454_292454
            Methanosarcina mazei strain Goe1, section 236 of 379 of
            the complete genome.>gb:AE008384_966563 Methanosarcina
            mazei strain Goe1, complete genome.
          Length = 337

 Score =  182 bits (461), Expect = 2e-44
 Identities = 113/364 (31%), Positives = 181/364 (49%), Gaps = 2/364 (0%)
 Frame = +1

Query: 106  PRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPGSKLH 285
            P+ GSL F PRKRA     + +A+P  +++   +L +F GYK GMTH++   +   S   
Sbjct: 7    PKRGSLAFSPRKRAKSHIPRFRAWP--EATGEPKLQSFAGYKVGMTHVIMVDDIKNSLTQ 64

Query: 286  KKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKNWCXXXXX 465
              E    VT++ETP + +  V  Y +   G + +   WA  L+ EL+RR           
Sbjct: 65   GMEISVPVTVIETPAIRVAAVRAYTEDSTGEKAIAEAWAADLDSELKRRI---------- 114

Query: 466  XXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHVMEIQVNG 645
                            +I   +E+ +     IR + +T  + + G+ +K   +ME  ++ 
Sbjct: 115  ---PIPAAGNQAEGLENIGKLIEEGRVSD--IRAVTYTLPKSLTGVPKKVPDIMESGISA 169

Query: 646  GTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHR- 822
              +  K ++A       V +  VF+   ++D   +T GKG +G V RWG+     K  R 
Sbjct: 170  KDLGAKFEYAKSILGNLVNVTDVFKNGTVVDTAAITIGKGTQGPVKRWGIQLQKGKHSRQ 229

Query: 823  -GLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTE 999
              LR++  +G+++P+RVS+ V + GQ GYH RTE NK+I K+G  G+E            
Sbjct: 230  GSLRQIGTLGSFNPSRVSWRVPQMGQMGYHQRTEFNKRILKIGSDGEE------------ 277

Query: 1000 KDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLKFIDTS 1179
              +TP GGF +YG+V+ DY+LIKG   GP KR++ LR  +  +  +  L E  + +I   
Sbjct: 278  --VTPEGGFINYGLVRGDYVLIKGSVPGPSKRLIRLRDPI--RAKKADLGEPNILYISRE 333

Query: 1180 SKFG 1191
            SK G
Sbjct: 334  SKQG 337



>sp|Q9UXA8|RL3_SULSO 50S ribosomal protein L3P.>pir|C90220|C90220 lSU
            ribosomal protein L3AB (rpl3AB) [imported] - Sulfolobus
            solfataricus>gb:SSU18930_191211 Sulfolobus solfataricus
            281 kb genomic DNA fragment, strain
            P2.>gb:AE006697_221616 Sulfolobus solfataricus P2 section
            56 of 272 of the complete genome.>gb:AE006641_1107464
            Sulfolobus solfataricus P2, complete genome.
          Length = 351

 Score =  181 bits (458), Expect = 4e-44
 Identities = 121/376 (32%), Positives = 193/376 (51%), Gaps = 6/376 (1%)
 Frame = +1

Query: 82   MSHRKFEHPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREV 261
            M HRK   PR GS G  PRKR+S      + +P+ +S  P +L  F+GYK GMTH+    
Sbjct: 1    MGHRKLASPRRGSAGLRPRKRSSELLPTPRTWPQINSQNP-KLLGFVGYKVGMTHVFMID 59

Query: 262  EKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGL-RCLNTVWAQHLNE--ELRRR 432
            + P S  + KE    VT++E PP++ + +  Y    +G    +   W+    +  ++ RR
Sbjct: 60   DWPNSPTNGKEIYMPVTVLEVPPIIPLALRAYAIDGKGEPNVITEYWSSSSLQFLDITRR 119

Query: 433  FYKNWCXXXXXXXXXXXXXXXXXXXXXD-IQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQ 609
             +                         D I+S L+++  +    R+L  TQ RK+  L +
Sbjct: 120  IHS--ISSFLKDDESKKKFDERFNTKLDLIKSNLDRIVYF----RLLVSTQPRKIPSLGK 173

Query: 610  KKAHVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRW 789
            K   ++EIQ+ GG    ++D+A     K++ I  VF++ ++ID++GVTKGKG+ GV+ R+
Sbjct: 174  KAPDLVEIQIGGGEKKSQLDYALNILGKEITIRDVFKEGQLIDVVGVTKGKGFAGVIKRY 233

Query: 790  GVTRLPR--KTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQE 963
             V  LPR  K  +G RK+   G       S+T  + GQ G+H RTE NK+I K+G     
Sbjct: 234  SVVELPRWHKHRKGSRKIGTRGP-SLGTPSYT-PQPGQLGFHRRTEYNKRIIKIGD---- 287

Query: 964  NHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVA 1143
                        K+I P GGF  YG+V++ Y+L++G  +G KKR + LR+ +  + S V 
Sbjct: 288  ----------EPKEINPAGGFVRYGIVRNTYVLLEGSILGSKKRPIFLREPV--RPSYVF 335

Query: 1144 LEEIKLKFIDTSSKFG 1191
                K+ +++  S+ G
Sbjct: 336  ENPPKITYVNLLSQQG 351



>gb:MMU89417_2123888 Mus musculus strain BALB/c ribosomal protein L3
           mRNA, partial cds.
          Length = 117

 Score =  176 bits (445), Expect = 1e-42
 Identities = 79/107 (73%), Positives = 96/107 (89%)
 Frame = +1

Query: 631 IQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPR 810
           IQVNGGT+A+K+D+A    E+QVP++ VF +DEMID+IGVTKGKGY+GV +RW   +LPR
Sbjct: 1   IQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPR 60

Query: 811 KTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGK 951
           KTHRGLRKVACIGAWHPARV+F+VARAGQ GYHHRTE+NKKIYK+G+
Sbjct: 61  KTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEINKKIYKIGQ 107



>sp|Q29293|RL3_PIG 60S ribosomal protein L3 (Fragment).
          Length = 130

 Score =  171 bits (432), Expect = 4e-41
 Identities = 79/130 (60%), Positives = 103/130 (79%), Gaps = 6/130 (4%)
 Frame = +1

Query: 694  QVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVS 873
            +VP++ VF +DEMID+IGVTKGKGY+GV +RW   +LPRKTHRGLRKVACIGAWHPAR +
Sbjct: 1    RVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARXA 60

Query: 874  FTVARAGQNGYHHRTELNKKIYKLG-----KVGQ-ENHTALTEFDRTEKDITPMGGFPHY 1035
            F+VARAGQ GYHHRTE+NKKIYK+G     K G+   +   T++D ++K I P+G F HY
Sbjct: 61   FSVARAGQKGYHHRTEINKKIYKIGQGYLIKDGKLIKNNXXTDYDLSDKSINPLGRFVHY 120

Query: 1036 GVVKDDYLLI 1065
            G V +D++++
Sbjct: 121  GEVTNDFVML 130



>gb:AE014297_1138966 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003690_1220959 Drosophila melanogaster
           chromosome 3R, section 28 of 118 of the complete
           sequence.
          Length = 125

 Score =  170 bits (430), Expect = 7e-41
 Identities = 76/108 (70%), Positives = 93/108 (86%)
 Frame = +1

Query: 121 LGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKKETC 300
           + F P+KR++R RGKVKAFPKDD+SKP  LT F+GYKAGMTHIVRE ++PGSK++KKE  
Sbjct: 1   MAFYPKKRSARHRGKVKAFPKDDASKPVHLTCFIGYKAGMTHIVREADRPGSKINKKEVV 60

Query: 301 EAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKN 444
           EAVT++ETPPM++VG VGY++TP GLR L  VWAQHL+EE RRRFYKN
Sbjct: 61  EAVTVLETPPMIVVGAVGYIETPFGLRALVNVWAQHLSEECRRRFYKN 108



>gb:AX885972_1481425 Sequence 1835 from Patent EP1033401.
          Length = 151

 Score =  168 bits (426), Expect = 2e-40
 Identities = 82/146 (56%), Positives = 107/146 (73%)
 Frame = +1

Query: 238 MTHIVREVEKPGSKLHKKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNE 417
           MTHIVREV++PGSK++KKE  EAVTIVETPPMV+VG+VGYV+TPRGLR   TV+A+H+++
Sbjct: 1   MTHIVREVDRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKTVFAEHISD 60

Query: 418 ELRRRFYKNWCXXXXXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMK 597
           E +RRFYKNW                       ++     +KKY  VIRV+AHTQ+R + 
Sbjct: 61  ECKRRFYKNWHKSKKKAFTKYCKKWQDEDGKKQLEKDFSSMKKYCQVIRVIAHTQMRLLP 120

Query: 598 GLKQKKAHVMEIQVNGGTIAQKVDFA 675
            L+QKKAH+MEIQVNGGT+A+K+D+A
Sbjct: 121 -LRQKKAHLMEIQVNGGTVAEKLDWA 145



>sp|P60458|RL3_NANEQ 50S ribosomal protein L3P.>gb:AE017199_403255
            Nanoarchaeum equitans Kin4-M, complete genome.
          Length = 321

 Score =  167 bits (424), Expect = 4e-40
 Identities = 107/360 (29%), Positives = 181/360 (50%)
 Frame = +1

Query: 106  PRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPGSKLH 285
            PR GS+GF PRKRASR   ++K +PK +  KP    AF  YK GMTH +  +       +
Sbjct: 9    PRRGSMGFWPRKRASRIYPRIKTWPKIEEIKPL---AFAAYKVGMTHTILNI-------N 58

Query: 286  KKETCEAVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKNWCXXXXX 465
             +     VT++E P ++++G   Y K    L+ +++++   L + + R+  K        
Sbjct: 59   GERVFTPVTVLEAPELLVIGAKAYKKENGALKEISSLYFNDLPQYVFRKIPK-------- 110

Query: 466  XXXXXXXXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHVMEIQVNG 645
                            + + Q       +  ++++  TQ  K+K   +K   + +I + G
Sbjct: 111  ---------LKNYNFEEKKEQFLSKADNADEVKIIVSTQPWKIK--LKKTPEIFDIPIGG 159

Query: 646  GTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRG 825
              + +K+++A     K++ I+ VF++ + +D+I VTKGKG++GV+ R+ V R   K+ +G
Sbjct: 160  SDVNKKLEYALSLLGKELSINDVFKEGQYVDVIAVTKGKGFQGVIKRFHVHRRQHKSEKG 219

Query: 826  LRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKD 1005
            +RKV  IG+  P R+  TV   GQ GYH RTE NK I K+G                 + 
Sbjct: 220  VRKVGAIGSRGPGRIFPTVPMPGQMGYHRRTEYNKLIIKIG-----------------EP 262

Query: 1006 ITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLKFIDTSSK 1185
            +   GG+  YG V    +L+KG   GP+KR++ LR+++     +  +E I  ++I  S K
Sbjct: 263  LNVEGGWVRYGQVIGPTILLKGSVPGPRKRLIILREAIRPPRKQEKVEGI--EYISLSPK 320



>sp|Q97BX7|RL3_THEVO 50S ribosomal protein L3P.>gb:BA000011_664770
            Thermoplasma volcanium GSS1 DNA, complete genome.
          Length = 331

 Score =  166 bits (419), Expect = 1e-39
 Identities = 104/366 (28%), Positives = 181/366 (49%), Gaps = 3/366 (0%)
 Frame = +1

Query: 103  HPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPGSKL 282
            H R GS+ + PR RA     +++++P  + S P ++  F G+K GMTH+     +  S  
Sbjct: 6    HSRRGSMAYYPRVRAKSIEPRIRSWP--EISGPVKVQGFAGFKVGMTHVEMVDYRKTSVT 63

Query: 283  HKKETCEAVTIVETPPMVIVGVVGYVKTPRG-LRCLNTVWAQHLNEELRRRFYKNWCXXX 459
              +     VT++E PP+ ++G+  Y +   G +  +   W Q+L++EL ++         
Sbjct: 64   AGQPIFVPVTVIEVPPLDVIGIRLYDEDEEGNMVVVYEKWTQNLDKELFKKI-------- 115

Query: 460  XXXXXXXXXXXXXXXXXXDIQSQLEK-LKKYSCVIRVLAHTQIRKMKGLKQKKAHVMEIQ 636
                                +   EK + +    +R++  T+ + + G+  KK  + E++
Sbjct: 116  -----------------TTFKEVKEKPVPETYADVRLIVATRNKDVPGIPSKKPEIFELR 158

Query: 637  VNGG-TIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRK 813
            + GG ++ ++ ++A     K +  +   +  + +D++ VTKGKG+ G V R+GV  LPRK
Sbjct: 159  IGGGNSVKERFEYATAHLGKTIRFEDFSKPGKFVDVLSVTKGKGFTGHVQRFGVKLLPRK 218

Query: 814  THRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDR 993
              +  R +  +G WHP  V  TV +AGQ GY  RT  N ++ K  K G++  T       
Sbjct: 219  NRKHRRMIGTLGPWHPDWVRNTVPQAGQMGYQQRTISNVRVLKYSK-GEDADT------- 270

Query: 994  TEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLKFID 1173
                I   GGF HYG+VK+DY+L+ G   GP KR++ +R     +   +  + +KL +I 
Sbjct: 271  ----INVRGGFLHYGLVKNDYVLLFGSVPGPAKRLIKMRDPARQKVPDI--DNVKLDYIS 324

Query: 1174 TSSKFG 1191
              SK G
Sbjct: 325  LESKQG 330



>gb:AY158026_2516026 Fundulus heteroclitus ribosomal protein L3
           mRNA, partial cds.
          Length = 154

 Score =  164 bits (414), Expect = 5e-39
 Identities = 79/155 (50%), Positives = 108/155 (69%)
 Frame = +1

Query: 304 AVTIVETPPMVIVGVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKNWCXXXXXXXXXXX 483
           AVTIVETPPMV+VGVVGYV TPRGLR   T++++H+++E +RRFY+NW            
Sbjct: 1   AVTIVETPPMVVVGVVGYVSTPRGLRSFKTIFSEHMSDECKRRFYRNWYKSKKKAFTKYC 60

Query: 484 XXXXXXXXXXDIQSQLEKLKKYSCVIRVLAHTQIRKMKGLKQKKAHVMEIQVNGGTIAQK 663
                      ++     +KKY  V+RV+AHTQ+R +  L+QKK+H+ME+Q+NGGTI+ K
Sbjct: 61  KKWQDEEGKKQLEKDFSAMKKYCQVVRVIAHTQMRLLP-LRQKKSHLMEVQLNGGTISDK 119

Query: 664 VDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGY 768
           VD+A    E+QV + AVF +DEMID+IGVTKG G+
Sbjct: 120 VDWAREKLEQQVAVSAVFSQDEMIDVIGVTKGHGW 154



>sp|Q9HIQ9|RL3_THEAC 50S ribosomal protein L3P.>gb:TACID5_197025
            Thermoplasma acidophilum complete genome; segment 5/5.
          Length = 331

 Score =  163 bits (413), Expect = 7e-39
 Identities = 107/367 (29%), Positives = 180/367 (49%), Gaps = 4/367 (1%)
 Frame = +1

Query: 103  HPRHGSLGFLPRKRASRQRGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPGSKL 282
            H R GS+ + PR RA     K++++P+       ++  F G+K GMTH+     +  S  
Sbjct: 6    HSRRGSMAYYPRVRAKSVDPKIRSWPEIKGE--VKVQGFAGFKVGMTHVEMIDYRKKSVT 63

Query: 283  HKKETCEAVTIVETPPMVIVGVVGYVKTPRG-LRCLNTVWAQHLNEELRRRFYKNWCXXX 459
              +     VT+VE PP+ +VG   Y +   G L  +   WA+ L++E+ R+         
Sbjct: 64   AGQPILVPVTVVEVPPLDVVGYRLYDEDAEGNLVVVFEAWAKDLDKEIFRKI-------- 115

Query: 460  XXXXXXXXXXXXXXXXXXDIQSQLEKLKKYSCV-IRVLAHTQIRKMKGLKQKKAHVMEIQ 636
                              +I+   E+    S   +R++  T+ + + G+  KK  + E++
Sbjct: 116  -----------------PEIKKVAERDPPESYEDVRIIVATRNKDVPGIPSKKPEIFELR 158

Query: 637  VNGG-TIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRK 813
            + GG ++ +++++A     KQ+      +  + +D++ +TKGKG+ G V R+GV  LPRK
Sbjct: 159  IGGGNSVKERLEYAKNHLGKQITFTDFSKPGKFVDVVSITKGKGFTGHVKRFGVKLLPRK 218

Query: 814  THRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDR 993
              +  R +  +G WHP  V  TV +AGQ G+  RT  N ++ K G             ++
Sbjct: 219  NRKHRRMIGTLGPWHPDWVRNTVPQAGQMGFQQRTISNVRVIKYG-------------NK 265

Query: 994  TEKD-ITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLKFI 1170
             E D I   GGF HYG VK+DY+L+ G   G  KR++ +R     +   +  EE+KL++I
Sbjct: 266  EEVDSINVRGGFLHYGFVKNDYVLLFGSIPGASKRLIKMRDPARQKVPDI--EEVKLEYI 323

Query: 1171 DTSSKFG 1191
               SK G
Sbjct: 324  SLESKQG 330



>gb:AF051237_1764226 Picea mariana 60S ribosomal protein L3 (Sb51)
            mRNA, partial cds.
          Length = 86

 Score =  156 bits (394), Expect = 1e-36
 Identities = 75/86 (87%), Positives = 80/86 (93%)
 Frame = +1

Query: 991  RTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLKFI 1170
            RTEKDITPMGGFPHYGV+KDDY++I+G CVG KKRVVTLRQSLL QTSR ALEEIKLKFI
Sbjct: 1    RTEKDITPMGGFPHYGVLKDDYIMIRGCCVGTKKRVVTLRQSLLKQTSRTALEEIKLKFI 60

Query: 1171 DTSSKFGHGRFQTTQEKQKFFGRLKA 1248
            DTSSKFGHGRFQTTQEK K FG+LKA
Sbjct: 61   DTSSKFGHGRFQTTQEKAKIFGKLKA 86



>gb:AB099068_1410391 Bos taurus mRNA for similar to ribosomal protein
            L3, partial cds, clone: ORCS13351.
          Length = 104

 Score =  119 bits (298), Expect = 2e-25
 Identities = 57/93 (61%), Positives = 74/93 (79%)
 Frame = +1

Query: 967  HTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVAL 1146
            + A T++D ++K I P+GGF HYG V +D++++KG  VG KKRV+TLR+SLL QT R AL
Sbjct: 2    NNASTDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRAL 61

Query: 1147 EEIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLK 1245
            E+I LKFIDT+SKFGHGRFQT +EK+ F G LK
Sbjct: 62   EKIDLKFIDTTSKFGHGRFQTVEEKKAFMGPLK 94



>gb:AB007166_1863932 Homo sapiens gene for ribosomal protein L3,
            partial cds.
          Length = 71

 Score = 89.7 bits (221), Expect = 1e-16
 Identities = 44/66 (66%), Positives = 55/66 (83%)
 Frame = +1

Query: 1048 DDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLKFIDTSSKFGHGRFQTTQEKQK 1227
            +D++++KG  VG KKRV+TLR+SLL QT R ALE+I LKFIDT+SKFGHGRFQT +EK+ 
Sbjct: 1    NDFVMLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKA 60

Query: 1228 FFGRLK 1245
            F G LK
Sbjct: 61   FMGPLK 66



>gb:AB098822_1410191 Bos taurus mRNA for similar to ribosomal protein
            L3, partial cds, clone: ORCS13351.
          Length = 72

 Score = 85.5 bits (210), Expect = 2e-15
 Identities = 43/62 (69%), Positives = 51/62 (82%)
 Frame = +1

Query: 1060 LIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLKFIDTSSKFGHGRFQTTQEKQKFFGR 1239
            ++KG  VG KKRV+TLR+SLL QT R ALE+I LKFIDT+SKFGHGRFQT +EK+ F G 
Sbjct: 1    VLKGCVVGTKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTVEEKKAFMGP 60

Query: 1240 LK 1245
            LK
Sbjct: 61   LK 62



>gb:AF247852_1255293 Caenorhabditis remanei ribosomal protein L3
           (rpl-3) gene, partial cds, alternatively spliced.
          Length = 91

 Score = 78.6 bits (192), Expect = 3e-13
 Identities = 37/90 (41%), Positives = 51/90 (56%)
 Frame = +1

Query: 343 GVVGYVKTPRGLRCLNTVWAQHLNEELRRRFYKNWCXXXXXXXXXXXXXXXXXXXXXDIQ 522
           GV GY+ TP+G R L T+WA+HL+EE RRRFY NW                       I+
Sbjct: 2   GVTGYIDTPQGPRALTTIWAEHLSEEARRRFYSNWAKSKKKAFTKYAKKWQDEDGKKLIE 61

Query: 523 SQLEKLKKYSCVIRVLAHTQIRKMKGLKQK 612
           +   KLKKY   IRV+AHTQ++ ++  ++K
Sbjct: 62  ADFAKLKKYCSSIRVIAHTQMKILRRRQKK 91



>gb:AF227523_2059934 Mus musculus ribosomal protein L3 (Rp13) gene,
            partial cds.
          Length = 67

 Score = 73.6 bits (179), Expect = 9e-12
 Identities = 37/69 (53%), Positives = 52/69 (75%)
 Frame = +1

Query: 946  GKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLN 1125
            GK+ + N  A T++D ++K I P+GGF HYG V +D++++KG  VG KKRV+TLR+SLL 
Sbjct: 1    GKLIKNN--ASTDYDLSDKSINPLGGFVHYGEVTNDFIMLKGCVVGTKKRVLTLRKSLLV 58

Query: 1126 QTSRVALEE 1152
            QT R ALE+
Sbjct: 59   QTKRRALEK 67



>gb:AF127447_1770539 Picea abies 60S ribosomal protein L3 (Sb51) gene,
            Sb51-358 allele, partial cds.>gb:AF127448_1770540 Picea
            abies 60S ribosomal protein L3 (Sb51) gene, Sb51-355
            allele, partial cds.
          Length = 33

 Score = 64.3 bits (155), Expect = 6e-09
 Identities = 30/33 (90%), Positives = 31/33 (93%)
 Frame = +1

Query: 1150 EIKLKFIDTSSKFGHGRFQTTQEKQKFFGRLKA 1248
            EIKLKFIDTSSKFGHGRFQTTQEK K FG+LKA
Sbjct: 1    EIKLKFIDTSSKFGHGRFQTTQEKAKIFGKLKA 33



>sp|Q890N9|RL3_CLOTE 50S ribosomal protein L3.>gb:AE015945_321618
            Clostridium tetani E88, section 10 of 10 of the complete
            genome.>gb:AE015927_964407 Clostridium tetani E88,
            complete genome.
          Length = 209

 Score = 56.2 bits (134), Expect = 2e-06
 Identities = 41/144 (28%), Positives = 64/144 (44%), Gaps = 1/144 (0%)
 Frame = +1

Query: 691  KQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARV 870
            +++ +D +F+  E ID+ G +KGKGY+G++ RW   R P                H ++ 
Sbjct: 95   QEIKVD-IFEAGEKIDVTGTSKGKGYQGIIKRWNAHRGPMS--------------HGSKF 139

Query: 871  SFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALT-EFDRTEKDITPMGGFPHYGVVK 1047
               V   G   Y  RT  NK++   G +G    T L  E  +T              + +
Sbjct: 140  HRAVGSMGAASYPARTFKNKRM--AGHMGNVKSTVLNLEVVKT--------------IPE 183

Query: 1048 DDYLLIKGGCVGPKKRVVTLRQSL 1119
             + +LIKGG  GP K  V +R S+
Sbjct: 184  KNLILIKGGIPGPNKGYVIIRNSI 207



>sp|Q97EH8|RL3_CLOAB 50S ribosomal protein L3.>pir|E97285|E97285
            ribosomal protein L3 [imported] - Clostridium
            acetobutylicum>gb:AE007808_230433 Clostridium
            acetobutylicum ATCC 824 section 296 of 356 of the
            complete genome.>gb:AE001437_1093388 Clostridium
            acetobutylicum ATCC 824, complete genome.
          Length = 209

 Score = 53.9 bits (128), Expect = 8e-06
 Identities = 37/140 (26%), Positives = 61/140 (43%), Gaps = 4/140 (2%)
 Frame = +1

Query: 712  VFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPR----KTHRGLRKVACIGAWHPARVSFT 879
            +F   E +D+ GV+KGKG++G + RWG  R P     K HR +  +   G+  P+R   +
Sbjct: 101  IFAAGEKVDVSGVSKGKGFQGTIRRWGAHRGPMSHGSKFHRAVGSMG--GSSDPSRTFKS 158

Query: 880  VARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYL 1059
                G  G+ + T LN ++ K+                               + + + +
Sbjct: 159  KKMPGHMGHVNTTVLNVEVAKV-------------------------------IPEKNLI 187

Query: 1060 LIKGGCVGPKKRVVTLRQSL 1119
            LIKGG  GP K  V ++ S+
Sbjct: 188  LIKGGVPGPNKSFVVIKNSV 207



>sp|Q7XYP4|RK3_CHLS6 50S ribosomal protein L3, chloroplast
           precursor.>gb:AY267636_1314459 Bigelowiella natans
           ribosomal protein rpL3 mRNA, complete cds; nuclear gene
           for plastid product.
          Length = 302

 Score = 51.6 bits (122), Expect = 4e-05
 Identities = 34/119 (28%), Positives = 58/119 (48%), Gaps = 4/119 (3%)
 Frame = +1

Query: 574 HTQIRKMKGLKQKKAHVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVT 753
           H  ++ MK LK+ K            IA   +F  G   +Q+  + +F+  +++D+ G +
Sbjct: 159 HGNVKAMKHLKEFK------------IADVSEFTPG---QQLKAEELFEVGDLVDVSGTS 203

Query: 754 KGKGYEGVVTRWGVTRLP----RKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRT 918
            GKG++G + RWG+ R P     K+HR    + C     P+RV   +  AG+ G   +T
Sbjct: 204 SGKGFQGSIRRWGMKRGPMSHGSKSHRQHGSIGCSAT--PSRVYKGLKMAGRMGNERKT 260



>gb:AE017308_437857 Mycoplasma mobile 163K complete genome.
          Length = 297

 Score = 50.4 bits (119), Expect = 9e-05
 Identities = 39/173 (22%), Positives = 75/173 (43%), Gaps = 13/173 (7%)
 Frame = +1

Query: 712  VFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRG------LRKVACIGAWHPARVS 873
            +F+  E++D+ G++KGKG+ G + R    ++  K+H G      +R+   IG     +V 
Sbjct: 98   IFKSGELVDVTGISKGKGFAGTIKRHN-QKIGPKSHGGGGGSKPVRQTGSIGDIAGNKVL 156

Query: 874  FTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDD 1053
              +   G  G   RT  N ++ K+                                +K++
Sbjct: 157  KGMTMPGHLGNVQRTIQNLEVVKVD-------------------------------IKNN 185

Query: 1054 YLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLK-------FIDTSSKFG 1191
             LL+KG   GPK   + ++ ++ N  SR A+E + +K        ++++ K+G
Sbjct: 186  ILLVKGSVPGPKNCFLIIKSAIKNLPSREAIELVNIKEAILKNQLLESAKKYG 238



>gb:BA000016_675445 Clostridium perfringens str. 13 DNA, complete
            genome.
          Length = 216

 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 40/146 (27%), Positives = 62/146 (42%), Gaps = 4/146 (2%)
 Frame = +1

Query: 694  QVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPR----KTHRGLRKVACIGAWHP 861
            ++ +D  F+  + +D+ GV+KGKG++G + RW  +R P     K HR    +    A  P
Sbjct: 103  EIKVDT-FEIGDKVDVSGVSKGKGFQGTIKRWNASRGPMSHGSKFHRAPGSMGA--ASDP 159

Query: 862  ARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGV 1041
            +R        G  G  + T LN ++ K+                 EK+I           
Sbjct: 160  SRTFKNKRMPGHMGAKNTTVLNLEVVKI---------------MPEKNI----------- 193

Query: 1042 VKDDYLLIKGGCVGPKKRVVTLRQSL 1119
                 +LIKGG  GP K  V +R S+
Sbjct: 194  -----ILIKGGIPGPNKGTVVIRNSV 214



>sp|Q8XHS3|RL3_CLOPE 50S ribosomal protein L3.
          Length = 209

 Score = 49.7 bits (117), Expect = 1e-04
 Identities = 40/146 (27%), Positives = 62/146 (42%), Gaps = 4/146 (2%)
 Frame = +1

Query: 694  QVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPR----KTHRGLRKVACIGAWHP 861
            ++ +D  F+  + +D+ GV+KGKG++G + RW  +R P     K HR    +    A  P
Sbjct: 96   EIKVDT-FEIGDKVDVSGVSKGKGFQGTIKRWNASRGPMSHGSKFHRAPGSMGA--ASDP 152

Query: 862  ARVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGV 1041
            +R        G  G  + T LN ++ K+                 EK+I           
Sbjct: 153  SRTFKNKRMPGHMGAKNTTVLNLEVVKI---------------MPEKNI----------- 186

Query: 1042 VKDDYLLIKGGCVGPKKRVVTLRQSL 1119
                 +LIKGG  GP K  V +R S+
Sbjct: 187  -----ILIKGGIPGPNKGTVVIRNSV 207



>sp|Q839G4|RL3_ENTFA 50S ribosomal protein L3.>gb:AE016947_364336
            Enterococcus faecalis V583, section 1 of 11 of the
            complete genome.>gb:AE016830_990824 Enterococcus faecalis
            V583, complete genome.
          Length = 209

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 38/144 (26%), Positives = 64/144 (44%), Gaps = 1/144 (0%)
 Frame = +1

Query: 691  KQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRK-THRGLRKVACIGAWHPAR 867
            K++ +D VFQ  +++D+ G TKGKG++G + R G +R P     R  R+   +G   P R
Sbjct: 95   KEIKVD-VFQAGDVVDVTGTTKGKGFQGAIKRHGQSRGPMSHGSRYHRRPGSMGPVAPNR 153

Query: 868  VSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVK 1047
            V      AG+ G    T  N ++ K+                                V+
Sbjct: 154  VFKNKRLAGRMGGDRVTIQNLEVVKVD-------------------------------VE 182

Query: 1048 DDYLLIKGGCVGPKKRVVTLRQSL 1119
             + +LIKG   G KK ++T++ ++
Sbjct: 183  RNVILIKGNIPGAKKSLITIKSAV 206



>gb:AE016822_340976 Leifsonia xyli subsp. xyli str. CTCB07, complete
           genome.
          Length = 219

 Score = 47.8 bits (112), Expect = 6e-04
 Identities = 37/129 (28%), Positives = 60/129 (46%), Gaps = 6/129 (4%)
 Frame = +1

Query: 568 LAHTQIRKMKGLKQKKAHVMEIQVNGG---TIAQKVDFAYGFFEKQVPIDAVFQKDEMID 738
           +A+ QI + K  K    H  +  V      T  +  D A     +++ +D  F+  +++D
Sbjct: 58  IAYGQIDRRKVNKPSAGHFDKAGVTPRRHLTEVRTADAAEYSAGQELTVDGTFEAGQLVD 117

Query: 739 IIGVTKGKGYEGVVTRWGVTRLPRK--THRGLRKVACIGAWH-PARVSFTVARAGQNGYH 909
           ++G +K KG+ GV+ R     +      HR  RK   IGA   P+RV   +  AG+ G  
Sbjct: 118 VVGTSKSKGFAGVMKRHNFQGVSASHGAHRNHRKPGSIGASSTPSRVFKGMRMAGRMGGE 177

Query: 910 HRTELNKKI 936
             T LN K+
Sbjct: 178 RVTVLNLKV 186



>gb:AF236098_1416545 Bos taurus ribosomal protein L3 gene, partial
            cds.
          Length = 43

 Score = 47.4 bits (111), Expect = 7e-04
 Identities = 19/42 (45%), Positives = 30/42 (71%)
 Frame = +1

Query: 979  TEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVT 1104
            T++D ++K I P+GGF HYG V +D++++KG  VG    V+T
Sbjct: 2    TDYDLSDKSINPLGGFVHYGEVTNDFVMLKGCVVGTXXXVLT 43



>gb:BA000043_736683 Geobacillus kaustophilus HTA426 DNA, complete
            genome.
          Length = 213

 Score = 47.4 bits (111), Expect = 7e-04
 Identities = 38/144 (26%), Positives = 65/144 (45%), Gaps = 1/144 (0%)
 Frame = +1

Query: 691  KQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP-RKTHRGLRKVACIGAWHPAR 867
            ++V +D +F + E++D+ G++KGKG++G + R G +R P     R  R+   +G+  P R
Sbjct: 95   QEVKVD-IFSEGEIVDVTGISKGKGFQGAIKRHGQSRGPMAHGSRYHRRPGSMGSIAPNR 153

Query: 868  VSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVK 1047
            V  T    G+ G    T  N KI K+                                 +
Sbjct: 154  VFKTKNLPGRMGGERVTIQNLKIVKVDP-------------------------------E 182

Query: 1048 DDYLLIKGGCVGPKKRVVTLRQSL 1119
             + LLIKG   GP+K +V ++ ++
Sbjct: 183  RNLLLIKGNVPGPRKGLVIVKSAV 206



>sp|P28600|RL3_BACST 50S ribosomal protein L3.>pir|S24363|S24363
            ribosomal protein L3 - Bacillus
            stearothermophilus>gb:BSRPLCLD_751190
            B.stearothermophilus genes rplC and rplD for ribosomal
            proteins L3 and L4, respectively.
          Length = 213

 Score = 47.4 bits (111), Expect = 7e-04
 Identities = 38/144 (26%), Positives = 65/144 (45%), Gaps = 1/144 (0%)
 Frame = +1

Query: 691  KQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP-RKTHRGLRKVACIGAWHPAR 867
            ++V +D +F + +++D+ G++KGKG++G + R G +R P     R  R+   +GA  P R
Sbjct: 95   QEVKVD-IFSEGDIVDVTGISKGKGFQGAIKRHGQSRGPMAHGSRYHRRPGSMGAIAPNR 153

Query: 868  VSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVK 1047
            V  T    G+ G    T  N KI K+                                 +
Sbjct: 154  VFKTKNLPGRMGGERVTIQNLKIVKVDP-------------------------------E 182

Query: 1048 DDYLLIKGGCVGPKKRVVTLRQSL 1119
             + LLIKG   GP+K +V ++ ++
Sbjct: 183  RNLLLIKGNVPGPRKGLVIVKSAV 206



>sp|Q7MTL3|RL3_PORGI 50S ribosomal protein L3.>gb:AE017178_398059
           Porphyromonas gingivalis W83 section 7 of 8 of the
           complete genome.>gb:AE015924_1033670 Porphyromonas
           gingivalis W83 complete genome.
          Length = 205

 Score = 47.0 bits (110), Expect = 0.001
 Identities = 28/81 (34%), Positives = 43/81 (53%), Gaps = 4/81 (4%)
 Frame = +1

Query: 715 FQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKT---HRGLRKVACIGAW-HPARVSFTV 882
           F   + +D++G +KGKG++GVV R G   + + T   H  LR    +GA  +PA+V    
Sbjct: 100 FSDADFVDVVGTSKGKGFQGVVKRHGFGGVGQATHGQHNRLRAPGAVGACSYPAKVFKGT 159

Query: 883 ARAGQNGYHHRTELNKKIYKL 945
             AGQ G    T  N ++ K+
Sbjct: 160 RMAGQMGNERVTVQNLEVIKV 180



>gb:CR522870_99969 Desulfotalea psychrophila LSv54 chromosome.
          Length = 209

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 21/62 (33%), Positives = 37/62 (59%), Gaps = 4/62 (6%)
 Frame = +1

Query: 697 VPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP----RKTHRGLRKVACIGAWHPA 864
           + +DA+F+  +++D+ G +KG+G++GV+ RWG    P     K HR    + C  + +P 
Sbjct: 99  ISVDALFKAGDIVDVQGTSKGRGFQGVIKRWGFKGGPGGHGSKHHRAPGSIGC--SAYPG 156

Query: 865 RV 870
           RV
Sbjct: 157 RV 158



>gb:AP006841_574701 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 205

 Score = 45.4 bits (106), Expect = 0.003
 Identities = 28/82 (34%), Positives = 44/82 (53%), Gaps = 4/82 (4%)
 Frame = +1

Query: 712 VFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKT---HRGLRKVACIGAW-HPARVSFT 879
           +F   + +D++G +KGKG++GVV R G   + + T   H   RK   IGA  +PA+V   
Sbjct: 99  LFDGADYVDVVGTSKGKGFQGVVKRHGFGGVGQSTHGQHNRARKPGSIGACSYPAKVFKG 158

Query: 880 VARAGQNGYHHRTELNKKIYKL 945
           +   GQ G    T  N ++ K+
Sbjct: 159 MRMGGQMGGDRVTVQNLQVLKV 180



>sp|O66431|RL3_AQUAE 50S ribosomal protein L3.>pir|D70300|D70300
            ribosomal protein L03 - Aquifex
            aeolicus>gb:AE000669_25782 Aquifex aeolicus VF5 section 1
            of 109 of the complete genome.>gb:AE000657_976313 Aquifex
            aeolicus VF5 complete genome.
          Length = 241

 Score = 45.4 bits (106), Expect = 0.003
 Identities = 37/162 (22%), Positives = 66/162 (40%), Gaps = 2/162 (1%)
 Frame = +1

Query: 691  KQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRK-THRGLRKVACIG-AWHPA 864
            +Q+ ++ VF+  +++D+ G++KG+G+ G + RW     P+   HR  R V  IG    P 
Sbjct: 96   QQLKVEDVFKPGDLVDVWGISKGRGFAGAMKRWDFAGFPKSHGHRYHRAVGAIGQRTDPG 155

Query: 865  RVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVV 1044
            RV       G  G                                K +   G F    + 
Sbjct: 156  RVWKGKRMPGHYG-------------------------------AKPVRVQGLFVVDVLP 184

Query: 1045 KDDYLLIKGGCVGPKKRVVTLRQSLLNQTSRVALEEIKLKFI 1170
            +++ +L+KG   G  K +V + QS +       L++ + +FI
Sbjct: 185  EENAILVKGSVPGHNKGIVVVEQSTIAYRKSQKLKQKRYQFI 226



>sp|O46894|RK3_GUITH Chloroplast 50S ribosomal protein
           L3.>gb:AF041468_1763572 Guillardia theta complete
           plastid genome.
          Length = 204

 Score = 44.7 bits (104), Expect = 0.005
 Identities = 39/131 (29%), Positives = 61/131 (46%), Gaps = 3/131 (2%)
 Frame = +1

Query: 568 LAHTQIRKMKGLKQKKAHVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIG 747
           L H Q+  +  LK  K + ++   +  TIAQ++D +            +F+  +++ + G
Sbjct: 66  LGHLQVNNLPPLKHLKEYKVDA-THTFTIAQQLDVS------------IFELGQIVSVSG 112

Query: 748 VTKGKGYEGVVTRWGVTRLPRKTH--RGLRKVACIGAWH-PARVSFTVARAGQNGYHHRT 918
           V+ GKG+ G V R   TR P  TH  +  R+   IG    PA+V      AG+ G H  T
Sbjct: 113 VSIGKGFAGTVKRHNFTRGP-MTHGSKNHREPGSIGQGSTPAKVHKGKKMAGRLGGHQVT 171

Query: 919 ELNKKIYKLGK 951
             N  +  L K
Sbjct: 172 TKNLTVVHLDK 182



>gb:BC084076_2563482 Xenopus laevis hypothetical LOC494992, mRNA
           (cDNA clone MGC:81544 IMAGE:6862817), complete cds.
          Length = 341

 Score = 44.3 bits (103), Expect = 0.006
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 5/84 (5%)
 Frame = +1

Query: 709 AVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP-----RKTHRGLRKVACIGAWHPARVS 873
           A F+  + +D+   T GKG++GV+ RWG    P      KTH   R+   I +  PARV 
Sbjct: 191 AHFRPGQFVDVTAKTIGKGFQGVMKRWGYKGQPASHGQTKTH---RRPGAISSGDPARVF 247

Query: 874 FTVARAGQNGYHHRTELNKKIYKL 945
                 G+ G  +RT    K++++
Sbjct: 248 PGTKMPGRMGNIYRTSYALKVWRV 271



>sp|Q98PY0|RL3_MYCPU 50S ribosomal protein L3.>pir|E90585|E90585 50S
            ribosomal protein L3 [imported] - Mycoplasma pulmonis
            (strain UAB CTIP)>gb:MPULM03_150102 Mycoplasma pulmonis
            (strain UAB CTIP) complete genome; segment 3/3.
          Length = 266

 Score = 44.3 bits (103), Expect = 0.006
 Identities = 39/154 (25%), Positives = 68/154 (44%)
 Frame = +1

Query: 709  AVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVAR 888
            ++F   E +D+ G++KGKG+ G + R    ++  K+H G       G   P R      +
Sbjct: 97   SIFTPGEFVDVTGISKGKGFAGTIKRHN-QKIGPKSHGG------GGGSKPVR------Q 143

Query: 889  AGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIK 1068
             G  G     ++ K +   G +G E  T        E  +T          VK++ LL+K
Sbjct: 144  TGSLGDISGNKVVKGMTMPGHLGHEQVT----IQNLEVIMTD---------VKNNILLVK 190

Query: 1069 GGCVGPKKRVVTLRQSLLNQTSRVALEEIKLKFI 1170
            G   GPKK  V +++      S+ A++ + L+ +
Sbjct: 191  GAVPGPKKGFVVIKECAKKIPSKEAVKLVDLEIV 224



>sp|Q8A476|RL3_BACTN 50S ribosomal protein L3.>gb:AE016937_362094
           Bacteroides thetaiotaomicron VPI-5482, section 12 of 21
           of the complete genome.>gb:AE015928_988582 Bacteroides
           thetaiotaomicron VPI-5482, complete genome.
          Length = 205

 Score = 44.3 bits (103), Expect = 0.006
 Identities = 28/82 (34%), Positives = 43/82 (52%), Gaps = 4/82 (4%)
 Frame = +1

Query: 712 VFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKT---HRGLRKVACIGAW-HPARVSFT 879
           +F     +D++G +KGKG++GVV R G   + + T   H   RK   IGA  +PA+V   
Sbjct: 99  MFNDATFVDVVGTSKGKGFQGVVKRHGFGGVGQATHGQHNRARKPGSIGACSYPAKVFKG 158

Query: 880 VARAGQNGYHHRTELNKKIYKL 945
           +   GQ G    T  N ++ K+
Sbjct: 159 MRMGGQLGGDRVTVQNLQVLKV 180



>gb:CP000023_875780 Streptococcus thermophilus LMG 18311, complete
            genome.>gb:CP000024_877695 Streptococcus thermophilus
            CNRZ1066, complete genome.
          Length = 208

 Score = 43.9 bits (102), Expect = 0.008
 Identities = 34/143 (23%), Positives = 65/143 (45%), Gaps = 1/143 (0%)
 Frame = +1

Query: 694  QVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP-RKTHRGLRKVACIGAWHPARV 870
            ++ +D +F+  +++D+ G +KGKG++GV+ R G +R P     R  R+   +G   P RV
Sbjct: 94   EITVD-IFEAGDVVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRV 152

Query: 871  SFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKD 1050
                  AG+ G +  T  N +I ++                               + + 
Sbjct: 153  FKNKHLAGRMGGNRVTIQNLEIVQV-------------------------------IPEK 181

Query: 1051 DYLLIKGGCVGPKKRVVTLRQSL 1119
            + +LIKG   G KK ++T++ ++
Sbjct: 182  NVILIKGNVPGAKKSLITIKSAV 204



>gb:CP000003_860018 Streptococcus pyogenes MGAS10394, complete genome.
          Length = 208

 Score = 43.9 bits (102), Expect = 0.008
 Identities = 32/136 (23%), Positives = 61/136 (44%), Gaps = 1/136 (0%)
 Frame = +1

Query: 715  FQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP-RKTHRGLRKVACIGAWHPARVSFTVARA 891
            F+  +++D+ G +KGKG++GV+ R G +R P     R  R+   +G   P RV      A
Sbjct: 100  FEAGDVVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKNKRLA 159

Query: 892  GQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKG 1071
            G+ G +  T  N +I ++                               +++ + +L+KG
Sbjct: 160  GRMGGNRVTVQNLEIVQV-------------------------------ILEKNVILVKG 188

Query: 1072 GCVGPKKRVVTLRQSL 1119
               G KK ++T++ ++
Sbjct: 189  NVPGAKKSLITIKSAV 204



>sp|P38515|RL3_THEMA 50S ribosomal protein L3.>pir|S40188|S40188
            ribosomal protein L3 - Thermotoga maritima (strain
            MSB8)>gb:AE001798_39395 Thermotoga maritima MSB8 section
            110 of 136 of the complete genome.>gb:TMRIBPRSA_197844
            Thermotoga maritima DNA for spc
            operon.>gb:AE000512_1113868 Thermotoga maritima MSB8,
            complete genome.
          Length = 207

 Score = 43.9 bits (102), Expect = 0.008
 Identities = 37/136 (27%), Positives = 63/136 (46%), Gaps = 1/136 (0%)
 Frame = +1

Query: 712  VFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARA 891
            VF+K E +D+ G TKG+G+ G + RWG +  P+               H ++    +   
Sbjct: 97   VFEKGEYVDVTGWTKGRGFAGAMKRWGFSGGPKS--------------HGSKFHRELGSV 142

Query: 892  GQNGYHHRTELNKKIYKLGKV-GQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIK 1068
            GQ+     TE   KI+K  K+ G+  +  +T  +    DI P          ++D L++K
Sbjct: 143  GQH-----TE-PAKIWKGKKMPGRYGNERVTVRNLQVVDIDP----------ENDLLVVK 186

Query: 1069 GGCVGPKKRVVTLRQS 1116
            GG  G +  +V +R +
Sbjct: 187  GGVPGARGGLVLIRSA 202



>sp|Q9A1X4|RL3_STRPY 50S ribosomal protein L3.>gb:AE006477_219307
            Streptococcus pyogenes M1 GAS, section 6 of 167 of the
            complete genome.>gb:AE004092_1105153 Streptococcus
            pyogenes M1 GAS, complete genome.
          Length = 208

 Score = 43.9 bits (102), Expect = 0.008
 Identities = 32/136 (23%), Positives = 61/136 (44%), Gaps = 1/136 (0%)
 Frame = +1

Query: 715  FQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP-RKTHRGLRKVACIGAWHPARVSFTVARA 891
            F+  +++D+ G++KGKG++GV+ R G +R P     R  R+   +G   P RV      A
Sbjct: 100  FEAGDVVDVTGISKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKNKRLA 159

Query: 892  GQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKG 1071
            G+ G +  T  N +I ++                               + + + +L+KG
Sbjct: 160  GRMGGNRVTVQNLEIVQV-------------------------------IPEKNVILVKG 188

Query: 1072 GCVGPKKRVVTLRQSL 1119
               G KK ++T++ ++
Sbjct: 189  NVPGAKKSLITIKSAV 204



>sp|Q8G417|RL3_BIFLO 50S ribosomal protein L3.>gb:AE014295_312239
            Bifidobacterium longum NCC2705, complete genome.
          Length = 213

 Score = 43.9 bits (102), Expect = 0.008
 Identities = 34/139 (24%), Positives = 56/139 (40%), Gaps = 3/139 (2%)
 Frame = +1

Query: 712  VFQKDEMIDIIGVTKGKGYEGVVTRWGVT--RLPRKTHRGLRKVACIGAW-HPARVSFTV 882
            +F++   +D+ G TKGKG+ G + RWG    R    +H+  R+   +GA   P+R+    
Sbjct: 103  LFEEGAEVDVTGTTKGKGFAGTIKRWGFKSYRRTHGSHKNERRPGSVGACATPSRILKGK 162

Query: 883  ARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLL 1062
              AG+ G+   T  N  +                                   V++  L 
Sbjct: 163  RMAGRMGHVTATTQNLTVVSAD-------------------------------VENGILA 191

Query: 1063 IKGGCVGPKKRVVTLRQSL 1119
            IKG   GPK  +V +R ++
Sbjct: 192  IKGAIPGPKGGIVLVRSAV 210



>gb:AE017333_446069 Bacillus licheniformis DSM 13, complete
            genome.>gb:CP000002_855891 Bacillus licheniformis ATCC
            14580, complete genome.
          Length = 209

 Score = 43.5 bits (101), Expect = 0.010
 Identities = 42/176 (23%), Positives = 72/176 (40%), Gaps = 4/176 (2%)
 Frame = +1

Query: 604  KQKKAHVMEIQVNGGTIAQK---VDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEG 774
            K +K HV + +       ++   VD       ++V +D +F   E++D+ G +KGKG++G
Sbjct: 63   KPEKGHVAKAETAPKRFVKELRGVDMDAYEVGQEVKVD-IFSNGEIVDVTGTSKGKGFQG 121

Query: 775  VVTRWGVTRLPRK-THRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLGK 951
             + R G +R P     R  R+   +G   P RV       G+ G    T  N +I K+  
Sbjct: 122  AIKRHGQSRGPMSHGSRYHRRPGSMGPVDPNRVFKGKLLPGRMGGEQITVQNLEIVKVD- 180

Query: 952  VGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSL 1119
                                           + + LL+KG   G KK +VT++ ++
Sbjct: 181  ------------------------------AERNLLLVKGNVPGAKKSLVTVKSAV 206



>sp|Q83I78|RL3_TROW8 50S ribosomal protein L3.>sp|Q83FY6|RL3_TROWT
           50S ribosomal protein L3.>gb:AE016852_349078 Tropheryma
           whipplei str. Twist, section 3 of 3 of the complete
           genome.>gb:BX251410_764411 Tropheryma whipplei TW08/27,
           complete genome; segment 1/3.>gb:AE014184_1029274
           Tropheryma whipplei str. Twist, complete genome.
          Length = 210

 Score = 43.5 bits (101), Expect = 0.010
 Identities = 30/94 (31%), Positives = 46/94 (48%), Gaps = 3/94 (3%)
 Frame = +1

Query: 712 VFQKDEMIDIIGVTKGKGYEGVVTRWGV--TRLPRKTHRGLRKVACIGAWH-PARVSFTV 882
           +FQ+ +++D++G +KGKG+ G + R           +HR  RK   +GA   P+RV    
Sbjct: 96  IFQEGQLVDVVGKSKGKGFSGTMKRHNFQGVSATHGSHRNHRKPGSVGASSTPSRVFKGT 155

Query: 883 ARAGQNGYHHRTELNKKIYKLGKVGQENHTALTE 984
             AG+ G    T  N    +L K+  EN   L E
Sbjct: 156 RMAGRLGSSRVTVHN---LRLVKIDSENGLLLVE 186



>sp|Q81J42|RL3_BACCR 50S ribosomal protein L3.>gb:AE016998_375168
            Bacillus cereus ATCC 14579 section 1 of 18 of the
            complete genome.>gb:AE016877_1015418 Bacillus cereus ATCC
            14579 complete genome.
          Length = 210

 Score = 43.5 bits (101), Expect = 0.010
 Identities = 39/141 (27%), Positives = 64/141 (45%), Gaps = 1/141 (0%)
 Frame = +1

Query: 691  KQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRK-THRGLRKVACIGAWHPAR 867
            ++V +D VF   E++D+ G++KGKG++GV+ R G +R P     R  R+   +G   P R
Sbjct: 95   QEVKVD-VFATGEIVDVTGISKGKGFQGVIKRHGQSRGPMSHGSRYHRRPGSMGPVAPNR 153

Query: 868  VSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVK 1047
            V      AG+ G    T  N +I ++                TE+++             
Sbjct: 154  VFKGKKLAGRMGGDQVTIQNLEIVQVD---------------TERNL------------- 185

Query: 1048 DDYLLIKGGCVGPKKRVVTLR 1110
               LL+KG   G KK +V ++
Sbjct: 186  ---LLVKGNVPGAKKSLVVVQ 203



>sp|Q81VT0|RL3_BACAN 50S ribosomal protein L3.>gb:AE017024_380406
            Bacillus anthracis str. Ames section 1 of 18 of the
            complete genome.>gb:AE017225_405523 Bacillus anthracis
            str. Sterne, complete genome.>gb:AE017264_421345 Bacillus
            cereus ATCC 10987, section 1 of 18 of the complete
            genome.>gb:AE017334_450255 Bacillus anthracis str. 'Ames
            Ancestor', complete genome.>gb:AE017355_461438 Bacillus
            thuringiensis serovar konkukian str. 97-27, complete
            genome.>gb:CP000001_850741 Bacillus cereus ZK, complete
            genome.>gb:AE016879_1010111 Bacillus anthracis str. Ames
            complete genome.>gb:AE017194_1059764 Bacillus cereus ATCC
            10987, complete genome.
          Length = 210

 Score = 43.5 bits (101), Expect = 0.010
 Identities = 39/141 (27%), Positives = 64/141 (45%), Gaps = 1/141 (0%)
 Frame = +1

Query: 691  KQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRK-THRGLRKVACIGAWHPAR 867
            ++V +D VF   E++D+ G++KGKG++GV+ R G +R P     R  R+   +G   P R
Sbjct: 95   QEVKVD-VFATGEIVDVTGISKGKGFQGVIKRHGQSRGPMSHGSRYHRRPGSMGPVAPNR 153

Query: 868  VSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVK 1047
            V      AG+ G    T  N +I ++                TE+++             
Sbjct: 154  VFKGKKLAGRMGGDQVTIQNLEIVQVD---------------TERNL------------- 185

Query: 1048 DDYLLIKGGCVGPKKRVVTLR 1110
               LL+KG   G KK +V ++
Sbjct: 186  ---LLVKGNVPGAKKSLVVVQ 203



>sp|Q9ZI50|RL3_AQUPY 50S ribosomal protein L3.>gb:AF040100_472182
           Aquifex pyrophilus ribosomal proteins S10 (rpS10), L3
           (rpL3), L4 (rpL4), L23 (rpL23), L2 (rpl2), S19 (rps19),
           L22 (rpl22), and S3 (rps3) genes, complete cds; and
           ribosomal protein L16 (rpl16) gene, partial cds.
          Length = 244

 Score = 43.5 bits (101), Expect = 0.010
 Identities = 19/54 (35%), Positives = 33/54 (61%), Gaps = 1/54 (1%)
 Frame = +1

Query: 691 KQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRK-THRGLRKVACIG 849
           +++ +  VF+  +++D+ G++KG+G+ GV+ RW     PR   HR  R V  IG
Sbjct: 96  QELRVQDVFKPGDLVDVWGISKGRGFAGVMKRWDFAGFPRSHGHRYHRAVGAIG 149



>gb:BACRPL1_746196 Bacillus subtilis genes for ribosomal proteins L13,
            L4, L23, L2, S19, L22, S3 and L16, partial and complete
            cds.
          Length = 162

 Score = 43.1 bits (100), Expect = 0.014
 Identities = 35/137 (25%), Positives = 57/137 (41%), Gaps = 1/137 (0%)
 Frame = +1

Query: 712  VFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRK-THRGLRKVACIGAWHPARVSFTVAR 888
            +F   E++D+ GV+KGKG++G + R G +R P     R  R+   +G   P RV      
Sbjct: 54   IFSAGEIVDVTGVSKGKGFQGAIKRHGQSRGPMSHGSRYHRRPGSMGPVDPNRVFKGKLL 113

Query: 889  AGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIK 1068
             G+ G    T  N +I K+                                 + + LLIK
Sbjct: 114  PGRMGGEQITVQNLEIVKVD-------------------------------AERNLLLIK 142

Query: 1069 GGCVGPKKRVVTLRQSL 1119
            G   G KK ++T++ ++
Sbjct: 143  GNVPGAKKSLITVKSAV 159



>sp|P60457|RL3_SPIKU 50S ribosomal protein L3.>gb:AY198133_596863
            Spiroplasma kunkelii strain CR2-3x partial genome
            sequence.
          Length = 258

 Score = 43.1 bits (100), Expect = 0.014
 Identities = 38/150 (25%), Positives = 59/150 (39%), Gaps = 1/150 (0%)
 Frame = +1

Query: 712  VFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGL-RKVACIGAWHPARVSFTVAR 888
            +F   E +D+ G +KGKG+ G + R   +R P     G  R V  +GA  P R+  +   
Sbjct: 98   IFTAGEFVDVTGTSKGKGFTGSIKRHNYSRGPMGHGSGYHRGVGSMGAIAPNRILKSKKM 157

Query: 889  AGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIK 1068
             G  G    T  N +I  +                TEK+                 LL+K
Sbjct: 158  PGHIGTEKVTIQNLEIIAID---------------TEKNA----------------LLVK 186

Query: 1069 GGCVGPKKRVVTLRQSLLNQTSRVALEEIK 1158
            G   GPKK+ V +++++         E +K
Sbjct: 187  GSIPGPKKQFVVIKEAIKGLKPNTPTELLK 216



>sp|P42920|RL3_BACSU 50S ribosomal protein L3 (BL3).>pir|G69694|G69694
            ribosomal protein L3 (BL3) rplC - Bacillus
            subtilis>gb:BSU43929_751666 Bacillus subtilis ribosomal
            protein gene cluster, rpsJ, rplC, rplD, rplW, rplB, rpsS,
            rplV and rpsC genes, complete cds, and rplP gene, partial
            cds.>gb:BSUB0001_752081 Bacillus subtilis complete genome
            (section 1 of 21): from 1 to 213080.
          Length = 209

 Score = 43.1 bits (100), Expect = 0.014
 Identities = 35/137 (25%), Positives = 57/137 (41%), Gaps = 1/137 (0%)
 Frame = +1

Query: 712  VFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRK-THRGLRKVACIGAWHPARVSFTVAR 888
            +F   E++D+ GV+KGKG++G + R G +R P     R  R+   +G   P RV      
Sbjct: 101  IFSAGEIVDVTGVSKGKGFQGAIKRHGQSRGPMSHGSRYHRRPGSMGPVDPNRVFKGKLL 160

Query: 889  AGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIK 1068
             G+ G    T  N +I K+                                 + + LLIK
Sbjct: 161  PGRMGGEQITVQNLEIVKVD-------------------------------AERNLLLIK 189

Query: 1069 GGCVGPKKRVVTLRQSL 1119
            G   G KK ++T++ ++
Sbjct: 190  GNVPGAKKSLITVKSAV 206



>sp|P60451|RL3_STRP3 50S ribosomal protein L3.>sp|P60452|RL3_STRP8 50S
            ribosomal protein L3.>gb:AE009958_257762 Streptococcus
            pyogenes strain MGAS8232, section 6 of 173 of the
            complete genome.>gb:AE014137_303517 Streptococcus
            pyogenes MGAS315, section 2 of 37 of the complete
            genome.>gb:BA000034_712966 Streptococcus pyogenes SSI-1
            DNA, complete genome.>gb:AE009949_904144 Streptococcus
            pyogenes strain MGAS8232, complete
            genome.>gb:AE014074_926696 Streptococcus pyogenes
            MGAS315, complete genome.
          Length = 208

 Score = 42.7 bits (99), Expect = 0.018
 Identities = 32/136 (23%), Positives = 60/136 (44%), Gaps = 1/136 (0%)
 Frame = +1

Query: 715  FQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP-RKTHRGLRKVACIGAWHPARVSFTVARA 891
            F+  +++D+ G +KGKG++GV+ R G +R P     R  R+   +G   P RV      A
Sbjct: 100  FEAGDVVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKNKRLA 159

Query: 892  GQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKG 1071
            G+ G +  T  N +I ++                               + + + +L+KG
Sbjct: 160  GRMGGNRVTVQNLEIVQV-------------------------------IPEKNVILVKG 188

Query: 1072 GCVGPKKRVVTLRQSL 1119
               G KK ++T++ ++
Sbjct: 189  NVPGAKKSLITIKSAV 204



>sp|Q8E7T8|RL3_STRA3 50S ribosomal protein L3.>sp|Q8E2D1|RL3_STRA5 50S
            ribosomal protein L3.>gb:SAG766843_169586 Streptococcus
            agalactiae NEM316 complete genome, segment
            1.>gb:AE014194_305400 Streptococcus agalactiae 2603V/R
            section 4 of 100 of the complete
            genome.>gb:AE009948_935513 Streptococcus agalactiae
            2603V/R complete genome.
          Length = 208

 Score = 42.7 bits (99), Expect = 0.018
 Identities = 33/136 (24%), Positives = 60/136 (44%), Gaps = 1/136 (0%)
 Frame = +1

Query: 715  FQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP-RKTHRGLRKVACIGAWHPARVSFTVARA 891
            F+  +++D+ G +KGKG++GV+ R G +R P     R  R+   +G   P RV      A
Sbjct: 100  FEAGDVVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKNKRLA 159

Query: 892  GQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKG 1071
            G+ G +  T  N +I ++                               + + + +LIKG
Sbjct: 160  GRMGGNRVTVQNLEIVQV-------------------------------IPEKNVVLIKG 188

Query: 1072 GCVGPKKRVVTLRQSL 1119
               G KK ++T++ ++
Sbjct: 189  NVPGAKKSLITIKSAV 204



>sp|Q8Y440|RL3_LISMO 50S ribosomal protein L3.>pir|AH1403|AH1403
            ribosomal protein L3 [imported] - Listeria monocytogenes 
            (strain EGD-e)>gb:AE017331_445021 Listeria monocytogenes
            str. 4b F2365, section 10 of 10 of the complete
            genome.>gb:AL591983_537123 Listeria monocytogenes strain
            EGD, complete genome segment 11/12.>gb:AE017262_1077377
            Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 209

 Score = 42.7 bits (99), Expect = 0.018
 Identities = 39/140 (27%), Positives = 60/140 (42%), Gaps = 1/140 (0%)
 Frame = +1

Query: 694  QVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP-RKTHRGLRKVACIGAWHPARV 870
            +V +D VF + ++ID  GV+KGKG++GV+ R G +R P     R  R+   +G   P RV
Sbjct: 96   EVKVD-VFAEGDIIDATGVSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRV 154

Query: 871  SFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKD 1050
                   G+ G    T  N +I K+                                V+ 
Sbjct: 155  FKNKLLPGRMGGEQITIQNLEIVKVD-------------------------------VEK 183

Query: 1051 DYLLIKGGCVGPKKRVVTLR 1110
            + LL+KG   G KK +V ++
Sbjct: 184  NVLLVKGNVPGAKKALVQIK 203



>sp|Q927K7|RL3_LISIN 50S ribosomal protein L3.>pir|AG1779|AG1779
            ribosomal protein L3 [imported] - Listeria innocua
            (strain Clip11262)>gb:AL596173_540121 Listeria innocua
            Clip11262 complete genome, segment 11/12.
          Length = 209

 Score = 42.7 bits (99), Expect = 0.018
 Identities = 39/140 (27%), Positives = 60/140 (42%), Gaps = 1/140 (0%)
 Frame = +1

Query: 694  QVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP-RKTHRGLRKVACIGAWHPARV 870
            +V +D VF + ++ID  GV+KGKG++GV+ R G +R P     R  R+   +G   P RV
Sbjct: 96   EVKVD-VFAEGDIIDATGVSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRV 154

Query: 871  SFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKD 1050
                   G+ G    T  N +I K+                                V+ 
Sbjct: 155  FKNKLLPGRMGGEQITIQNLEIVKVD-------------------------------VEK 183

Query: 1051 DYLLIKGGCVGPKKRVVTLR 1110
            + LL+KG   G KK +V ++
Sbjct: 184  NVLLVKGNVPGAKKALVQIK 203



>gb:PFA929357_1393402 Plasmodium falciparum strain 3D7, chromosome
           9; segment 3/5.
          Length = 252

 Score = 42.4 bits (98), Expect = 0.023
 Identities = 28/75 (37%), Positives = 41/75 (54%), Gaps = 4/75 (5%)
 Frame = +1

Query: 733 IDIIGVTKGKGYEGVVTRWGVTRLPR---KTHRGLRKVACIGA-WHPARVSFTVARAGQN 900
           +++ G++KGKG+ GV+ RWG  R P     +H   RK   IGA  H  RV       G++
Sbjct: 131 VNVRGLSKGKGFCGVIKRWGFKRGPMSHGSSHH--RKPGSIGASTHIGRVLKGKKMPGKH 188

Query: 901 GYHHRTELNKKIYKL 945
           G  +RT +N K+  L
Sbjct: 189 GNKYRTMINLKLLGL 203



>sp|Q8KAH2|RL3_CHLTE 50S ribosomal protein L3.>gb:AE012965_287647
           Chlorobium tepidum TLS section 186 of 194 of the
           complete genome.>gb:AE006470_934815 Chlorobium tepidum
           TLS complete genome.
          Length = 209

 Score = 42.4 bits (98), Expect = 0.023
 Identities = 29/86 (33%), Positives = 48/86 (55%), Gaps = 3/86 (3%)
 Frame = +1

Query: 697 VPIDAVFQKDEMIDIIGVTKGKGYEGVVTR---WGVTRLPRKTHRGLRKVACIGAWHPAR 867
           VP+D VF++ + ++++GVTKGKG+ GVV R    G +R   ++ R     +  G+  P+R
Sbjct: 97  VPVD-VFKEGDKVNVLGVTKGKGFAGVVKRHNFGGGSRTHGQSDRLRAPGSVGGSSDPSR 155

Query: 868 VSFTVARAGQNGYHHRTELNKKIYKL 945
                  AG+ G  ++T  N  I K+
Sbjct: 156 TFKGTRMAGRMGGKNKTVQNLVIVKV 181



>sp|P60454|RL3_GEOSL 50S ribosomal protein L3.>gb:AE017180_401147
            Geobacter sulfurreducens PCA, complete genome.
          Length = 210

 Score = 42.0 bits (97), Expect = 0.031
 Identities = 39/135 (28%), Positives = 58/135 (42%)
 Frame = +1

Query: 715  FQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAG 894
            F+  E ID+ G + GKG++GV+ RWG  R  R +H           +H A  S      G
Sbjct: 102  FEVGEYIDVTGTSIGKGFQGVIKRWGF-RGGRSSHG--------SCFHRAPGSI-----G 147

Query: 895  QNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGG 1074
             + Y  R   NKK+   G++G E  T +        D              D+ LLIKG 
Sbjct: 148  SSAYPSRVFKNKKM--PGQLGNERVT-VQRLQVVRVD------------AADNILLIKGA 192

Query: 1075 CVGPKKRVVTLRQSL 1119
              G K  +V ++ ++
Sbjct: 193  IPGAKNGIVLVKDTV 207



>sp|P10134|RL3_MYCCA 50S ribosomal protein L3.>pir|S02831|R5YM3C
            ribosomal protein L3 - Mycoplasma
            capricolum>gb:MCRPCLUS_143174 Mycoplasma capricolum
            ribosomal protein gene cluster.
          Length = 223

 Score = 41.2 bits (95), Expect = 0.052
 Identities = 41/187 (21%), Positives = 73/187 (39%), Gaps = 5/187 (2%)
 Frame = +1

Query: 604  KQKKAHVMEIQVNGGTIAQKVDFAYGFFEKQV-PIDAVFQKDEMIDIIGVTKGKGYEGVV 780
            K +  H  +   N     +++    G+   QV  +  +F   E +D+ G++KGKG+ G +
Sbjct: 62   KPELGHFKKANSNPKRFVKEIRNMQGYEIGQVINVSDIFVSGEYVDVTGISKGKGFAGGI 121

Query: 781  TRWGVTRLPRK----THRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG 948
             R   +R P       HRG+  +  I      R+  +    G  G   RT  N +I  + 
Sbjct: 122  KRHNYSRGPMAHGSGYHRGIGSMGAI----INRIFKSKKMPGHMGNAKRTIQNLEIIAID 177

Query: 949  KVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQ 1128
            +                                ++ +LIKG   GPK   V ++Q++   
Sbjct: 178  Q-------------------------------SNNIMLIKGPIPGPKNSFVQIKQNVKGM 206

Query: 1129 TSRVALE 1149
            +S+ A+E
Sbjct: 207  SSKQAVE 213



>gb:SPAC644_1718187 S.pombe chromosome I cosmid c644.
          Length = 259

 Score = 40.8 bits (94), Expect = 0.068
 Identities = 46/178 (25%), Positives = 73/178 (41%), Gaps = 4/178 (2%)
 Frame = +1

Query: 613  KAHVMEIQVN--GGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTR 786
            K HV E +V    G ++    F   +F+ +          + +D+ G+TKGKG+ GV+ R
Sbjct: 119  KMHVREFRVRDASGLVSPGTIFTTDYFKPK----------QYVDVKGITKGKGFAGVMKR 168

Query: 787  WGVTRLPRKTHRGLRKVACIGAWHPARVSF-TVARAGQNGYHHRTELNKKIYKLGKVGQE 963
            WG +                 A H A +S  T    GQN    R    +K+   G +G  
Sbjct: 169  WGFSG--------------GNASHGASLSHRTPGSTGQNTTPSRVLPGRKM--AGHMGHR 212

Query: 964  NHTALTEFDRTEKDITPMGGFPHYGVVKD-DYLLIKGGCVGPKKRVVTLRQSLLNQTS 1134
            +        RT K++        + V  D + +L+KG   GP K  V +  ++   TS
Sbjct: 213  S--------RTVKNLLV------WAVDADLECILVKGSIPGPNKSAVYVTDTINRSTS 256



>gb:AP006840_570261 Symbiobacterium thermophilum DNA, complete genome.
          Length = 216

 Score = 40.8 bits (94), Expect = 0.068
 Identities = 36/140 (25%), Positives = 58/140 (41%), Gaps = 4/140 (2%)
 Frame = +1

Query: 712  VFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP----RKTHRGLRKVACIGAWHPARVSFT 879
            +F + E++D+ G+++GKG+ G V RW   R P     K H   R+   +G    ARV   
Sbjct: 101  IFAEGELVDVTGISRGKGFAGGVKRWNFNRGPSSHGSKYH---RRPGSLGQRRWARVPKG 157

Query: 880  VARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYL 1059
                G+ G    T L  ++ K+                 EK++                +
Sbjct: 158  RKLPGRLGGERVTVLGLRVVKVD---------------PEKNL----------------I 186

Query: 1060 LIKGGCVGPKKRVVTLRQSL 1119
            LIKG   G K  ++T+R S+
Sbjct: 187  LIKGAVPGAKGSLITIRDSV 206



>sp|Q8R7V4|RL3_THETN 50S ribosomal protein L3.>gb:AE013171_289860
            Thermoanaerobacter tengcongensis MB4, section 198 of 244
            of the complete genome.>gb:AE008691_1111925
            Thermoanaerobacter tengcongensis strain MB4, complete
            genome.
          Length = 210

 Score = 40.8 bits (94), Expect = 0.068
 Identities = 36/146 (24%), Positives = 62/146 (42%), Gaps = 4/146 (2%)
 Frame = +1

Query: 694  QVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVS 873
            ++ +D +F+  + +D+ G++KGKG+ GV+ R+G  R P                H ++  
Sbjct: 96   EIKVD-IFKPGDRVDVTGISKGKGFAGVIKRYGARRGPMS--------------HGSKYH 140

Query: 874  FTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDD 1053
              V   G      RT   KK+   G++G +  T                   +  VVK D
Sbjct: 141  RRVGSMGATTDPGRTFKGKKMP--GRMGSDRVT-----------------IQNLEVVKVD 181

Query: 1054 ----YLLIKGGCVGPKKRVVTLRQSL 1119
                 L++KG   GPK  ++ +R S+
Sbjct: 182  PELNLLVVKGSVPGPKGSLLIIRDSV 207



>sp|Q9Z9L4|RL3_BACHD 50S ribosomal protein L3.>pir|T44383|T44383
            ribosomal protein L3 (BL3) rplC [imported] - Bacillus
            halodurans (strain C-125)>gb:AB017508_3248 Bacillus
            halodurans C-125 genomic DNA, 32 kb fragment, complete
            cds.>gb:BA000004_654080 Bacillus halodurans C-125 DNA,
            complete genome.
          Length = 209

 Score = 40.8 bits (94), Expect = 0.068
 Identities = 36/144 (25%), Positives = 59/144 (40%), Gaps = 1/144 (0%)
 Frame = +1

Query: 691  KQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRK-THRGLRKVACIGAWHPAR 867
            +++ +DA F + +++D+ G +KGKG+ G + R    R P     R  R+   +G   P R
Sbjct: 95   QEIKVDA-FAEGDIVDVTGTSKGKGFAGAIKRHNQARGPMSHGSRYHRRPGSMGPVDPNR 153

Query: 868  VSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVK 1047
            V    A  G+ G    T  N +I K+                                 +
Sbjct: 154  VFKGKALPGRMGGEQVTVQNLEIIKVD-------------------------------AE 182

Query: 1048 DDYLLIKGGCVGPKKRVVTLRQSL 1119
             + LL+KG   G KK  VT+R ++
Sbjct: 183  RNLLLVKGNVPGAKKSYVTVRSAI 206



>gb:BC055650_2551510 Danio rerio zgc:66423, mRNA (cDNA clone
           MGC:66423 IMAGE:6034148), complete cds.
          Length = 319

 Score = 40.4 bits (93), Expect = 0.089
 Identities = 27/84 (32%), Positives = 40/84 (47%), Gaps = 5/84 (5%)
 Frame = +1

Query: 709 AVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP-----RKTHRGLRKVACIGAWHPARVS 873
           A F+  + +D+   T GKG++GV+ RWG    P      KTHR  R  A      PA+V 
Sbjct: 170 AHFRPGQYVDVTAKTIGKGFQGVMKRWGFKGQPASHGQTKTHR--RPGALGPGGDPAKVF 227

Query: 874 FTVARAGQNGYHHRTELNKKIYKL 945
                 G+ G  + T    KI+++
Sbjct: 228 KGTKMPGRMGNVYNTNFGLKIWRV 251



>sp|P18665|RM03_RAT Mitochondrial 60S ribosomal protein L3
           (L3mt).>pir|S05472|R5RTL3 ribosomal protein L3
           precursor, mitochondrial [similarity] - rat
          Length = 347

 Score = 40.4 bits (93), Expect = 0.089
 Identities = 30/101 (29%), Positives = 44/101 (43%), Gaps = 15/101 (14%)
 Frame = +1

Query: 709 AVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP-----RKTHRGLRKVACIGAWHPARVS 873
           A F+  + +D+   T GKG++GV+ RWG    P      KTH   R+   I     ARV 
Sbjct: 196 AHFRPGQYVDVTAKTIGKGFQGVMKRWGFKGQPASHGQTKTH---RRPGAISTGDIARVW 252

Query: 874 FTVARAGQNGYHHRTELNKKIYKL----------GKVGQEN 966
                 G+ G  +RT    K++++          G VG  N
Sbjct: 253 PGTKMPGKMGNQNRTVYGLKVWRVNTKHNIIYVNGSVGHRN 293



>sp|P09001|RM03_HUMAN Mitochondrial 60S ribosomal protein L3
           (L3mt).>pir|A27294|R5HUL3 ribosomal protein L3
           precursor, mitochondrial - human>gb:BC003375_1968788
           Homo sapiens mitochondrial ribosomal protein L3, mRNA
           (cDNA clone MGC:5219 IMAGE:2901120), complete
           cds.>gb:CR456720_1992927 Homo sapiens full open reading
           frame cDNA clone RZPDo834H053D for gene MRPL3,
           mitochondrial ribosomal protein L3; complete cds, incl.
           stopcodon.>gb:HSMRL3R_2018893 Human MRL3 mRNA for
           ribosomal protein L3 homologue ( MRL3 = mammalian
           ribosome L3 ).
          Length = 348

 Score = 40.4 bits (93), Expect = 0.089
 Identities = 25/84 (29%), Positives = 40/84 (47%), Gaps = 5/84 (5%)
 Frame = +1

Query: 709 AVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP-----RKTHRGLRKVACIGAWHPARVS 873
           A F+  + +D+   T GKG++GV+ RWG    P      KTH   R+   +      RV 
Sbjct: 196 AHFRPGQYVDVTAKTIGKGFQGVMKRWGFKGQPATHGQTKTH---RRPGAVATGDIGRVW 252

Query: 874 FTVARAGQNGYHHRTELNKKIYKL 945
                 G+ G  +RTE   K++++
Sbjct: 253 PGTKMPGKMGNIYRTEYGLKVWRI 276



>gb:BC011128_2091256 Mus musculus mitochondrial ribosomal protein
           L3, mRNA (cDNA clone MGC:18779 IMAGE:4187019), complete
           cds.
          Length = 348

 Score = 40.0 bits (92), Expect = 0.12
 Identities = 26/84 (30%), Positives = 40/84 (47%), Gaps = 5/84 (5%)
 Frame = +1

Query: 709 AVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP-----RKTHRGLRKVACIGAWHPARVS 873
           A F+  + +D+   T GKG++GV+ RWG    P      KTH   R+   I     ARV 
Sbjct: 196 AHFRPGQYVDVTAKTIGKGFQGVMKRWGFKGQPASHGQTKTH---RRPGAISTGDIARVW 252

Query: 874 FTVARAGQNGYHHRTELNKKIYKL 945
                 G+ G  +RT    K++++
Sbjct: 253 PGTKMPGRMGNQNRTVYGLKVWRV 276



>gb:AE017263_420675 Mesoplasma florum L1 complete genome.
          Length = 238

 Score = 40.0 bits (92), Expect = 0.12
 Identities = 32/150 (21%), Positives = 60/150 (40%), Gaps = 4/150 (2%)
 Frame = +1

Query: 712  VFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRK----THRGLRKVACIGAWHPARVSFT 879
            +F+  + +D+ G++KGKG+ G + R   +R P       HRG+  +  I      R+  +
Sbjct: 99   IFETGQYVDVTGISKGKGFAGAIKRHNYSRGPMAHGSGYHRGIGSMGAI----INRIFKS 154

Query: 880  VARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYL 1059
               AG  G+  RT  N ++                                   + ++ +
Sbjct: 155  KKMAGHMGHVKRTVQNLEVI---------------------------------AIDNNIM 181

Query: 1060 LIKGGCVGPKKRVVTLRQSLLNQTSRVALE 1149
            L+KG   GP K  VT++ ++   ++  A E
Sbjct: 182  LVKGSIPGPNKGFVTIKANVKGLSNTQAAE 211



>sp|Q99N95|RM03_MOUSE Mitochondrial 60S ribosomal protein L3
           (L3mt).>gb:AK077857_1172087 Mus musculus 13 days embryo
           forelimb cDNA, RIKEN full-length enriched library,
           clone:5930422H18 product:mitochondrial ribosomal protein
           L3, full insert sequence.>gb:AB049633_2046184 Mus
           musculus MRPL3 mRNA for mitochondrial ribosomal protein
           L3 (L3mt), complete cds.>gb:BC034877_2097780 Mus
           musculus mitochondrial ribosomal protein L3, mRNA (cDNA
           clone MGC:41297 IMAGE:1547459), complete cds.
          Length = 348

 Score = 40.0 bits (92), Expect = 0.12
 Identities = 26/84 (30%), Positives = 40/84 (47%), Gaps = 5/84 (5%)
 Frame = +1

Query: 709 AVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP-----RKTHRGLRKVACIGAWHPARVS 873
           A F+  + +D+   T GKG++GV+ RWG    P      KTH   R+   I     ARV 
Sbjct: 196 AHFRPGQYVDVTAKTIGKGFQGVMKRWGFKGQPASHGQTKTH---RRPGAISTGDIARVW 252

Query: 874 FTVARAGQNGYHHRTELNKKIYKL 945
                 G+ G  +RT    K++++
Sbjct: 253 PGTKMPGRMGNQNRTVYGLKVWRV 276



>gb:AJ719688_2501875 Gallus gallus mRNA for hypothetical protein,
           clone 5e20.
          Length = 348

 Score = 39.7 bits (91), Expect = 0.15
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 5/84 (5%)
 Frame = +1

Query: 709 AVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP-----RKTHRGLRKVACIGAWHPARVS 873
           A F+  +++D+   T GKG++GV+ RWG    P      KTH   R+   I     +RV 
Sbjct: 197 AHFRPGQIVDVTAKTIGKGFQGVMKRWGFKGQPASHGQTKTH---RRPGAISTNKVSRVF 253

Query: 874 FTVARAGQNGYHHRTELNKKIYKL 945
                 G+ G  +RT    K++++
Sbjct: 254 PGKKMPGKMGNIYRTSFGLKVWRI 277



>sp|Q97SV5|RL3_STRPN 50S ribosomal protein L3.>sp|Q8CWV8|RL3_STRR6 50S
            ribosomal protein L3.>pir|D97895|D97895 50S ribosomal
            protein L3 [imported] - Streptococcus pneumoniae (strain
            R6)>pir|D95024|D95024 ribosomal protein L3 [imported] -
            Streptococcus pneumoniae  (strain
            TIGR4)>gb:AE007335_225450 Streptococcus pneumoniae TIGR4
            section 18 of 194 of the complete
            genome.>gb:AE008401_236509 Streptococcus pneumoniae R6
            section 17 of 184 of the complete
            genome.>gb:AE007317_942667 Streptococcus pneumoniae R6,
            complete genome.>gb:AE005672_1103218 Streptococcus
            pneumoniae TIGR4, complete genome.
          Length = 208

 Score = 39.7 bits (91), Expect = 0.15
 Identities = 33/136 (24%), Positives = 58/136 (42%), Gaps = 1/136 (0%)
 Frame = +1

Query: 715  FQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP-RKTHRGLRKVACIGAWHPARVSFTVARA 891
            F   +++D+ G +KGKG++GV+ R G +R P     R  R+   +G   P RV      A
Sbjct: 100  FAAGDVVDVTGTSKGKGFQGVIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKGKNLA 159

Query: 892  GQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKG 1071
            G+ G    T  N ++ ++                               V + + +LIKG
Sbjct: 160  GRMGGDRVTIQNLEVVQV-------------------------------VPEKNVILIKG 188

Query: 1072 GCVGPKKRVVTLRQSL 1119
               G KK ++T++ ++
Sbjct: 189  NVPGAKKSLITIKSAV 204



>sp|Q8DS16|RL3_STRMU 50S ribosomal protein L3.>gb:AE015024_314301
            Streptococcus mutans UA159 section 172 of 185 of the
            complete genome.>gb:AE014133_941302 Streptococcus mutans
            UA159 complete genome.
          Length = 208

 Score = 39.7 bits (91), Expect = 0.15
 Identities = 32/136 (23%), Positives = 58/136 (42%), Gaps = 1/136 (0%)
 Frame = +1

Query: 715  FQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP-RKTHRGLRKVACIGAWHPARVSFTVARA 891
            F+  +++D+ G TKGKG++G + R G +R P     R  R+   +G   P RV      A
Sbjct: 100  FEAGDVVDVTGTTKGKGFQGAIKRHGQSRGPMAHGSRYHRRPGSMGPVAPNRVFKGKNLA 159

Query: 892  GQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKG 1071
            G+ G +  T  N ++ ++                               V + + +LIKG
Sbjct: 160  GRMGGNRVTVQNLEVVQV-------------------------------VPEKNVILIKG 188

Query: 1072 GCVGPKKRVVTLRQSL 1119
               G KK ++ ++ ++
Sbjct: 189  NVPGAKKSLIIIKSAV 204



>gb:AE017332_445447 Mycoplasma hyopneumoniae 232, complete genome.
          Length = 230

 Score = 39.3 bits (90), Expect = 0.20
 Identities = 32/138 (23%), Positives = 59/138 (42%), Gaps = 1/138 (0%)
 Frame = +1

Query: 709  AVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVAR 888
            ++F   E +D+ G +KGKG+ G + R+     PR    G       G   P R      +
Sbjct: 97   SIFSPGEFVDVTGTSKGKGFAGTIKRYNQAIGPRSHGGG-------GGSKPIR------Q 143

Query: 889  AGQNGYHHRTELNKKIYKLGKVGQENHTALT-EFDRTEKDITPMGGFPHYGVVKDDYLLI 1065
             G  G     ++ K +   G++G E  T  + E  + +K+              ++ L++
Sbjct: 144  TGSLGDISGNKVVKGMTMPGRLGHEKVTKQSLEIIKVDKE--------------NNLLVL 189

Query: 1066 KGGCVGPKKRVVTLRQSL 1119
            KG   GPKK  + ++ ++
Sbjct: 190  KGSVPGPKKSFLVIKSAI 207



>sp|P52860|RL3_THETH 50S ribosomal protein L3.>gb:TTRPS10L3_198622
            T.thermophilus genes for ribosomal proteind L3 and
            S10.>gb:AE017305_436962 Thermus thermophilus HB27 section
            5 of 7 of the complete genome.>gb:AP008226_579149 Thermus
            thermophilus HB8 genomic DNA, complete
            genome.>gb:AE017221_1078940 Thermus thermophilus HB27
            complete genome.
          Length = 206

 Score = 39.3 bits (90), Expect = 0.20
 Identities = 34/138 (24%), Positives = 55/138 (39%), Gaps = 3/138 (2%)
 Frame = +1

Query: 712  VFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRK--THRGLRKVACIGAWH-PARVSFTV 882
            +F+  E +D+ G +KG+G+ GV+ RW     P     H+  R    IG    P RV    
Sbjct: 95   IFKPGERVDVTGTSKGRGFAGVMKRWNFAGGPDSHGAHKIHRHPGSIGNRKTPGRVYKGK 154

Query: 883  ARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLL 1062
              AG  G    T +N ++                      D+ P          +++ LL
Sbjct: 155  KMAGHYGAERVTVMNLEVV---------------------DVIP----------EENLLL 183

Query: 1063 IKGGCVGPKKRVVTLRQS 1116
            +KG   GP   +V +R++
Sbjct: 184  VKGAVPGPNGGLVIVRET 201



>sp|Q8ETY2|RL3_OCEIH 50S ribosomal protein L3.>gb:BA000028_694506
           Oceanobacillus iheyensis HTE831 DNA, complete genome.
          Length = 209

 Score = 39.3 bits (90), Expect = 0.20
 Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 2/62 (3%)
 Frame = +1

Query: 691 KQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRG--LRKVACIGAWHPA 864
           +++ +D +F+  E ID+ G +KGKG++GV+ R G  R P  TH     R    +G   P 
Sbjct: 95  QEIKVD-IFESGEKIDVTGTSKGKGFQGVIKRHGQQRGP-TTHGSHFHRAPGAMGVIDPM 152

Query: 865 RV 870
           RV
Sbjct: 153 RV 154



>sp|P60453|RL3_CORDI 50S ribosomal protein L3.>gb:BX248355_761768
           Corynebacterium diphtheriae gravis NCTC13129, complete
           genome; segment 2/8.
          Length = 218

 Score = 39.3 bits (90), Expect = 0.20
 Identities = 34/114 (29%), Positives = 47/114 (41%), Gaps = 3/114 (2%)
 Frame = +1

Query: 613 KAHVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWG 792
           + HV EI         ++D   G+   Q     +F+    +D+ G TKGKGY G + R G
Sbjct: 81  RRHVAEI---------RMDDVSGYELGQDVTVEIFEGINFVDVTGTTKGKGYAGAMKRHG 131

Query: 793 VT--RLPRKTHRGLRKVACIGAW-HPARVSFTVARAGQNGYHHRTELNKKIYKL 945
                         R+V  IGA   P RV      AG+ G    T  N K+ K+
Sbjct: 132 FAGQGAAHGNQAAHRRVGGIGACATPGRVFKGTRMAGRMGSDRVTTQNLKVQKI 185



>gb:AE017283_431619 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 223

 Score = 38.9 bits (89), Expect = 0.26
 Identities = 25/81 (30%), Positives = 39/81 (48%), Gaps = 3/81 (3%)
 Frame = +1

Query: 712 VFQKDEMIDIIGVTKGKGYEGVVTR--WGVTRLPRKTHRGLRKVACIGAWH-PARVSFTV 882
           VF + + +D+ G +KGKG  GV+ R  +G  R     HR  R    IG    P +V   +
Sbjct: 106 VFSESDFVDVTGTSKGKGTAGVMKRHGFGGLRATHGVHRKHRSPGSIGGCSTPGKVIKGL 165

Query: 883 ARAGQNGYHHRTELNKKIYKL 945
             AG+ G    T  N +++ +
Sbjct: 166 RMAGRMGVERVTVQNLQVHSV 186



>gb:BX842644_822747 Mycoplasma mycoides subsp. mycoides SC genomic
            DNA, complete sequence; segment 3/4.
          Length = 223

 Score = 38.5 bits (88), Expect = 0.34
 Identities = 40/187 (21%), Positives = 71/187 (37%), Gaps = 5/187 (2%)
 Frame = +1

Query: 604  KQKKAHVMEIQVNGGTIAQKVDFAYGFFEKQV-PIDAVFQKDEMIDIIGVTKGKGYEGVV 780
            K +  H  +   N     +++    G+   QV  +  +F   E +D+ G++KGKG+ G +
Sbjct: 62   KPELGHFKKANSNPKRFVKEIRNMQGYELGQVINVSDIFVSGEYVDVTGISKGKGFAGGI 121

Query: 781  TRWGVTRLPRK----THRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKLG 948
             R    R P       HRG+  +  I      R+  +    G  G   RT  N +I  + 
Sbjct: 122  KRHNYARGPMAHGSGYHRGIGSMGAI----INRIFKSKKMPGHMGNAKRTIQNLEIIAID 177

Query: 949  KVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGGCVGPKKRVVTLRQSLLNQ 1128
            +                                ++ +LIKG   G K   V ++Q++   
Sbjct: 178  Q-------------------------------PNNIMLIKGSIPGSKNSFVQIKQNIKGM 206

Query: 1129 TSRVALE 1149
            +S+ A+E
Sbjct: 207  SSKQAVE 213



>gb:AF115283_480068 Leptospira interrogans S10-spc-alpha locus,
           complete sequence.
          Length = 206

 Score = 38.5 bits (88), Expect = 0.34
 Identities = 28/85 (32%), Positives = 42/85 (49%), Gaps = 2/85 (2%)
 Frame = +1

Query: 703 IDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP-RKTHRGLRKVACIGA-WHPARVSF 876
           I  VF   +++ + GV+KG+GY+GVV R G    P     R  R    +GA   P+RV  
Sbjct: 98  IQDVFAVSDVVKVTGVSKGRGYQGVVKRHGHAGGPGAHGSRFHRHPGSMGANSTPSRVFK 157

Query: 877 TVARAGQNGYHHRTELNKKIYKLGK 951
            V   G+ G    T  N K+ ++ +
Sbjct: 158 GVKLPGRTGSQKTTVRNLKVVRINE 182



>sp|Q9XD36|RL3_LEPIN 50S ribosomal protein L3.>gb:AE011262_270977
           Leptospira interrogans serovar lai str. 56601 chromosome
           I, section 71 of 397 of the complete
           sequence.>gb:AE017298_435035 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           section 12 of 14 of the complete
           sequence.>gb:AE010300_1004376 Leptospira interrogans
           serovar lai str. 56601 chromosome I, complete
           sequence.>gb:AE016823_1068046 Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130, chromosome I,
           complete sequence.
          Length = 206

 Score = 38.5 bits (88), Expect = 0.34
 Identities = 28/85 (32%), Positives = 42/85 (49%), Gaps = 2/85 (2%)
 Frame = +1

Query: 703 IDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP-RKTHRGLRKVACIGA-WHPARVSF 876
           I  VF   +++ + GV+KG+GY+GVV R G    P     R  R    +GA   P+RV  
Sbjct: 98  IQDVFAVSDVVKVTGVSKGRGYQGVVKRHGHAGGPGAHGSRFHRHPGSMGANSTPSRVFK 157

Query: 877 TVARAGQNGYHHRTELNKKIYKLGK 951
            V   G+ G    T  N K+ ++ +
Sbjct: 158 GVKLPGRTGSQKTTVRNLKVVRINE 182



>sp|Q9LRN8|RK3B_ARATH 50S ribosomal protein L3-2, chloroplast
           precursor.
          Length = 324

 Score = 38.5 bits (88), Expect = 0.34
 Identities = 37/132 (28%), Positives = 54/132 (40%), Gaps = 16/132 (12%)
 Frame = +1

Query: 598 GLKQKKAHVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAV-----------FQKDEMIDII 744
           G  QKK   +   V G   AQ V       E  V  DA+           F   + +D+ 
Sbjct: 126 GCGQKKPKHLSKAVVGHFRAQGVPLKRKLREFPVTEDALLPVGTSLGVRHFVPGQYVDVT 185

Query: 745 GVTKGKGYEGVVTRWGVTRLPRK-----THRGLRKVACIGAWHPARVSFTVARAGQNGYH 909
           G+T+GKG++G + R G + +P       +HR         A  P +V      AG+ G  
Sbjct: 186 GITRGKGFQGCMKRHGFSGMPASHGASLSHRSGGSTGQRDA--PGKVFKGRKMAGRMGAD 243

Query: 910 HRTELNKKIYKL 945
            RT  N  +YK+
Sbjct: 244 QRTVKNVWVYKI 255



>gb:BA000026_694363 Mycoplasma penetrans HF-2 DNA, complete genome.
          Length = 326

 Score = 38.1 bits (87), Expect = 0.44
 Identities = 46/209 (22%), Positives = 82/209 (39%), Gaps = 2/209 (0%)
 Frame = +1

Query: 541  KKYSCVIRVLAHTQIRKMKGLKQKKAHVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQ 720
            +K   V   +   QI + K  K +K +  +I+ +     ++     G+      +  +F 
Sbjct: 57   EKNGYVATKVGFQQIEEKKLNKPQKGYFKKIKTDAFKHTKEFRNVSGYNVGDKILVDIFN 116

Query: 721  KDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARV--SFTVARAG 894
              + +D   +TKGKG+ G + RW     P             GA +P R   S +  R G
Sbjct: 117  SGDKVDAQAITKGKGFTGAIKRWNFKVGPLGH----------GAGYPHRYQGSISFGRGG 166

Query: 895  QNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGG 1074
              G   R    +K+      G   H  +T  + T   I           ++ + +L+KG 
Sbjct: 167  SQG--QRVPKGQKM-----SGHYGHELVTISNLTVVSIE----------LEKNLILVKGS 209

Query: 1075 CVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
              GP   +V L+ ++    S+  ++ IKL
Sbjct: 210  VPGPVNSLVLLKTTV---KSKKQVDPIKL 235



>gb:AP006618_557127 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 221

 Score = 38.1 bits (87), Expect = 0.44
 Identities = 33/116 (28%), Positives = 53/116 (45%), Gaps = 5/116 (4%)
 Frame = +1

Query: 613 KAHVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTR-- 786
           + H+ EI+V     A    F  G   +++  D VF++   +D+ G +KGKGY G + R  
Sbjct: 84  RRHIAEIRV-----ADASSFEVG---QEINAD-VFEEGSYVDVTGTSKGKGYAGTMKRHG 134

Query: 787 ---WGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELNKKIYKL 945
               G +   +  HR  R  +  G   P RV   +  AG+ G    T  N  ++K+
Sbjct: 135 FRGQGASHGAQAVHR--RPGSIGGCATPGRVFKGMRMAGRMGNDRVTTQNLSVHKV 188



>sp|Q8EUB3|RL3_MYCPE 50S ribosomal protein L3.
          Length = 310

 Score = 38.1 bits (87), Expect = 0.44
 Identities = 46/209 (22%), Positives = 82/209 (39%), Gaps = 2/209 (0%)
 Frame = +1

Query: 541  KKYSCVIRVLAHTQIRKMKGLKQKKAHVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQ 720
            +K   V   +   QI + K  K +K +  +I+ +     ++     G+      +  +F 
Sbjct: 41   EKNGYVATKVGFQQIEEKKLNKPQKGYFKKIKTDAFKHTKEFRNVSGYNVGDKILVDIFN 100

Query: 721  KDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARV--SFTVARAG 894
              + +D   +TKGKG+ G + RW     P             GA +P R   S +  R G
Sbjct: 101  SGDKVDAQAITKGKGFTGAIKRWNFKVGPLGH----------GAGYPHRYQGSISFGRGG 150

Query: 895  QNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKGG 1074
              G   R    +K+      G   H  +T  + T   I           ++ + +L+KG 
Sbjct: 151  SQG--QRVPKGQKM-----SGHYGHELVTISNLTVVSIE----------LEKNLILVKGS 193

Query: 1075 CVGPKKRVVTLRQSLLNQTSRVALEEIKL 1161
              GP   +V L+ ++    S+  ++ IKL
Sbjct: 194  VPGPVNSLVLLKTTV---KSKKQVDPIKL 219



>gb:AE017248_415815 Treponema denticola ATCC 35405, section 3 of 10
           of the complete genome.>gb:AE017226_1069411 Treponema
           denticola ATCC 35405, complete genome.
          Length = 208

 Score = 37.7 bits (86), Expect = 0.58
 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 5/41 (12%)
 Frame = +1

Query: 685 FEKQVPID-----AVFQKDEMIDIIGVTKGKGYEGVVTRWG 792
           F+K+V +        F+K   +DI  ++KGKG++GV+ RWG
Sbjct: 84  FDKEVAVGDKLGVEAFEKVSYLDITAISKGKGFQGVMKRWG 124



>gb:AE008692_240255 Zymomonas mobilis subsp. mobilis ZM4, complete
           genome.
          Length = 242

 Score = 37.7 bits (86), Expect = 0.58
 Identities = 26/78 (33%), Positives = 36/78 (46%), Gaps = 4/78 (5%)
 Frame = +1

Query: 715 FQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGA----WHPARVSFTV 882
           F   +++DI G T+GKG+ G + RWG   L R TH         G+      P RV    
Sbjct: 102 FIAGQLVDISGQTQGKGFAGAMKRWGFGGL-RATHGVSLSHRSHGSTGNRQDPGRVFKNK 160

Query: 883 ARAGQNGYHHRTELNKKI 936
             AG  G   RT+ N ++
Sbjct: 161 KMAGHMGARQRTQQNLEV 178



>sp|Q8NT09|RL3_CORGL 50S ribosomal protein L3.>gb:BA000036_718233
           Corynebacterium glutamicum ATCC 13032 DNA, complete
           genome.>gb:BX927149_832096 Corynebacterium glutamicum
           ATCC 13032, IS fingerprint type 4-5, complete genome;
           segment 2/10.
          Length = 218

 Score = 37.7 bits (86), Expect = 0.58
 Identities = 33/114 (28%), Positives = 47/114 (41%), Gaps = 3/114 (2%)
 Frame = +1

Query: 613 KAHVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWG 792
           + HV EI         ++D   G+   Q     +F   + +D+ G TKGKGY G + R G
Sbjct: 81  RRHVTEI---------RMDDVSGYEVGQDVTVEIFNDIKFVDVTGTTKGKGYAGAMKRHG 131

Query: 793 VT--RLPRKTHRGLRKVACIG-AWHPARVSFTVARAGQNGYHHRTELNKKIYKL 945
                         R+V  IG A  P R+      AG+ G    T  N K+ K+
Sbjct: 132 FAGQGAGHGNQAAHRRVGGIGAAATPGRIFKGKRMAGRMGNDRVTTQNLKVQKI 185



>gb:BX640422_807999 Bordetella pertussis strain Tohama I, complete
           genome; segment 12/12.
          Length = 214

 Score = 37.4 bits (85), Expect = 0.75
 Identities = 32/131 (24%), Positives = 56/131 (42%), Gaps = 11/131 (8%)
 Frame = +1

Query: 586 RKMKGLKQKKAHVMEIQVNGGTI--------AQKVDFAYGFFEKQVPIDAVFQKDEMIDI 741
           R  + +K +  H  +     G+I        A+  +FA G     + +++VF+  + +D+
Sbjct: 52  RATRVVKPQAGHYAKAGAEAGSILKEFRLDPARAAEFAAGAV---IAVESVFEAGQQVDV 108

Query: 742 IGVTKGKGYEGVVTR--WGVTRLPRKTHRGLRKVACIG-AWHPARVSFTVARAGQNGYHH 912
            G + GKG+ G + R  +G  R      R  R    IG A  P R+      +G  G   
Sbjct: 109 TGTSIGKGFAGTIKRHNFGSQRASHGNSRSHRVPGSIGQAQDPGRIFPGKRMSGHMGDVT 168

Query: 913 RTELNKKIYKL 945
           RT  N  + ++
Sbjct: 169 RTVQNLDVVRV 179



>gb:AE017313_439554 Desulfovibrio vulgaris subsp. vulgaris str.
            Hildenborough, section 5 of 12 of the complete
            genome.>gb:AE017285_1072715 Desulfovibrio vulgaris subsp.
            vulgaris str. Hildenborough, complete genome.
          Length = 209

 Score = 37.4 bits (85), Expect = 0.75
 Identities = 33/134 (24%), Positives = 55/134 (41%)
 Frame = +1

Query: 712  VFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARA 891
            +F   + + + G + GKGY+GV+ RW      + TH G  KV   G              
Sbjct: 103  LFATGDRVKVSGTSIGKGYQGVMRRWNFAG-SKDTH-GCEKVHRSG-----------GSI 149

Query: 892  GQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKG 1071
            G N +       KK+      G   + ++T  +    D+ P          +D+ +L+KG
Sbjct: 150  GNNTFPGHVFKGKKM-----AGHWGNESVTVLNLEVVDVRP----------EDNVILVKG 194

Query: 1072 GCVGPKKRVVTLRQ 1113
               GPK  +V +R+
Sbjct: 195  SVPGPKNGLVMVRK 208



>gb:AE017201_403714 Lactobacillus johnsonii NCC 533, section 2 of 7
           of the complete genome.>gb:AE017198_1122201
           Lactobacillus johnsonii NCC 533, complete genome.
          Length = 209

 Score = 37.4 bits (85), Expect = 0.75
 Identities = 21/90 (23%), Positives = 47/90 (52%), Gaps = 6/90 (6%)
 Frame = +1

Query: 568 LAHTQIRKMKGLKQKKAHVMEIQVNGGTIAQKV------DFAYGFFEKQVPIDAVFQKDE 729
           + +  +R++   K  K H  + + +     +++      D+  G    ++ +D+ F + +
Sbjct: 51  VGYQDMREVLSNKPAKGHAAKAKTSPKRFIREIRDVELKDYEVG---SEITVDS-FSEGD 106

Query: 730 MIDIIGVTKGKGYEGVVTRWGVTRLPRKTH 819
           ++D+ G T+G G +G + RWG +R P +TH
Sbjct: 107 VVDVTGTTRGHGTQGNIKRWGQSRGP-ETH 135



>gb:CP000046_92328 Staphylococcus aureus subsp. aureus COL, complete
            genome.
          Length = 209

 Score = 37.4 bits (85), Expect = 0.75
 Identities = 34/143 (23%), Positives = 60/143 (41%)
 Frame = +1

Query: 691  KQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARV 870
            ++V +D  F   ++ID+ GV+KGKG++G + R G +R P                H +  
Sbjct: 92   QEVSVDT-FVAGDVIDVTGVSKGKGFQGAIKRHGQSRGPMS--------------HGSHF 136

Query: 871  SFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKD 1050
                   G      R    +K+   G++G  N   +   +  + D             ++
Sbjct: 137  HRAPGSVGMASDASRVFKGQKM--PGRMG-GNTVTVQNLEVVQVD------------TEN 181

Query: 1051 DYLLIKGGCVGPKKRVVTLRQSL 1119
              +L+KG   GPKK +V +R S+
Sbjct: 182  KVILVKGNVPGPKKGLVEIRTSI 204



>gb:CP000033_88599 Lactobacillus acidophilus NCFM, complete genome.
          Length = 212

 Score = 37.4 bits (85), Expect = 0.75
 Identities = 22/90 (24%), Positives = 48/90 (53%), Gaps = 6/90 (6%)
 Frame = +1

Query: 568 LAHTQIRKMKGLKQKKAHVMEIQVNGGTIAQKV------DFAYGFFEKQVPIDAVFQKDE 729
           L +   R++   K +K H  + + +     +++      D+  G    +V +D  F++ +
Sbjct: 51  LGYQDKREVLSNKPEKGHADKAKTSPKRFIREIRGVELKDYEVG---SEVTVDT-FKEGD 106

Query: 730 MIDIIGVTKGKGYEGVVTRWGVTRLPRKTH 819
           ++++ G ++G GY+G + RWG +R P +TH
Sbjct: 107 VVNVTGTSRGHGYQGNIKRWGQSRGP-ETH 135



>sp|P60448|RL3_STAAM 50S ribosomal protein L3.>sp|P60449|RL3_STAAN 50S
            ribosomal protein L3.>sp|P60450|RL3_STAAW 50S ribosomal
            protein L3.>pir|E90022|E90022 50S ribosomal protein L3
            [imported] - Staphylococcus aureus  (strain
            N315)>gb:BA000017_677935 Staphylococcus aureus subsp.
            aureus Mu50 DNA, complete genome.>gb:BA000018_680524
            Staphylococcus aureus subsp. aureus N315 genomic DNA,
            complete genome.>gb:BA000033_712461 Staphylococcus aureus
            subsp. aureus MW2 DNA, complete genome,
            strain:MW2.>gb:BX571856_781760 Staphylococcus aureus
            subsp. aureus strain MRSA252, complete
            genome.>gb:BX571857_784372 Staphylococcus aureus strain
            MSSA476, complete genome.
          Length = 220

 Score = 37.4 bits (85), Expect = 0.75
 Identities = 34/143 (23%), Positives = 60/143 (41%)
 Frame = +1

Query: 691  KQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARV 870
            ++V +D  F   ++ID+ GV+KGKG++G + R G +R P                H +  
Sbjct: 103  QEVSVDT-FVAGDVIDVTGVSKGKGFQGAIKRHGQSRGPMS--------------HGSHF 147

Query: 871  SFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKD 1050
                   G      R    +K+   G++G  N   +   +  + D             ++
Sbjct: 148  HRAPGSVGMASDASRVFKGQKM--PGRMG-GNTVTVQNLEVVQVD------------TEN 192

Query: 1051 DYLLIKGGCVGPKKRVVTLRQSL 1119
              +L+KG   GPKK +V +R S+
Sbjct: 193  KVILVKGNVPGPKKGLVEIRTSI 215



>sp|Q9HWD5|RL3_PSEAE 50S ribosomal protein L3.>pir|E83116|E83116 50S
           ribosomal protein L3 PA4263 [imported] - Pseudomonas
           aeruginosa (strain PAO1)>gb:AE004841_58498 Pseudomonas
           aeruginosa PAO1, section 402 of 529 of the complete
           genome.>gb:AE004091_972598 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 211

 Score = 37.4 bits (85), Expect = 0.75
 Identities = 14/32 (43%), Positives = 23/32 (71%)
 Frame = +1

Query: 694 QVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRW 789
           Q+ +D +FQ  +M+D+ G +KGKG+ G + RW
Sbjct: 95  QITVD-LFQAGQMVDVTGESKGKGFAGTIKRW 125



>sp|Q7WRC5|RL3_BORBR 50S ribosomal protein L3.>sp|Q7W2F6|RL3_BORPA
           50S ribosomal protein L3.>sp|Q7VTD3|RL3_BORPE 50S
           ribosomal protein L3.>gb:BX640423_808283 Bordetella
           parapertussis strain 12822, complete genome; segment
           1/14.>gb:BX640437_812685 Bordetella bronchiseptica
           strain RB50, complete genome; segment 1/16.
          Length = 233

 Score = 37.4 bits (85), Expect = 0.75
 Identities = 32/131 (24%), Positives = 56/131 (42%), Gaps = 11/131 (8%)
 Frame = +1

Query: 586 RKMKGLKQKKAHVMEIQVNGGTI--------AQKVDFAYGFFEKQVPIDAVFQKDEMIDI 741
           R  + +K +  H  +     G+I        A+  +FA G     + +++VF+  + +D+
Sbjct: 71  RATRVVKPQAGHYAKAGAEAGSILKEFRLDPARAAEFAAGAV---IAVESVFEAGQQVDV 127

Query: 742 IGVTKGKGYEGVVTR--WGVTRLPRKTHRGLRKVACIG-AWHPARVSFTVARAGQNGYHH 912
            G + GKG+ G + R  +G  R      R  R    IG A  P R+      +G  G   
Sbjct: 128 TGTSIGKGFAGTIKRHNFGSQRASHGNSRSHRVPGSIGQAQDPGRIFPGKRMSGHMGDVT 187

Query: 913 RTELNKKIYKL 945
           RT  N  + ++
Sbjct: 188 RTVQNLDVVRV 198



>gb:AY552545_627847 Uncultured marine gamma proteobacterium
           EBAC20E09 clone EBAC20E09, complete sequence.
          Length = 202

 Score = 37.0 bits (84), Expect = 0.98
 Identities = 36/110 (32%), Positives = 53/110 (48%), Gaps = 7/110 (6%)
 Frame = +1

Query: 637 VNGGTIAQ-KVDFAYGFFE--KQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP 807
           +N G++++ KV+     FE  K +  D VF+  + +DI G +KGKGY GV+ R   + + 
Sbjct: 62  INPGSLSEFKVENDIDTFEIGKHMTAD-VFEVGQFVDITGTSKGKGYAGVIKRHNFS-MQ 119

Query: 808 RKTHRGL---RKVACIGAWH-PARVSFTVARAGQNGYHHRTELNKKIYKL 945
             TH      R    IG    P RV      +G  G   +T  N KI +L
Sbjct: 120 DATHGNSLAHRAHGSIGQCQTPGRVWKGKKMSGHMGNVQKTVQNLKIVEL 169



>sp|P60443|RL3_NEIMA 50S ribosomal protein L3.>sp|P60444|RL3_NEIMB
           50S ribosomal protein L3.>pir|H81230|H81230 50S
           ribosomal protein L3 NMB0142 [imported] - Neisseria
           meningitidis (strain MC58 serogroup B, strain Z2491
           serogroup A)>gb:AE002373_45623 Neisseria meningitidis
           serogroup B strain MC58 section 15 of 206 of the
           complete genome.>gb:AE004969_61489 Neisseria gonorrhoeae
           FA 1090, complete genome.>gb:NMA1Z2491_153093 Neisseria
           meningitidis serogroup A strain Z2491 complete genome;
           segment 1/7.>gb:AE002098_895736 Neisseria meningitidis
           serogroup B strain MC58 complete genome.
          Length = 214

 Score = 37.0 bits (84), Expect = 0.98
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 3/68 (4%)
 Frame = +1

Query: 709 AVFQKDEMIDIIGVTKGKGYEGVVTR--WGVTRLPRKTHRGLRKVACIG-AWHPARVSFT 879
           ++F+  +++D+ G +KGKG+ G + R  +G  R      R  R    IG A  P RV   
Sbjct: 102 SMFEVGQLVDVTGTSKGKGFSGTIKRHNFGAQRTSHGNSRSHRVPGSIGMAQDPGRVFPG 161

Query: 880 VARAGQNG 903
              AGQ G
Sbjct: 162 KRMAGQYG 169



>sp|Q88XY6|RL3_LACPL 50S ribosomal protein L3.>gb:AL935254_550917
            Lactobacillus plantarum strain WCFS1 complete genome;
            segment 3/11.
          Length = 209

 Score = 37.0 bits (84), Expect = 0.98
 Identities = 36/137 (26%), Positives = 56/137 (40%), Gaps = 1/137 (0%)
 Frame = +1

Query: 712  VFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP-RKTHRGLRKVACIGAWHPARVSFTVAR 888
            +F   + +D+ G+TKG GY+G + + G +R P     R  R+   +GA    RV      
Sbjct: 102  IFAAGDAVDVTGITKGHGYQGNIHKDGQSRGPMAHGSRYHRRPGSMGA-IINRVFKGKKL 160

Query: 889  AGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIK 1068
             G+ G H RT  N +I +                                 V+++ LLIK
Sbjct: 161  PGRMGNHQRTMQNLQIVRAD-------------------------------VENNVLLIK 189

Query: 1069 GGCVGPKKRVVTLRQSL 1119
            G   G  K  VT++ S+
Sbjct: 190  GNVPGANKSFVTVKTSV 206



>gb:AP001278_1820912 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0434D08.
          Length = 319

 Score = 36.6 bits (83), Expect = 1.3
 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 5/82 (6%)
 Frame = +1

Query: 715 FQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRK-----THRGLRKVACIGAWHPARVSFT 879
           F   + +D+ G+TKGKG+ G + R G + +P       +HR +       A  P RV   
Sbjct: 174 FVPGQFVDVTGITKGKGFAGGMKRHGFSGMPASHGASLSHRSIGSTGQRDA--PGRVFKN 231

Query: 880 VARAGQNGYHHRTELNKKIYKL 945
               G+ G   RT  N  +Y++
Sbjct: 232 RKMPGRMGGVQRTVKNVWVYQI 253



>gb:CP000020_870412 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 173

 Score = 36.6 bits (83), Expect = 1.3
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 4/82 (4%)
 Frame = +1

Query: 712 VFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGL---RKVACIGAWH-PARVSFT 879
           VF + + +D+ G +KGKG++G V RW   R    TH      R    IG    P RV   
Sbjct: 64  VFNEIKKVDVTGTSKGKGFQGAVKRWNF-RTQDMTHGNSLSHRAPGSIGQCQTPGRVFKG 122

Query: 880 VARAGQNGYHHRTELNKKIYKL 945
              AG  G    T  N +I ++
Sbjct: 123 KKMAGHMGAERVTTQNLEIVRV 144



>gb:AP006627_562477 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 206

 Score = 36.6 bits (83), Expect = 1.3
 Identities = 32/136 (23%), Positives = 55/136 (40%), Gaps = 1/136 (0%)
 Frame = +1

Query: 715  FQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRK-THRGLRKVACIGAWHPARVSFTVARA 891
            F   +++D+ G +KGKG++G + R   +R P     R  R+   +G   P RV    A  
Sbjct: 100  FAAGDLVDVTGTSKGKGFQGAIKRHNQSRGPMSHGSRYHRRPGSMGPVAPNRVFKGKALP 159

Query: 892  GQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLIKG 1071
            G+ G    T  N +I ++ +                               + + LL+KG
Sbjct: 160  GRMGGEQITMQNLEIVRVDE-------------------------------ERNLLLVKG 188

Query: 1072 GCVGPKKRVVTLRQSL 1119
               G KK  VT++ ++
Sbjct: 189  NVPGAKKSYVTVQSAV 204



>gb:CP000029_82422 Staphylococcus epidermidis RP62A, complete
           genome.
          Length = 220

 Score = 36.6 bits (83), Expect = 1.3
 Identities = 16/39 (41%), Positives = 27/39 (69%)
 Frame = +1

Query: 691 KQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP 807
           ++V +D  F+  ++ID+ GV+KGKG++G + R G  R P
Sbjct: 103 QEVSVDT-FETGDIIDVTGVSKGKGFQGAIKRHGQGRGP 140



>pir|T01736|T01736 ribosomal protein L3 precursor, chloroplast -
           common tobacco (fragment)
          Length = 259

 Score = 36.6 bits (83), Expect = 1.3
 Identities = 32/115 (27%), Positives = 54/115 (46%), Gaps = 6/115 (5%)
 Frame = +1

Query: 619 HVMEIQ---VNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRW 789
           H+ E +   ++G  + QK+DF             +F++ +++D+ G T GKG++G + R 
Sbjct: 121 HLQEFRLQSIDGFEVTQKLDFG-----------ELFKEGDLVDVSGTTIGKGFQGGIKRH 169

Query: 790 GVTRLPRKTH--RGLRKVACIGA-WHPARVSFTVARAGQNGYHHRTELNKKIYKL 945
              R  + TH  +  R++  IGA   P RV       G+ G   R     KI K+
Sbjct: 170 NFKR-GQMTHGSKSHRQLGSIGAGTTPGRVYKGKKMPGRMGGTKRKIRKLKIVKI 223



>sp|Q8PC49|RL3_XANCP 50S ribosomal protein L3.>gb:AE012189_280161
           Xanthomonas campestris pv. campestris str. ATCC 33913,
           section 97 of 460 of the complete
           genome.>gb:AE008922_913443 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 216

 Score = 36.6 bits (83), Expect = 1.3
 Identities = 21/55 (38%), Positives = 33/55 (60%)
 Frame = +1

Query: 655 AQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTH 819
           AQ  DFA G    ++  D +F+  + +D+ GVTKGKG++G + R+   R+   TH
Sbjct: 92  AQLGDFAVG---GEIKAD-IFEVGQKVDVQGVTKGKGFQGTIKRYNF-RMGDATH 141



>sp|Q8PNS4|RL3_XANAC 50S ribosomal protein L3.>gb:AE011728_275926
           Xanthomonas axonopodis pv. citri str. 306, section 106
           of 469 of the complete genome.>gb:AE008923_917701
           Xanthomonas axonopodis pv. citri str. 306, complete
           genome.
          Length = 216

 Score = 36.6 bits (83), Expect = 1.3
 Identities = 21/55 (38%), Positives = 33/55 (60%)
 Frame = +1

Query: 655 AQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTH 819
           AQ  DFA G    ++  D +F+  + +D+ GVTKGKG++G + R+   R+   TH
Sbjct: 92  AQLGDFAVG---GEIKAD-IFEVGQKVDVQGVTKGKGFQGTIKRYNF-RMGDATH 141



>sp|Q8CRG0|RL3_STAEP 50S ribosomal protein L3.>gb:AE016750_323474
           Staphylococcus epidermidis ATCC 12228, section 7 of 9 of
           the complete genome.>gb:AE015929_1148143 Staphylococcus
           epidermidis ATCC 12228, complete genome.
          Length = 220

 Score = 36.6 bits (83), Expect = 1.3
 Identities = 16/39 (41%), Positives = 27/39 (69%)
 Frame = +1

Query: 691 KQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP 807
           ++V +D  F+  ++ID+ GV+KGKG++G + R G  R P
Sbjct: 103 QEVSVDT-FETGDIIDVTGVSKGKGFQGAIKRHGQGRGP 140



>sp|Q9RXK2|RL3_DEIRA 50S ribosomal protein L3.>pir|G75533|G75533
           ribosomal protein L3 - Deinococcus radiodurans (strain
           R1)>gb:AE001892_40590 Deinococcus radiodurans R1 section
           29 of 229 of the complete chromosome
           1.>gb:AE000513_881485 Deinococcus radiodurans R1
           complete chromosome 1.
          Length = 211

 Score = 36.6 bits (83), Expect = 1.3
 Identities = 28/88 (31%), Positives = 38/88 (43%), Gaps = 10/88 (11%)
 Frame = +1

Query: 712 VFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP-----RKTHR-----GLRKVACIGAWHP 861
           +F + E ID  G +KGKG +GV+ RW     P     +K HR     G RK        P
Sbjct: 95  IFAEGEKIDATGTSKGKGTQGVMKRWNFAGGPASHGSKKWHRRPGSIGQRKT-------P 147

Query: 862 ARVSFTVARAGQNGYHHRTELNKKIYKL 945
            RV      AG  G    T  N ++ ++
Sbjct: 148 GRVYKGKRMAGHMGMERVTVQNLEVVEI 175



>sp|O80360|RK3_TOBAC 50S ribosomal protein L3, chloroplast precursor
           (Fragment).>gb:AB010877_1511279 Nicotiana tabacum mRNA
           for chloroplast ribosomal protein L3, partial cds.
          Length = 259

 Score = 36.6 bits (83), Expect = 1.3
 Identities = 32/115 (27%), Positives = 54/115 (46%), Gaps = 6/115 (5%)
 Frame = +1

Query: 619 HVMEIQ---VNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRW 789
           H+ E +   ++G  + QK+DF             +F++ +++D+ G T GKG++G + R 
Sbjct: 121 HLQEFRLQSIDGFEVTQKLDFG-----------ELFKEGDLVDVSGTTIGKGFQGGIKRH 169

Query: 790 GVTRLPRKTH--RGLRKVACIGA-WHPARVSFTVARAGQNGYHHRTELNKKIYKL 945
              R  + TH  +  R++  IGA   P RV       G+ G   R     KI K+
Sbjct: 170 NFKR-GQMTHGSKSHRQLGSIGAGTTPGRVYKGKKMPGRMGGTKRKIRKLKIVKI 223



>gb:CP000013_869708 Borrelia garinii PBi, complete genome.
          Length = 206

 Score = 36.2 bits (82), Expect = 1.7
 Identities = 37/139 (26%), Positives = 64/139 (46%), Gaps = 4/139 (2%)
 Frame = +1

Query: 580 QIRKMKGLKQKKAHVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKG 759
           Q + +K ++ KK +V+E++   G  A            ++ +D VF+  + +D+ G TKG
Sbjct: 67  QYKSLKDIEPKK-YVIELKGLDGYDAGD----------EIKVD-VFKSVKYVDVTGTTKG 114

Query: 760 KGYEGVVTRWGVTRLP----RKTHRGLRKVACIGAWHPARVSFTVARAGQNGYHHRTELN 927
           KG++G + R   +  P     K HR L       A  PAR       AG+ G + +T  N
Sbjct: 115 KGFQGAMKRHNFSGGPSSHGSKFHRHLGGTG--QATTPARTFKGTKMAGRMGGNKQTIQN 172

Query: 928 KKIYKLGKVGQENHTALTE 984
            ++     + +EN   L +
Sbjct: 173 LEVV---LIDEENRAILVK 188



>gb:AY744382_644936 Buchnera aphidicola (Cinara cedri) genomic
           sequence.
          Length = 208

 Score = 36.2 bits (82), Expect = 1.7
 Identities = 35/131 (26%), Positives = 54/131 (41%), Gaps = 6/131 (4%)
 Frame = +1

Query: 586 RKMKGLKQKKAHVME--IQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKG 759
           ++ K LK +  H ++  + V  G    K   +  +   Q      F+  + +DI G++KG
Sbjct: 56  KEKKVLKSEYGHFLKFNVSVGRGLWEFKCKNSSNYSSGQKITINFFKNIKKLDITGISKG 115

Query: 760 KGYEGVVTRWGVTRLPRKTHRGL---RKVACIGA-WHPARVSFTVARAGQNGYHHRTELN 927
           KG+ G V RW   R+   TH      R    IG    P  V      +G  G    T  N
Sbjct: 116 KGFAGTVKRWNF-RMQDATHGNSLSHRVPGSIGQNQTPGHVFKGKKMSGHLGDQRTTIQN 174

Query: 928 KKIYKLGKVGQ 960
            KI K+  + +
Sbjct: 175 LKIVKIDDINK 185



>gb:CR378663_93736 Photobacterium profundum SS9; segment 1/12.
          Length = 209

 Score = 36.2 bits (82), Expect = 1.7
 Identities = 24/81 (29%), Positives = 37/81 (45%), Gaps = 3/81 (3%)
 Frame = +1

Query: 712 VFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGL--RKVACIGAWH-PARVSFTV 882
           +F + + +D+ G +KGKG++GV+ RW  +         L  R    IG    P RV    
Sbjct: 100 LFNEVKKVDVTGTSKGKGFQGVIKRWNFSTQDMTHGNSLSHRAPGSIGQCQTPGRVFKGK 159

Query: 883 ARAGQNGYHHRTELNKKIYKL 945
             AG  G    T  N +I ++
Sbjct: 160 KMAGHMGAERVTTQNLEIVRV 180



>sp|Q87T13|RL3_VIBPA 50S ribosomal protein L3.>gb:BA000031_705717
           Vibrio parahaemolyticus RIMD 2210633 DNA, chromosome 1,
           complete sequence.
          Length = 209

 Score = 36.2 bits (82), Expect = 1.7
 Identities = 26/82 (31%), Positives = 37/82 (45%), Gaps = 4/82 (4%)
 Frame = +1

Query: 712 VFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGL---RKVACIGAWH-PARVSFT 879
           +F + + +D+ G +KGKG++G V RW   R    TH      R    IG    P RV   
Sbjct: 100 LFNETKKVDVTGTSKGKGFQGAVKRWNF-RTQDMTHGNSLSHRAPGSIGQCQTPGRVFKG 158

Query: 880 VARAGQNGYHHRTELNKKIYKL 945
              AG  G    T  N +I ++
Sbjct: 159 KKMAGHMGAERVTTQNLEIVRV 180



>sp|Q889X1|RL3_PSESM 50S ribosomal protein L3.>gb:AE016858_350080
           Pseudomonas syringae pv. tomato str. DC3000 section 3 of
           21 of the complete genome.>gb:AE016853_1035255
           Pseudomonas syringae pv. tomato str. DC3000 complete
           genome.
          Length = 211

 Score = 36.2 bits (82), Expect = 1.7
 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 1/58 (1%)
 Frame = +1

Query: 619 HVMEIQVNGGTIAQKVDFAYGFFEKQVPIDA-VFQKDEMIDIIGVTKGKGYEGVVTRW 789
           H  +  V  G    +     G ++    I+A +F   +++D+ G +KGKG++G + RW
Sbjct: 68  HFAKANVAAGRTVMEFRLEEGEYQAGDQINAEIFAAGQLVDVTGQSKGKGFQGTIKRW 125



>sp|O52332|RL3_MYCGA 50S ribosomal protein L3.>gb:AE016967_369320
           Mycoplasma gallisepticum strain R section 1 of 4 of the
           complete genome.>gb:AE015450_1033969 Mycoplasma
           gallisepticum strain R complete genome.
          Length = 236

 Score = 36.2 bits (82), Expect = 1.7
 Identities = 25/101 (24%), Positives = 48/101 (47%), Gaps = 1/101 (0%)
 Frame = +1

Query: 604 KQKKAHVMEIQVNGGTIAQKVDFAYGF-FEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVV 780
           K +  H  +   N     ++V    G+     + ++ +FQ+ +++D+   TKG+G+ G +
Sbjct: 62  KPQLGHFKKANTNNYKYLEEVRGMVGYKIGDLLKVEELFQEGQVVDVQARTKGRGFTGAI 121

Query: 781 TRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQNG 903
            RW   ++  K H         GA +P R   +V +AG+ G
Sbjct: 122 KRWNF-KIGSKGH---------GAGYPHRFQGSV-QAGRGG 151



>sp|Q8FS80|RL3_COREF 50S ribosomal protein L3.>gb:BA000035_715307
           Corynebacterium efficiens YS-314 DNA, complete genome.
          Length = 218

 Score = 36.2 bits (82), Expect = 1.7
 Identities = 32/114 (28%), Positives = 47/114 (41%), Gaps = 3/114 (2%)
 Frame = +1

Query: 613 KAHVMEIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWG 792
           + HV EI         ++D   G+   Q     +F   + +D+ G +KGKGY G + R G
Sbjct: 81  RRHVTEI---------RMDDVSGYEVGQDVTVEIFNDVKFVDVTGTSKGKGYAGAMKRHG 131

Query: 793 VT--RLPRKTHRGLRKVACIG-AWHPARVSFTVARAGQNGYHHRTELNKKIYKL 945
                         R+V  IG A  P R+      AG+ G    T  N K+ K+
Sbjct: 132 FAGQGAGHGNQAAHRRVGGIGAAATPGRIFKGKRMAGRMGNDRVTTQNLKVQKI 185



>gb:AY085287_1570359 Arabidopsis thaliana clone 142861 mRNA,
           complete sequence.
          Length = 271

 Score = 35.8 bits (81), Expect = 2.2
 Identities = 37/140 (26%), Positives = 63/140 (45%), Gaps = 12/140 (8%)
 Frame = +1

Query: 568 LAHTQIRKMKGLKQKKAHVMEIQVNGGTIAQK------VDFAYGFFEKQ-VPIDAVFQKD 726
           + + ++R  K  K +  H+ +     GTI  +      +    GF   Q +  D +F++ 
Sbjct: 105 IGYRRVRDKKLTKPETGHLQK----AGTIPMRHLQEFRLTNIEGFEPNQKLVFDEIFKEG 160

Query: 727 EMIDIIGVTKGKGYEGVVTRW----GVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAG 894
           +++D+ G T GKG++G + R     G      K+HR L  +       P RV       G
Sbjct: 161 DLVDVAGTTIGKGFQGGIKRHHFKRGQMTHGSKSHRALGSIG--AGTTPGRVYKGKKMPG 218

Query: 895 QNGYHHRTELNK-KIYKLGK 951
           + G   RT++ K KI K+ K
Sbjct: 219 RMG-GTRTKIRKLKIVKVDK 237



>gb:AF036708_471573 Mycoplasma gallisepticum strain A5969var.B
           ribosomal proteins S10 (rps10), L3 (rpl3), L4 (rpl4),
           L23 (rpl23), L2 (rpl2), S19 (rps19), L22 (rpl22), S3
           (rps3), L16 (rpl16), L29 (rpl29), S17 (rps17), L14
           (rpl14), L24 (rpl24), L5 (rpl5), S14 (rps14), S8 (rps8),
           L6 (rpl6), L18 (rpl18), S5 (rps5), L15 (rpl15),
           secretion protein Y (secY), adenylate kinase (adk),
           methionine aminopeptidase (map), and lactate
           dehydrogenase (ldh) genes, complete cds; and rrn235
           operon consisting of 23S (rrl) and 5S (rrf) ribosomal
           RNA genes, complete sequence.
          Length = 236

 Score = 35.8 bits (81), Expect = 2.2
 Identities = 20/67 (29%), Positives = 37/67 (55%)
 Frame = +1

Query: 703 IDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTV 882
           ++ +FQ+ +++D+   TKG+G+ G + RW   ++  K H         GA +P R   +V
Sbjct: 96  VEELFQEGQVVDVQARTKGRGFTGAIKRWNF-KIGSKGH---------GAGYPHRFQGSV 145

Query: 883 ARAGQNG 903
            +AG+ G
Sbjct: 146 -QAGRGG 151



>gb:CP000033_89824 Lactobacillus acidophilus NCFM, complete genome.
          Length = 685

 Score = 35.8 bits (81), Expect = 2.2
 Identities = 20/45 (44%), Positives = 24/45 (53%)
 Frame = +1

Query: 883  ARAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPM 1017
            A A QNGYH+ +EL+ K+ K GK G E H      D    D  PM
Sbjct: 389  APALQNGYHYDSELSNKLQKFGKNGYEPHNV----DNGYSDKIPM 429



>pir|C88445|C88445 protein C26E6.6 [imported] - Caenorhabditis
           elegans
          Length = 379

 Score = 35.8 bits (81), Expect = 2.2
 Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 2/84 (2%)
 Frame = +1

Query: 700 PIDAV-FQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP-RKTHRGLRKVACIGAWHPARVS 873
           P+DA  F   + +   G T   G++G + RWG+   P R+T +  R++  +G+   AR+ 
Sbjct: 188 PLDARHFGVGQYVTATGKTIDWGFQGGMHRWGMRGQPTRRTTKSHRRIGSVGSVGDARIW 247

Query: 874 FTVARAGQNGYHHRTELNKKIYKL 945
                 G  GY  RT    +I ++
Sbjct: 248 PGKRMPGHMGYEWRTVSGLEIVRI 271



>sp|P49404|RM03_CAEEL Putative mitochondrial 60S ribosomal protein
           L3.>gb:U13875_1401873 Caenorhabditis elegans cosmid
           C26E6, complete sequence.
          Length = 381

 Score = 35.8 bits (81), Expect = 2.2
 Identities = 24/84 (28%), Positives = 41/84 (48%), Gaps = 2/84 (2%)
 Frame = +1

Query: 700 PIDAV-FQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP-RKTHRGLRKVACIGAWHPARVS 873
           P+DA  F   + +   G T   G++G + RWG+   P R+T +  R++  +G+   AR+ 
Sbjct: 190 PLDARHFGVGQYVTATGKTIDWGFQGGMHRWGMRGQPTRRTTKSHRRIGSVGSVGDARIW 249

Query: 874 FTVARAGQNGYHHRTELNKKIYKL 945
                 G  GY  RT    +I ++
Sbjct: 250 PGKRMPGHMGYEWRTVSGLEIVRI 273



>sp|Q824Q1|RL3_CHLCV 50S ribosomal protein L3.>gb:AE016994_374160
            Chlamydophila caviae GPIC section 1 of 4 of the complete
            genome.>gb:AE015925_993839 Chlamydophila caviae GPIC
            complete genome.
          Length = 221

 Score = 35.8 bits (81), Expect = 2.2
 Identities = 37/137 (27%), Positives = 54/137 (39%), Gaps = 2/137 (1%)
 Frame = +1

Query: 712  VFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGL-RKVACIGAWH-PARVSFTVA 885
            V +    +DI GV+KGKG++GV+ R+G    P+    G  R    IG    P R      
Sbjct: 111  VLEDISSVDISGVSKGKGFQGVMKRFGFRGGPKTHGSGFHRHAGSIGMRSTPGRCFPGSK 170

Query: 886  RAGQNGYHHRTELNKKIYKLGKVGQENHTALTEFDRTEKDITPMGGFPHYGVVKDDYLLI 1065
            R    G  + T  N ++ K+                 EK +                LL+
Sbjct: 171  RPSHMGTVNVTVKNLEVVKID---------------LEKKV----------------LLV 199

Query: 1066 KGGCVGPKKRVVTLRQS 1116
            KG   GP+  VV +R+S
Sbjct: 200  KGAIPGPRGSVVVIRRS 216



>sp|Q89A68|RL3_BUCBP 50S ribosomal protein L3.>gb:AE014017_302857
           Buchnera aphidicola str. Bp (Baizongia pistaciae),
           section 2 of 2 of the complete
           genome.>gb:AE016826_981458 Buchnera aphidicola str. Bp
           (Baizongia pistaciae), complete genome.
          Length = 214

 Score = 35.8 bits (81), Expect = 2.2
 Identities = 28/81 (34%), Positives = 34/81 (41%), Gaps = 3/81 (3%)
 Frame = +1

Query: 712 VFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGL--RKVACIGA-WHPARVSFTV 882
           +F   + +DIIG +KGKG+ G V RW            L  R    IG    P RV    
Sbjct: 102 LFSNIKKVDIIGTSKGKGFCGTVKRWNFHTQDATHGNSLSHRAPGSIGQNQTPGRVFKGK 161

Query: 883 ARAGQNGYHHRTELNKKIYKL 945
             AG  G H  T  N  I K+
Sbjct: 162 KMAGHLGNHRVTVQNLDIVKI 182



>sp|Q9SKX4|RK3A_ARATH 50S ribosomal protein L3-1, chloroplast
           precursor.>pir|B84861|B84861 50S ribosomal protein L3
           [imported] - Arabidopsis thaliana>gb:AC006224_1533706
           Arabidopsis thaliana chromosome 2 clone MFL8 map
           CIC10F02, complete sequence.
          Length = 271

 Score = 35.8 bits (81), Expect = 2.2
 Identities = 37/140 (26%), Positives = 63/140 (45%), Gaps = 12/140 (8%)
 Frame = +1

Query: 568 LAHTQIRKMKGLKQKKAHVMEIQVNGGTIAQK------VDFAYGFFEKQ-VPIDAVFQKD 726
           + + ++R  K  K +  H+ +     GTI  +      +    GF   Q +  D +F++ 
Sbjct: 105 IGYRRVRDKKLTKPETGHLQK----AGTIPMRHLQEFRLTNIEGFEPNQKLVFDEIFKEG 160

Query: 727 EMIDIIGVTKGKGYEGVVTRW----GVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAG 894
           +++D+ G T GKG++G + R     G      K+HR L  +       P RV       G
Sbjct: 161 DLVDVAGTTIGKGFQGGIKRHHFKRGQMTHGSKSHRALGSIG--AGTTPGRVYKGKKMPG 218

Query: 895 QNGYHHRTELNK-KIYKLGK 951
           + G   RT++ K KI K+ K
Sbjct: 219 RMG-GTRTKIRKLKIVKVDK 237



>gb:CR382138_1670792 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 610

 Score = 35.4 bits (80), Expect = 2.9
 Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 6/73 (8%)
 Frame = +1

Query: 547 YSCVIRVLAHTQIRKMKG-----LKQKKAHVMEIQVNGGTIAQKVDFAYGFFEKQVP-ID 708
           Y  ++ VL H    K+K      L  KK +   + +NGGTI ++V F    F K +P + 
Sbjct: 293 YERLVLVLLHAPEEKIKNKSKDLLGPKKINRKILPINGGTIEERVSFFIYCFRKLLPELS 352

Query: 709 AVFQKDEMIDIIG 747
             FQ++++++  G
Sbjct: 353 QYFQEEQILNKFG 365



>gb:MBS10OPER_142865 Mycobacterium bovis BCG DNA for ribosomal S10
           operon.
          Length = 217

 Score = 35.4 bits (80), Expect = 2.9
 Identities = 25/83 (30%), Positives = 38/83 (45%), Gaps = 5/83 (6%)
 Frame = +1

Query: 712 VFQKDEMIDIIGVTKGKGYEGVVTR-----WGVTRLPRKTHRGLRKVACIGAWHPARVSF 876
           +F     +D+ G +KGKG+ G + R      G +   +  HR  R  +  G   PARV  
Sbjct: 105 IFADGSYVDVTGTSKGKGFAGTMKRHGFRGQGASHGAQAVHR--RPGSIGGCATPARVFK 162

Query: 877 TVARAGQNGYHHRTELNKKIYKL 945
               AG+ G    T LN  ++K+
Sbjct: 163 GTRMAGRMGNDRVTVLNLLVHKV 185



>pir|E70159|E70159 ribosomal protein L3 (rplC) - Lyme disease
           spirochete>gb:AE001152_32458 Borrelia burgdorferi B31
           (section 38 of 70) of the complete
           genome.>gb:AE000783_1120109 Borrelia burgdorferi B31
           complete genome.
          Length = 206

 Score = 35.4 bits (80), Expect = 2.9
 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 4/85 (4%)
 Frame = +1

Query: 694 QVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP----RKTHRGLRKVACIGAWHP 861
           ++ +D VF+  + +D+ G TKGKG++G + R   +  P     K HR L       A  P
Sbjct: 94  EIKVD-VFKSVKYVDVTGTTKGKGFQGAMKRHNFSGGPSSHGSKFHRHLGGTG--QATTP 150

Query: 862 ARVSFTVARAGQNGYHHRTELNKKI 936
           AR       AG+ G + +T  N ++
Sbjct: 151 ARTFKGTKMAGRMGGNQQTIQNLEV 175



>pir|I53597|I53597 proline dehydrogenase (EC 1.5.99.8) /
           1-pyrroline-5-carboxylate dehydrogenase (EC 1.5.1.12)
           [similarity] - Escherichia coli>gb:ECPUTA_132368 E.coli
           (K12-CSH4) PUTA gene.
          Length = 1310

 Score = 35.4 bits (80), Expect = 2.9
 Identities = 29/109 (26%), Positives = 49/109 (44%), Gaps = 3/109 (2%)
 Frame = +1

Query: 583 IRKMKGLKQKKAHVMEIQ---VNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVT 753
           IR+  GL++++ +   +Q    NG T  Q+VD A    +++   +A+ +  E +D +   
Sbjct: 689 IRRRFGLRRRRKNAAILQRAVFNGKTKMQQVDLACWSVKRETFSNAIAEVREAVDFLHYY 748

Query: 754 KGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWHPARVSFTVARAGQN 900
            G+  +             +THR L  V CI  W+     FT    GQN
Sbjct: 749 AGQVRDD---------FDNETHRPLGPVVCISPWNFPLAIFT----GQN 784



>sp|Q7MPI8|RL3_VIBVY 50S ribosomal protein L3.>gb:BA000037_721201
           Vibrio vulnificus YJ016 DNA, chromosome I, complete
           sequence.
          Length = 209

 Score = 35.4 bits (80), Expect = 2.9
 Identities = 26/82 (31%), Positives = 37/82 (45%), Gaps = 4/82 (4%)
 Frame = +1

Query: 712 VFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGL---RKVACIGAWH-PARVSFT 879
           +F + + +D+ G +KGKG++G V RW   R    TH      R    IG    P RV   
Sbjct: 100 LFNEVKKVDVTGTSKGKGFQGTVKRWNF-RTQDMTHGNSLSHRAPGSIGQCQTPGRVFKG 158

Query: 880 VARAGQNGYHHRTELNKKIYKL 945
              AG  G    T  N +I ++
Sbjct: 159 KKMAGHMGAERVTTQNLEIVRV 180



>sp|Q8DE39|RL3_VIBVU 50S ribosomal protein L3.>gb:AE016799_335523
           Vibrio vulnificus CMCP6 chromosome I section 3 of 11 of
           the complete sequence.>gb:AE016795_1045247 Vibrio
           vulnificus CMCP6 chromosome I complete sequence.
          Length = 209

 Score = 35.4 bits (80), Expect = 2.9
 Identities = 26/82 (31%), Positives = 37/82 (45%), Gaps = 4/82 (4%)
 Frame = +1

Query: 712 VFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGL---RKVACIGAWH-PARVSFT 879
           +F + + +D+ G +KGKG++G V RW   R    TH      R    IG    P RV   
Sbjct: 100 LFNEVKKVDVTGTSKGKGFQGTVKRWNF-RTQDMTHGNSLSHRAPGSIGQCQTPGRVFKG 158

Query: 880 VARAGQNGYHHRTELNKKIYKL 945
              AG  G    T  N +I ++
Sbjct: 159 KKMAGHMGAERVTTQNLEIVRV 180



>sp|Q9KNY4|RL3_VIBCH 50S ribosomal protein L3.>pir|F82059|F82059
           ribosomal protein L3 VC2596 [imported] - Vibrio cholerae
            (strain N16961 serogroup O1)>gb:AE004326_52967 Vibrio
           cholerae O1 biovar eltor str. N16961 chromosome I,
           section 234 of 251 of the complete
           chromosome.>gb:AE003852_1053741 Vibrio cholerae O1
           biovar eltor str. N16961 chromosome I, complete
           chromosome.
          Length = 209

 Score = 35.4 bits (80), Expect = 2.9
 Identities = 26/82 (31%), Positives = 37/82 (45%), Gaps = 4/82 (4%)
 Frame = +1

Query: 712 VFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGL---RKVACIGAWH-PARVSFT 879
           +F + + +D+ G +KGKG++G V RW   R    TH      R    IG    P RV   
Sbjct: 100 LFNEVKKVDVTGTSKGKGFQGAVKRWNF-RTQDMTHGNSLSHRAPGSIGQCQTPGRVFKG 158

Query: 880 VARAGQNGYHHRTELNKKIYKL 945
              AG  G    T  N +I ++
Sbjct: 159 KKMAGHMGAERVTTQNLEIVRV 180



>sp|P60441|RL3_MYCBO 50S ribosomal protein L3.>sp|P60442|RL3_MYCTU
           50S ribosomal protein L3.>pir|H70641|H70641 probable
           ribosomal protein L3 rplC - Mycobacterium tuberculosis
           (strain H37RV)>gb:AE000516_20730 Mycobacterium
           tuberculosis CDC1551, complete
           genome.>gb:BX248336_758078 Mycobacterium bovis subsp.
           bovis AF2122/97 complete genome; segment
           3/14.>gb:BX842574_818752 Mycobacterium tuberculosis
           H37Rv complete genome; segment 3/13.
          Length = 217

 Score = 35.4 bits (80), Expect = 2.9
 Identities = 25/83 (30%), Positives = 38/83 (45%), Gaps = 5/83 (6%)
 Frame = +1

Query: 712 VFQKDEMIDIIGVTKGKGYEGVVTR-----WGVTRLPRKTHRGLRKVACIGAWHPARVSF 876
           +F     +D+ G +KGKG+ G + R      G +   +  HR  R  +  G   PARV  
Sbjct: 105 IFADGSYVDVTGTSKGKGFAGTMKRHGFRGQGASHGAQAVHR--RPGSIGGCATPARVFK 162

Query: 877 TVARAGQNGYHHRTELNKKIYKL 945
               AG+ G    T LN  ++K+
Sbjct: 163 GTRMAGRMGNDRVTVLNLLVHKV 185



>sp|Q8K950|RL3_BUCAP 50S ribosomal protein L3.>gb:AE014125_303408
           Buchnera aphidicola str. Sg (Schizaphis graminum)
           section 50 of 57 of the complete
           genome.>gb:AE013218_935386 Buchnera aphidicola str. Sg
           (Schizaphis graminum) complete genome.
          Length = 209

 Score = 35.4 bits (80), Expect = 2.9
 Identities = 27/82 (32%), Positives = 36/82 (43%), Gaps = 4/82 (4%)
 Frame = +1

Query: 712 VFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGL---RKVACIGA-WHPARVSFT 879
           +F   + +D+ G++KGKG+ G V RW   R    TH      R    IG    P RV   
Sbjct: 100 IFNDIKKVDVTGISKGKGFSGTVKRWNF-RTQDATHGNSLSHRVPGSIGQNQTPGRVFKG 158

Query: 880 VARAGQNGYHHRTELNKKIYKL 945
              AG  G +  T  N  I K+
Sbjct: 159 KKMAGHLGNNRVTVQNLNIVKI 180



>gb:BX908798_829968 Parachlamydia-related symbiont UWE25, complete
           genome.
          Length = 235

 Score = 35.0 bits (79), Expect = 3.7
 Identities = 29/100 (29%), Positives = 43/100 (43%), Gaps = 2/100 (2%)
 Frame = +1

Query: 691 KQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTHRGLRKVACIGAWH--PA 864
           +++ +D  F   E +D   ++KGKGY+GV+ R      P     G  + A        P 
Sbjct: 116 QEISVDT-FNGIEFVDATAISKGKGYQGVMKRHNFAGGPASHGSGHHRHAGSTGMRSTPG 174

Query: 865 RVSFTVARAGQNGYHHRTELNKKIYKLGKVGQENHTALTE 984
           R      +AGQ G    T  N +I    KV  ENH  + +
Sbjct: 175 RGLPGGKKAGQMGNERVTVQNLRIV---KVDSENHVIVVK 211



>gb:AE013598_297285 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 216

 Score = 35.0 bits (79), Expect = 3.7
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 667 DFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTH 819
           DFA G    ++  D +F+  + +D+ GVTKGKG++G + R+   R+   TH
Sbjct: 96  DFAVG---GEIKAD-IFEVGQKVDVQGVTKGKGFQGTIKRYNF-RMGDATH 141



>sp|O83219|RL3_TREPA 50S ribosomal protein L3.>pir|G71354|G71354
           probable ribosomal protein L3 (rplC) - syphilis
           spirochete>gb:AE001202_33018 Treponema pallidum subsp.
           pallidum str. Nichols section 18 of 87 of the complete
           genome.>gb:AE000520_1049246 Treponema pallidum subsp.
           pallidum str. Nichols complete genome.
          Length = 208

 Score = 35.0 bits (79), Expect = 3.7
 Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 3/81 (3%)
 Frame = +1

Query: 712 VFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTH--RGLRKVACIG-AWHPARVSFTV 882
           V +    +D+  ++KGKG++GVV RWG +   R +H  +  R+    G    P R    V
Sbjct: 98  VLESVRYLDVCALSKGKGFQGVVKRWGFSG-GRSSHGSKFHREAGSTGQCTSPGRTFKNV 156

Query: 883 ARAGQNGYHHRTELNKKIYKL 945
              G+ G    T  N +I ++
Sbjct: 157 KMPGRMGAERVTVQNLRIERI 177



>gb:AK035282_1164060 Mus musculus adult male urinary bladder cDNA,
           RIKEN full-length enriched library, clone:9530009E11
           product:weakly similar to 60S RIBOSOMAL PROTEIN L3 (J1
           PROTEIN) [Mus musculus], full insert
           sequence.>gb:AK048221_1168322 Mus musculus 16 days
           embryo head cDNA, RIKEN full-length enriched library,
           clone:C130041A08 product:weakly similar to 60S RIBOSOMAL
           PROTEIN L3 (J1 PROTEIN) [Mus musculus], full insert
           sequence.
          Length = 109

 Score = 34.7 bits (78), Expect = 4.9
 Identities = 18/45 (40%), Positives = 25/45 (55%)
 Frame = +1

Query: 157 RGKVKAFPKDDSSKPCRLTAFLGYKAGMTHIVREVEKPGSKLHKK 291
           R + K FPK+D  K   L  FL  +A MT+ V E+ + G K  +K
Sbjct: 9   RIQAKDFPKEDLPKSAHLIVFLVSRAVMTYFVWEINRSGPKWTRK 53



>gb:CP000027_79479 Dehalococcoides ethenogenes 195, complete genome.
          Length = 205

 Score = 34.7 bits (78), Expect = 4.9
 Identities = 17/35 (48%), Positives = 22/35 (62%)
 Frame = +1

Query: 715 FQKDEMIDIIGVTKGKGYEGVVTRWGVTRLPRKTH 819
           F+  E ID  GV++G+G+ GVV RW     P KTH
Sbjct: 98  FKDGEKIDASGVSRGRGFAGVVKRWHFAGGP-KTH 131



>sp|Q8D212|RL3_WIGBR 50S ribosomal protein L3.>gb:BA000021_687289
           Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis DNA, complete genome.
          Length = 215

 Score = 34.7 bits (78), Expect = 4.9
 Identities = 29/109 (26%), Positives = 45/109 (41%), Gaps = 3/109 (2%)
 Frame = +1

Query: 628 EIQVNGGTIAQKVDFAYGFFEKQVPIDAVFQKDEMIDIIGVTKGKGYEGVVTRWGVTRLP 807
           ++++  G    KVD    F+  QV     F     ++I G++KGKG+ G + RW      
Sbjct: 72  KVELGRGLWEFKVDKNSKFYVGQVLSINTFININKVNITGISKGKGFSGTMKRWNFHGQD 131

Query: 808 RKTHRGL--RKVACIGA-WHPARVSFTVARAGQNGYHHRTELNKKIYKL 945
                 L  R    IG    P +V      +G  GY+  T  N  + K+
Sbjct: 132 ASHGNSLSHRAPGSIGQNQTPGKVFKGKKMSGHLGYNKNTVKNLFVVKI 180



>sp|P57591|RL3_BUCAI 50S ribosomal protein L3.>pir|A84991|A84991 50S
           ribosomal protein L3 [imported] - Buchnera sp. (strain
           APS)>gb:BA000003_653871 Buchnera aphidicola str. APS
           (Acyrthosiphon pisum) genomic DNA, complete sequence.
          Length = 209

 Score = 34.7 bits (78), Expect = 4.9
 Identities = 12/26 (46%), Positives = 18/26 (69%)
 Frame = +1

Query: 712 VFQKDEMIDIIGVTKGKGYEGVVTRW 789
           +F   + +DI G++KGKG+ G V RW
Sbjct: 100 IFNNVKKVDITGISKGKGFSGTVKRW 125


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,435,888,218
Number of Sequences: 1806583
Number of extensions: 30861626
Number of successful extensions: 83844
Number of sequences better than 10.0: 257
Number of HSP's better than 10.0 without gapping: 78672
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 83497
length of database: 581,917,975
effective HSP length: 128
effective length of database: 350,675,351
effective search space used: 118528268638
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)