BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig5687
         (690 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB012239_1511663 Arabidopsis thaliana genomic DNA, chromosome...   125   9e-28   
gb:AE016959_1023834 Oryza sativa (japonica cultivar-group) chrom...    93   5e-18   
gb:AB023044_1515502 Arabidopsis thaliana genomic DNA, chromosome...    88   2e-16   
pir|T05537|T05537 probable serine/threonine-specific protein kin...    77   3e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AP004996_1846974 Oryza sativa (japonica cultivar-group) genom...    57   4e-07   
gb:AP005412_1851384 Oryza sativa (japonica cultivar-group) genom...    55   1e-06   
pir|T04490|T04490 hypothetical protein F8F16.50 - Arabidopsis th...    52   1e-05   Arabidopsis thaliana [mouse-ear cress]
gb:BT002868_1636459 Arabidopsis thaliana clone RAFL14-96-C23 (R2...    49   6e-05   
pir|T01289|T01289 probable protein kinase At2g19410 [imported] -...    49   6e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AP005098_1847762 Oryza sativa (japonica cultivar-group) genom...    49   8e-05   
pir|H84635|H84635 probable protein kinase [imported] - Arabidops...    46   5e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AB012239_1511664 Arabidopsis thaliana genomic DNA, chromosome...    45   0.001   
gb:AP004729_1843899 Oryza sativa (japonica cultivar-group) genom...    44   0.004   
gb:AP003368_1828577 Oryza sativa (japonica cultivar-group) genom...    41   0.017   
gb:AP004159_1838384 Oryza sativa (japonica cultivar-group) genom...    40   0.051   
gb:AP005098_1847769 Oryza sativa (japonica cultivar-group) genom...    36   0.56    
gb:AP003332_1828067 Oryza sativa (japonica cultivar-group) genom...    35   1.3     
gb:AP000383_1819914 Arabidopsis thaliana genomic DNA, chromosome...    35   1.6     
gb:BT005957_1638879 Arabidopsis thaliana At3g20200 gene, complet...    35   1.6     
gb:AP001306_1821081 Arabidopsis thaliana genomic DNA, chromosome...    21   1.8     
gb:AF391808_1795322 Zea mays chromosome 9S bz genomic region str...    34   2.1     
gb:BT005843_1638765 Arabidopsis thaliana At1g09740 gene, complet...    34   2.8     
pir|S71558|S71558 probable cell wall-plasma membrane linker prot...    21   3.5     Brassica napus [oilseed rape]
gb:AF448416_1800655 Zea mays B73 chromosome 9S bz genomic region.      33   3.6     
gb:AY664416_1620633 Zea mays cultivar Mo17 locus bz, complete se...    33   3.6     
gb:AP005126_1848240 Oryza sativa (japonica cultivar-group) genom...    33   6.2     
gb:AP005126_1848239 Oryza sativa (japonica cultivar-group) genom...    33   6.2     
gb:AY095206_1298285 Drosophila melanogaster SD06937 full insert ...    33   6.2     
gb:AE014134_1128972 Drosophila melanogaster chromosome 2L, compl...    33   6.2     
sp|O35103|OMD_MOUSE|OMD_MOUSE Osteomodulin precursor (Osteoadherin) (OSAD)...    33   6.2     Mus musculus [mouse]
gb:BT004026_1637140 Arabidopsis thaliana clone RAFL15-12-A17 (R2...    32   8.1     
pir|T45665|T45665 hypothetical protein F14P22.40 - Arabidopsis t...    32   8.1     Arabidopsis thaliana [mouse-ear cress]
pir|T18131|T18131 probable ribonucleoside-diphosphate reductase ...    32   8.1     Paramecium bursaria Chlorella virus 1


>gb:AB012239_1511663 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K11J9.
          Length = 845

 Score =  125 bits (313), Expect = 9e-28
 Identities = 60/118 (50%), Positives = 89/118 (75%)
 Frame = +3

Query: 315 EKKFLQSEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPV 494
           EKK +++  + L+ +PP PS  VAVAINGK KSKY V WAL+KF+PEG   FKLL+VRP 
Sbjct: 3   EKKVVRALSEHLS-LPPPPSPSVAVAINGKKKSKYVVFWALEKFIPEGFTDFKLLYVRPP 61

Query: 495 ISAVPTPMGNSIPISQVRDDVAAAFIKEIEWQTSQKLLPYKALCTKRKVEVEVQQIES 668
           +S +PTPMG ++ +S++R+DV +A+ +E++W  ++ L PYK +  +RKV+VEV  ++S
Sbjct: 62  VSYIPTPMGIAVAVSELREDVVSAYKQELDWSANEMLRPYKKMFERRKVQVEVLLLDS 119



>gb:AE016959_1023834 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC079890_1733040
           Oryza sativa chromosome 10 BAC OSJNBb0089A17 genomic
           sequence, complete sequence.>gb:AE017119_1753653 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           73 of 77 of the complete sequence.
          Length = 782

 Score = 92.8 bits (229), Expect = 5e-18
 Identities = 44/107 (41%), Positives = 68/107 (63%)
 Frame = +3

Query: 369 PSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGNSIPISQVR 548
           P++ V +A++    SKYAV WA+  F   G + F L+HV   I+ VPTPMGN IPI +VR
Sbjct: 12  PTVTVGLAVSSSKSSKYAVQWAVKNFCTNGMVRFVLIHVLQRITTVPTPMGNYIPIDKVR 71

Query: 549 DDVAAAFIKEIEWQTSQKLLPYKALCTKRKVEVEVQQIESDNIVNAI 689
            D+A+A++KE+E +    LL YK +C + K + EV  ++ +++   I
Sbjct: 72  ADIASAYVKEVECKARTMLLFYKNMCDE-KAKAEVLVVKGEDVAETI 117



>gb:AB023044_1515502 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MWD22.
          Length = 819

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 40/103 (38%), Positives = 70/103 (67%), Gaps = 1/103 (0%)
 Frame = +3

Query: 363 PSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGNSIPISQ 542
           PS  + VA+AI+G  KSK  + WAL+KF  +  + FKL+H+ P I+ +PT  GN + IS+
Sbjct: 28  PSEPMTVALAISGSIKSKNVIKWALNKFGSDKNVTFKLIHIHPKITTLPTASGNIVSISE 87

Query: 543 VRDDVAAAFIKEIEWQTSQKLL-PYKALCTKRKVEVEVQQIES 668
             ++VAAA+ +++  +T + LL P+K +C ++K++++  + ES
Sbjct: 88  ELEEVAAAYRQKVMQETKETLLKPFKKMCERKKLKIDETRFES 130



>pir|T05537|T05537 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) F13M23.300 - Arabidopsis
           thaliana>gb:ATCHRIV62_1546398 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           62.>gb:ATF13M23_1548516 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F13M23 (ESSAII project).
          Length = 814

 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 38/80 (47%), Positives = 53/80 (66%), Gaps = 6/80 (7%)
 Frame = +3

Query: 360 PPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGNSIPIS 539
           PP PS  V VA++G SKSKY V WA++KF  EG + FKLLH+ P+I++VPTP  + +P  
Sbjct: 15  PPPPSRTVVVALSGSSKSKYVVTWAIEKFATEGNVGFKLLHIHPMITSVPTP--SKVPTM 72

Query: 540 QVR------DDVAAAFIKEI 581
            +       D+VAAA  +E+
Sbjct: 73  PLEVLVIESDNVAAAIAEEV 92



>gb:AP004996_1846974 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0027A02.
          Length = 869

 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 32/118 (27%), Positives = 53/118 (44%), Gaps = 8/118 (6%)
 Frame = +3

Query: 360 PPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGK-------ILFKLLHVRPVISAVPTPM 518
           PPSP+ V      G S S+ A  WA    VP G            ++HV P +  VP+P 
Sbjct: 8   PPSPAAVAVAVRPGGSASRRAARWAAANLVPAGDGDGRASAAAISVVHVIPPLRFVPSPC 67

Query: 519 GNSIPISQVRDDVAAAFIKEIEWQTSQKLLPYKAL-CTKRKVEVEVQQIESDNIVNAI 689
           G  +P ++V  + A A+ ++   +  + L P++ +        VE   +E D +  A+
Sbjct: 68  GEQVPAARVAREAAEAYARDRHARAQEALRPFRRIFAAAANATVETVVLEGDGVAEAL 125



>gb:AP005412_1851384 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0050G13.
          Length = 775

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 34/119 (28%), Positives = 62/119 (52%)
 Frame = +3

Query: 333 SEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPT 512
           +EMD   A      +V AVA++G   S++A+ WA D  +      F LLHVR   +++ +
Sbjct: 41  AEMDH-RAAADGGKVVAAVAVDGDRGSQHALKWAADHVLSLSHPFF-LLHVRRKHASLHS 98

Query: 513 PMGNSIPISQVRDDVAAAFIKEIEWQTSQKLLPYKALCTKRKVEVEVQQIESDNIVNAI 689
             G    +  V+DDVAA+   +++  T   LLP++  C++R ++     ++  ++   I
Sbjct: 99  AGGKQFSLLHVQDDVAASSPDQMDHHTKDLLLPFQCFCSRRGLQCRETILDGTDVWKVI 157



>pir|T04490|T04490 hypothetical protein F8F16.50 - Arabidopsis
           thaliana>gb:ATCHRIV74_1547044 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 74.>gb:ATF8F16_1551141
           Arabidopsis thaliana DNA chromosome 4, BAC clone F8F16
           (ESSA project).
          Length = 537

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 31/107 (28%), Positives = 60/107 (56%), Gaps = 3/107 (2%)
 Frame = +3

Query: 378 VVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAV---PTPMGNSIPISQVR 548
           +VAVAI+    S+ A+ WA+D  + +G+ +  L+HV+P  S++   P+   NS   SQ+ 
Sbjct: 17  LVAVAIDRDKNSQGALKWAVDNLLQKGQTVV-LVHVKPRASSLSTNPSINSNSSKTSQIN 75

Query: 549 DDVAAAFIKEIEWQTSQKLLPYKALCTKRKVEVEVQQIESDNIVNAI 689
            D ++    E E    Q  LP++ LC+++ ++ +   +E  ++  A+
Sbjct: 76  GD-SSLVCGEPEGSYKQLFLPFRCLCSRKDIQCKDVLLEESDVARAL 121



>gb:BT002868_1636459 Arabidopsis thaliana clone RAFL14-96-C23
           (R20332) unknown protein (At5g47740) mRNA, complete
           cds.>gb:BT004428_1637500 Arabidopsis thaliana clone
           U20332 unknown protein (At5g47740) mRNA, complete cds.
          Length = 244

 Score = 49.3 bits (116), Expect = 6e-05
 Identities = 28/103 (27%), Positives = 48/103 (46%)
 Frame = +3

Query: 381 VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGNSIPISQVRDDVA 560
           V V +     S  A+ WA+D  +     L  L+HV P    +P P+G  I   +   +  
Sbjct: 45  VYVGVGKGDSSMEALRWAIDNLMTSSSTLLFLIHVFPETRFIPYPLGR-ITRERASQEQV 103

Query: 561 AAFIKEIEWQTSQKLLPYKALCTKRKVEVEVQQIESDNIVNAI 689
            +F+ +   +    LL +   C+  KV+VE   +ESD++  A+
Sbjct: 104 ESFMSQEREKRRTLLLKFLHACSASKVKVETILVESDSVAKAV 146



>pir|T01289|T01289 probable protein kinase At2g19410 [imported] -
           Arabidopsis thaliana>gb:AC003058_1531064 Arabidopsis
           thaliana chromosome 2 clone F27F23 map CIC06E08,
           complete sequence.
          Length = 801

 Score = 49.3 bits (116), Expect = 6e-05
 Identities = 27/105 (25%), Positives = 53/105 (50%), Gaps = 21/105 (20%)
 Frame = +3

Query: 375 LVVAVAINGK-------SKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTP------ 515
           L VAVA+ G        + S+ AV WA+D  +P+    F ++HV P I+++PTP      
Sbjct: 22  LFVAVAVKGLIGDKLGGAGSRRAVRWAVDNLLPKAD-KFVMIHVIPTITSIPTPNILILM 80

Query: 516 --------MGNSIPISQVRDDVAAAFIKEIEWQTSQKLLPYKALC 626
                    G+ +P+ +V + V   ++++++ +     +P+  +C
Sbjct: 81  FTRMWVVTAGDRLPVEEVEESVVEMYVRDVKKEYETVFVPFLKMC 125



>gb:AP005098_1847762 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBa0008C11.
          Length = 700

 Score = 48.9 bits (115), Expect = 8e-05
 Identities = 31/110 (28%), Positives = 58/110 (52%), Gaps = 6/110 (5%)
 Frame = +3

Query: 378 VVAVAING-KSKSKYAVNWALDKFVP--EGK---ILFKLLHVRPVISAVPTPMGNSIPIS 539
           VV VA++G ++K+   + WAL +  P  EG+    L  L++V    + +P   G  +P  
Sbjct: 39  VVYVAVSGNRNKALPTLRWALRRHAPAPEGRKKTALLVLVYVHRPATMIPIFTGAKVPSI 98

Query: 540 QVRDDVAAAFIKEIEWQTSQKLLPYKALCTKRKVEVEVQQIESDNIVNAI 689
            ++D++  ++ ++    T + L  Y  +CT  KV+ E   I +DNI + +
Sbjct: 99  VLKDEIVTSYRQQERRITEKFLQQYLDICTSEKVQAEAFMIANDNIAHGL 148



>pir|H84635|H84635 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AC006403_1534089 Arabidopsis thaliana
           chromosome 2 clone T28I24 map mi238, complete sequence.
          Length = 816

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 27/107 (25%), Positives = 57/107 (53%), Gaps = 3/107 (2%)
 Frame = +3

Query: 378 VVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGNSIPI---SQVR 548
           VVAVAI+    S++A+ WA+D  +  G+ +  L+HV+      P+P+ NS  +   S   
Sbjct: 19  VVAVAIDKDKSSQHALKWAVDNLLQRGQSVI-LVHVK----LRPSPLNNSASLHASSAKL 73

Query: 549 DDVAAAFIKEIEWQTSQKLLPYKALCTKRKVEVEVQQIESDNIVNAI 689
              ++   ++ E  + +  LP++  CT++ ++ +   +E  ++  A+
Sbjct: 74  SQDSSLVCRDPEGISKEIFLPFRCFCTRKDIQCQDVLLEESDVAKAL 120



>gb:AB012239_1511664 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K11J9.
          Length = 763

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 22/41 (53%), Positives = 30/41 (73%), Gaps = 1/41 (2%)
 Frame = +3

Query: 372 SLVVAVAINGK-SKSKYAVNWALDKFVPEGKILFKLLHVRP 491
           +L+VAVAI G  SK+K  V WAL +F  +  ++FKLLHV+P
Sbjct: 23  ALIVAVAIKGNNSKTKGVVRWALQEFASQEHVVFKLLHVQP 63



>gb:AP004729_1843899 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0006A22.
          Length = 806

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 29/117 (24%), Positives = 59/117 (50%), Gaps = 4/117 (3%)
 Frame = +3

Query: 351 NAMPPSPSLVVAVAINGKSK-SKYAVNWALDKFVPEGKILFK--LLHVRPVISAVPTPMG 521
           +A   + ++VVAVA+ G  + S+ A  WA       G    +  L+HV P +S VP+P G
Sbjct: 29  SAAAAAGAIVVAVAVRGDGRASRRAARWAAANLAAHGAGAGRVALVHVIPPVSFVPSPSG 88

Query: 522 NSIPISQVRDDVAAAFIKEIEWQTSQKL-LPYKALCTKRKVEVEVQQIESDNIVNAI 689
             +P+ ++  +    + ++   +  +++ LP + L  +  VE  +  +E  ++  A+
Sbjct: 89  ERVPVEKMDAETVEMYAEDRRARAQEEVFLPLRRLFARTTVETVI--LEEPSVTAAL 143



>gb:AP003368_1828577 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1100D10.
          Length = 262

 Score = 41.2 bits (95), Expect = 0.017
 Identities = 29/78 (37%), Positives = 42/78 (53%)
 Frame = +3

Query: 321 KFLQSEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVIS 500
           ++  S + G NA   SP   +A+A++   +S YAV WA+  ++  G  +  LLHVRP   
Sbjct: 45  RYFFSSLAGTNA---SPHRRIAIAVDLSDESAYAVRWAVQNYLRPGDAVV-LLHVRPTSV 100

Query: 501 AVPTPMGNSIPISQVRDD 554
                 G SIP+S V DD
Sbjct: 101 LYGADWG-SIPVS-VSDD 116



>gb:AP004159_1838384 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1175_B01.
          Length = 162

 Score = 39.7 bits (91), Expect = 0.051
 Identities = 30/103 (29%), Positives = 52/103 (50%), Gaps = 6/103 (5%)
 Frame = +3

Query: 381 VAVAINGKSKSKYAVNWALD--KFVPEGKILFKLLHVRPVISAVPTPMGNSIPISQVRDD 554
           V VA++G  +S  A+ WALD  +  P+G ++  +LHV+P  S         IP     + 
Sbjct: 9   VVVAVDGSEESMNALRWALDNLRLRPDGALV--VLHVQPPPSIAAGLNPGPIPFGGPSEV 66

Query: 555 VAAAFIKEIE---WQTSQKLLPYK-ALCTKRKVEVEVQQIESD 671
              AF + IE    + +Q +L +   +C+++ VEV+   +  D
Sbjct: 67  EVPAFTQAIEAHQRRITQAILDHALKICSEKNVEVKTDVVVGD 109



>gb:AP005098_1847769 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBa0008C11.
          Length = 136

 Score = 36.2 bits (82), Expect = 0.56
 Identities = 27/100 (27%), Positives = 49/100 (49%), Gaps = 1/100 (1%)
 Frame = +3

Query: 381 VAVAINGK-SKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGNSIPISQVRDDV 557
           V VA+ G+  +    + WAL  + P G  L  LL+V    + +P   G  +P+  ++D+V
Sbjct: 12  VYVAVGGEPERCLPTLRWALS-YTPAGSTLV-LLYVHRPDAMIPIFTGARVPVCVLKDEV 69

Query: 558 AAAFIKEIEWQTSQKLLPYKALCTKRKVEVEVQQIESDNI 677
                ++      ++L  + A C  ++V  EV   E+D+I
Sbjct: 70  INVHRQKERSIVQERLRIFTAECESKQVHTEVIIAENDSI 109



>gb:AP003332_1828067 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1097D05.
          Length = 765

 Score = 35.0 bits (79), Expect = 1.3
 Identities = 26/112 (23%), Positives = 49/112 (43%), Gaps = 1/112 (0%)
 Frame = +3

Query: 357 MPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGN-SIP 533
           M   P++ + VA++    S+ AV W +D  +     +  LLH+     AV  P  N    
Sbjct: 21  MHHQPAMTIVVAVDRDRNSQLAVKWVVDHLLTGASNII-LLHI-----AVHPPAANHGFA 74

Query: 534 ISQVRDDVAAAFIKEIEWQTSQKLLPYKALCTKRKVEVEVQQIESDNIVNAI 689
           +++       A ++EI        +P++  CT+  V V    +E  ++  A+
Sbjct: 75  MAEATHGALEAEMREI-------FVPFRGFCTRNGVHVSELVLEEADVSKAL 119



>gb:AP000383_1819914 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone:MAL21.
          Length = 822

 Score = 34.7 bits (78), Expect = 1.6
 Identities = 25/104 (24%), Positives = 47/104 (45%)
 Frame = +3

Query: 378 VVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGNSIPISQVRDDV 557
           +VAVA++    S++A+ WA D  V +G+ +  LLHV                I +   D 
Sbjct: 17  LVAVAVDNNKGSQHALKWAADHLVSKGQTII-LLHV----------------ILRSSSD- 58

Query: 558 AAAFIKEIEWQTSQKLLPYKALCTKRKVEVEVQQIESDNIVNAI 689
           +     E   Q     + +   C++++++     +E DNIV ++
Sbjct: 59  SGEITAEKHKQAENLFVTFHCYCSRKEIQCLDVTLEDDNIVKSL 102



>gb:BT005957_1638879 Arabidopsis thaliana At3g20200 gene, complete
           cds.>gb:AK118636_1816602 Arabidopsis thaliana At3g20200
           mRNA for putative protein kinase, complete cds, clone:
           RAFL19-90-E11.
          Length = 780

 Score = 34.7 bits (78), Expect = 1.6
 Identities = 25/104 (24%), Positives = 47/104 (45%)
 Frame = +3

Query: 378 VVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGNSIPISQVRDDV 557
           +VAVA++    S++A+ WA D  V +G+ +  LLHV                I +   D 
Sbjct: 17  LVAVAVDNNKGSQHALKWAADHLVSKGQTII-LLHV----------------ILRSSSD- 58

Query: 558 AAAFIKEIEWQTSQKLLPYKALCTKRKVEVEVQQIESDNIVNAI 689
           +     E   Q     + +   C++++++     +E DNIV ++
Sbjct: 59  SGEITAEKHKQAENLFVTFHCYCSRKEIQCLDVTLEDDNIVKSL 102



>gb:AP001306_1821081 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone:MKA23.
          Length = 334

 Score = 21.2 bits (43), Expect(6) = 1.8
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -3

Query: 94  TPPILTPP 71
           TPP++TPP
Sbjct: 211 TPPVITPP 218



 Score = 21.2 bits (43), Expect(6) = 1.8
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -3

Query: 94  TPPILTPP 71
           TPP++TPP
Sbjct: 201 TPPVITPP 208



 Score = 21.2 bits (43), Expect(6) = 1.8
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -3

Query: 94  TPPILTPP 71
           TPP++TPP
Sbjct: 181 TPPVITPP 188



 Score = 20.8 bits (42), Expect(6) = 1.8
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -3

Query: 94  TPPILTPP 71
           TPP++TPP
Sbjct: 231 TPPVVTPP 238



 Score = 20.8 bits (42), Expect(6) = 1.8
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -3

Query: 94  TPPILTPP 71
           TPP++TPP
Sbjct: 221 TPPVVTPP 228



 Score = 20.8 bits (42), Expect(6) = 1.8
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -3

Query: 94  TPPILTPP 71
           TPP++TPP
Sbjct: 171 TPPVVTPP 178



>gb:AF391808_1795322 Zea mays chromosome 9S bz genomic region strain
           McC.
          Length = 787

 Score = 34.3 bits (77), Expect = 2.1
 Identities = 26/124 (20%), Positives = 54/124 (43%)
 Frame = +3

Query: 318 KKFLQSEMDGLNAMPPSPSLVVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVI 497
           + +L+   D    + P    +VAV I+    S+ A+ WA+D  V +G+ +  L+HV    
Sbjct: 3   RSYLEGGRDAGRTLVP----LVAVCIDKDKNSQNALKWAIDSLVQKGQTIV-LVHV---- 53

Query: 498 SAVPTPMGNSIPISQVRDDVAAAFIKEIEWQTSQKLLPYKALCTKRKVEVEVQQIESDNI 677
                  G S  +       AA F +  +       +P++  CT++ +  +   ++  ++
Sbjct: 54  ----NTKGTSGGVED-----AAGFKQPTDPHMKDLFVPFRCFCTRKDINCKDVVLDEHDV 104

Query: 678 VNAI 689
             +I
Sbjct: 105 AKSI 108



>gb:BT005843_1638765 Arabidopsis thaliana At1g09740 gene, complete
           cds.
          Length = 171

 Score = 33.9 bits (76), Expect = 2.8
 Identities = 29/104 (27%), Positives = 40/104 (38%), Gaps = 7/104 (6%)
 Frame = +3

Query: 381 VAVAINGKSKSKYAVNWALDKF---VPEGKILFKLLHVRPVISAVPTPMGNSIPISQVRD 551
           V VA++G   S  A+ WALD            F +LHV+P  S        +IP      
Sbjct: 10  VVVAVDGSEVSMEALRWALDNLKLSSSSSDSSFVVLHVQPSPSVAAGVSPGTIPFGGPSG 69

Query: 552 DVAAAFIKEIEWQ----TSQKLLPYKALCTKRKVEVEVQQIESD 671
               AF   IE      T   L     +C ++ V V+ Q +  D
Sbjct: 70  LEVPAFTAAIEQHQKRITDTILEHASQICAEKSVNVKTQVVIGD 113



>pir|S71558|S71558 probable cell wall-plasma membrane linker protein
           PRP precursor - rape>gb:BNPRP_1633626 B.napus PRP gene.
          Length = 376

 Score = 20.8 bits (42), Expect(6) = 3.5
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -3

Query: 94  TPPILTPP 71
           TPP++TPP
Sbjct: 275 TPPVVTPP 282



 Score = 20.8 bits (42), Expect(6) = 3.5
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -3

Query: 94  TPPILTPP 71
           TPP++TPP
Sbjct: 265 TPPVVTPP 272



 Score = 20.8 bits (42), Expect(6) = 3.5
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -3

Query: 94  TPPILTPP 71
           TPP++TPP
Sbjct: 257 TPPVVTPP 264



 Score = 20.8 bits (42), Expect(6) = 3.5
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -3

Query: 94  TPPILTPP 71
           TPP++TPP
Sbjct: 247 TPPVVTPP 254



 Score = 20.8 bits (42), Expect(6) = 3.5
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -3

Query: 94  TPPILTPP 71
           TPP++TPP
Sbjct: 211 TPPVVTPP 218



 Score = 20.8 bits (42), Expect(6) = 3.5
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -3

Query: 94  TPPILTPP 71
           TPP++TPP
Sbjct: 178 TPPVVTPP 185



>gb:AF448416_1800655 Zea mays B73 chromosome 9S bz genomic region.
          Length = 787

 Score = 33.5 bits (75), Expect = 3.6
 Identities = 23/104 (22%), Positives = 47/104 (45%)
 Frame = +3

Query: 378 VVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGNSIPISQVRDDV 557
           +VAV I+    S+ A+ WA+D  V +G+ +  L+HV           G S  +       
Sbjct: 20  LVAVCIDKDKNSQNALKWAIDSLVQKGQTIV-LVHV--------NTKGTSGGVED----- 65

Query: 558 AAAFIKEIEWQTSQKLLPYKALCTKRKVEVEVQQIESDNIVNAI 689
           AA F +  +       +P++  CT++ +  +   ++  ++  +I
Sbjct: 66  AAGFKQPTDPHMKDLFVPFRCFCTRKDINCKDVVLDEHDVAKSI 109



>gb:AY664416_1620633 Zea mays cultivar Mo17 locus bz, complete
           sequence.
          Length = 767

 Score = 33.5 bits (75), Expect = 3.6
 Identities = 23/104 (22%), Positives = 47/104 (45%)
 Frame = +3

Query: 378 VVAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRPVISAVPTPMGNSIPISQVRDDV 557
           +VAV I+    S+ A+ WA+D  V +G+ +  L+HV           G S  +       
Sbjct: 20  LVAVCIDKDKNSQNALKWAIDSLVQKGQTIV-LVHV--------NTKGTSGGVED----- 65

Query: 558 AAAFIKEIEWQTSQKLLPYKALCTKRKVEVEVQQIESDNIVNAI 689
           AA F +  +       +P++  CT++ +  +   ++  ++  +I
Sbjct: 66  AAGFKQPTDPHMKDLFVPFRCFCTRKDINCKDVVLDEHDVAKSI 109



>gb:AP005126_1848240 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBb0041B22.
          Length = 268

 Score = 32.7 bits (73), Expect = 6.2
 Identities = 15/37 (40%), Positives = 24/37 (64%)
 Frame = +3

Query: 381 VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRP 491
           +A+A++   +S YAV WA+  ++  G  +  LLHVRP
Sbjct: 58  IAIAVDLSDESAYAVRWAVANYLRPGDAVI-LLHVRP 93



>gb:AP005126_1848239 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBb0041B22.
          Length = 268

 Score = 32.7 bits (73), Expect = 6.2
 Identities = 15/37 (40%), Positives = 24/37 (64%)
 Frame = +3

Query: 381 VAVAINGKSKSKYAVNWALDKFVPEGKILFKLLHVRP 491
           +A+A++   +S YAV WA+  ++  G  +  LLHVRP
Sbjct: 58  IAIAVDLSDESAYAVRWAVANYLRPGDAVI-LLHVRP 93



>gb:AY095206_1298285 Drosophila melanogaster SD06937 full insert
           cDNA.
          Length = 965

 Score = 32.7 bits (73), Expect = 6.2
 Identities = 14/46 (30%), Positives = 25/46 (54%)
 Frame = +2

Query: 209 NVVFFISCLNASGRTQAIPWFLTFFIHKNLRIKFCREEVFAV*DGW 346
           +VVF   C+NAS R + + +  +   H + R++F  +E     DG+
Sbjct: 303 HVVFHSLCVNASSRPKTLEYIASILRHNDRRVQFASDEKLLARDGF 348



>gb:AE014134_1128972 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003638_1219079 Drosophila melanogaster
           chromosome 2L, section 47 of 83 of the complete
           sequence.>gb:AY094803_1297977 Drosophila melanogaster
           LD24832 full insert cDNA.
          Length = 1217

 Score = 32.7 bits (73), Expect = 6.2
 Identities = 14/46 (30%), Positives = 25/46 (54%)
 Frame = +2

Query: 209 NVVFFISCLNASGRTQAIPWFLTFFIHKNLRIKFCREEVFAV*DGW 346
           +VVF   C+NAS R + + +  +   H + R++F  +E     DG+
Sbjct: 555 HVVFHSLCVNASSRPKTLEYIASILRHNDRRVQFASDEKLLARDGF 600



>sp|O35103|OMD_MOUSE Osteomodulin precursor (Osteoadherin) (OSAD)
           (Keratan sulfate proteoglycan osteomodulin) (KSPG
           osteomodulin).>gb:AB007848_2043386 Mus musculus mRNA for
           osteomodulin, complete cds.
          Length = 423

 Score = 32.7 bits (73), Expect = 6.2
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = -2

Query: 473 LEENLPFWNKFVQCPVHCIFAFRFPIDSYCNNQR 372
           +E  +PF+N  + C   C     FP   YC+N++
Sbjct: 49  IEYGVPFYNNILGCAKECFCPTNFPTSMYCDNRK 82



>gb:BT004026_1637140 Arabidopsis thaliana clone RAFL15-12-A17
           (R20781) unknown protein (At3g58450) mRNA, complete
           cds.>gb:BT005060_1638006 Arabidopsis thaliana clone
           U20781 unknown protein (At3g58450) mRNA, complete cds.
          Length = 204

 Score = 32.3 bits (72), Expect = 8.1
 Identities = 30/109 (27%), Positives = 40/109 (36%), Gaps = 10/109 (9%)
 Frame = +3

Query: 375 LVVAVAINGKSKSKYAVNWALDKFV----------PEGKILFKLLHVRPVISAVPTPMGN 524
           L V VAI+    S  A+ WA+D              EG +L  LLHV P       P G 
Sbjct: 30  LKVMVAIDESKNSFDALEWAVDHLRVVISAEPETGQEGGLL-TLLHVHPTYLQYIYPSGG 88

Query: 525 SIPISQVRDDVAAAFIKEIEWQTSQKLLPYKALCTKRKVEVEVQQIESD 671
           +       D V     K  E  T+        +C  + V+ E   +E D
Sbjct: 89  TASAVYATDSVPEPMRKAREESTTNLFTRALEICRGKMVKTETMILEGD 137



>pir|T45665|T45665 hypothetical protein F14P22.40 - Arabidopsis
           thaliana>gb:ATF14P22_1548613 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F14P22.
          Length = 174

 Score = 32.3 bits (72), Expect = 8.1
 Identities = 30/109 (27%), Positives = 40/109 (36%), Gaps = 10/109 (9%)
 Frame = +3

Query: 375 LVVAVAINGKSKSKYAVNWALDKFV----------PEGKILFKLLHVRPVISAVPTPMGN 524
           L V VAI+    S  A+ WA+D              EG +L  LLHV P       P G 
Sbjct: 30  LKVMVAIDESKNSFDALEWAVDHLRVVISAEPETGQEGGLL-TLLHVHPTYLQYIYPSGG 88

Query: 525 SIPISQVRDDVAAAFIKEIEWQTSQKLLPYKALCTKRKVEVEVQQIESD 671
           +       D V     K  E  T+        +C  + V+ E   +E D
Sbjct: 89  TASAVYATDSVPEPMRKAREESTTNLFTRALEICRGKMVKTETMILEGD 137



>pir|T18131|T18131 probable ribonucleoside-diphosphate reductase (EC
           1.17.4.1) large chain - Chlorella virus
           PBCV-1>gb:PBU42580_2446086 Paramecium bursaria Chlorella
           virus 1, complete genome.
          Length = 771

 Score = 32.3 bits (72), Expect = 8.1
 Identities = 31/104 (29%), Positives = 47/104 (45%), Gaps = 2/104 (1%)
 Frame = -1

Query: 561 LQHHRVLVK*ESNSPWELELQKSQVERVRA*RESSLLEQICPVPSSLHICFSISH**LLQ 382
           LQ+H   V  +SN  W     +   ERV+    +SLL  + P  S+  IC S+       
Sbjct: 577 LQYHMWDVTPKSNLDW-----RGLEERVKKGVRNSLLTALMPTASTAQICGSVE----AF 627

Query: 381 QPKRAKGASRLDHPSQTAKTSS--LQNFILRFLWMKNVKNQGIA 256
           +P  +   SR     +    +S  ++  I R  W +N+KNQ IA
Sbjct: 628 EPITSNLYSRRTLAGEFPVVNSYLVRELIERGTWSENMKNQIIA 671


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 753,567,568
Number of Sequences: 1806583
Number of extensions: 15929019
Number of successful extensions: 38939
Number of sequences better than 10.0: 33
Number of HSP's better than 10.0 without gapping: 37580
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 38911
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 39798953635
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)