BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig5666
         (1106 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY084729_1569815 Arabidopsis thaliana clone 116131 mRNA, comp...   294   2e-78   
pir|D96575|D96575 probable chalcone isomerase, 94270-95700 [impo...   294   2e-78   Arabidopsis thaliana [mouse-ear cress]
gb:T3F20_1724042 Sequence of BAC T3F20 from Arabidopsis thaliana...   260   3e-68   
gb:AP005651_1855503 Oryza sativa (japonica cultivar-group) genom...   205   2e-51   
gb:AY063786_1565741 Arabidopsis thaliana unknown protein (At5g05...    74   5e-12   
gb:AB010692_1511099 Arabidopsis thaliana genomic DNA, chromosome...    74   5e-12   
sp|Q42663|CFI_CALCH|CFI_CALCH Chalcone--flavonone isomerase (EC 5.5.1.6) (...    72   2e-11   Callistephus chinensis [Chinese aster]
sp|P11650|CFIA_PETHY|CFIA_PETHY Chalcone--flavonone isomerase A (EC 5.5.1.6...    71   3e-11   Petunia x hybrida [garden petunia]
pir|JQ0962|ISPJA1 chalcone isomerase (EC 5.5.1.6) A - garden pet...    70   8e-11   
gb:AF233637_1779471 Petunia x hybrida chalcone isomerase A (chiA...    69   2e-10   
gb:AB011794_1511575 Citrus sinensis mRNA for chalcone isomerase,...    67   5e-10   
gb:AF509335_1807039 Saussurea medusa chalcone isomerase (CHI) mR...    66   1e-09   
gb:AB054801_1521400 Lotus corniculatus var. japonicus mRNA for p...    65   2e-09   
gb:AB054802_1521401 Lotus corniculatus var. japonicus mRNA for p...    65   3e-09   
sp|P51117|CFI_VITVI|CFI_VITVI Chalcone--flavonone isomerase (EC 5.5.1.6) (...    64   4e-09   Vitis vinifera
gb:AB078955_1523807 Eustoma grandiflorum EgCHI mRNA for chalcone...    64   7e-09   
gb:AB080768_1524009 Ipomoea batatas chi mRNA for chalcone isomer...    61   5e-08   
sp|P11651|CFIB_PETHY|CFIB_PETHY Chalcone--flavonone isomerase B (EC 5.5.1.6...    61   5e-08   Petunia x hybrida [garden petunia]
gb:LJA548840_1684985 Lotus japonicus mRNA for chalcone isomerase...    60   6e-08   
gb:AY700850_1623610 Allium cepa chalcone isomerase (CHI) gene, C...    60   8e-08   
sp|O22604|CFI_IPOPU|CFI_IPOPU Chalcone--flavonone isomerase (EC 5.5.1.6) (...    60   8e-08   Ipomoea purpurea
gb:AY541034_1612617 Allium cepa chalcone isomerase mRNA, complet...    60   1e-07   
gb:AB073787_1523219 Lotus corniculatus var. japonicus mRNA for c...    59   1e-07   
gb:AB037396_1519131 Ipomoea batatas chi mRNA for chalcone isomer...    59   1e-07   
gb:AY700851_1623611 Allium cepa chalcone isomerase (CHI) gene, C...    59   2e-07   
sp|Q9LKC3|CHI_ARALP|CHI_ARALP Chalcone--flavonone isomerase (EC 5.5.1.6) (...    57   5e-07   
sp|O65333|CFI_ELAUM|CFI_ELAUM Chalcone--flavonone isomerase (EC 5.5.1.6) (...    57   5e-07   Elaeagnus umbellata [aki-gumi]
gb:ATH287311_1552297 Arabidopsis thaliana chi gene for chalcone ...    57   7e-07   
pir|JQ1687|JQ1687 chalcone isomerase (EC 5.5.1.6) - Arabidopsis ...    57   7e-07   Arabidopsis thaliana [mouse-ear cress]
sp|P41088|CFI_ARATH|CFI_ARATH Chalcone--flavonone isomerase (EC 5.5.1.6) (...    57   7e-07   Arabidopsis thaliana [mouse-ear cress]
gb:ATH287300_1552286 Arabidopsis thaliana chi gene for chalcone ...    57   9e-07   
sp|O22651|CFI_RAPSA|CFI_RAPSA Chalcone--flavonone isomerase (EC 5.5.1.6) (...    55   3e-06   Raphanus sativus
gb:MSCHI10_1687080 Malus sp. CHI mRNA for chalcone isomerase (pR...    54   4e-06   
pir|S29554|S29554 chalcone isomerase (EC 5.5.1.6) - apple tree (...    54   4e-06   Malus sp.
sp|Q43056|CFI_PUELO|CFI_PUELO Chalcone--flavonone isomerase (EC 5.5.1.6) (...    54   4e-06   Pueraria montana var. lobata [kudzu]
gb:AF276302_1782637 Glycine max chalcone isomerase (CHI) mRNA, c...    53   1e-05   
sp|P28012|CFI1_MEDSA|CFI1_MEDSA Chalcone--flavonone isomerase 1 (EC 5.5.1.6...    53   1e-05   Medicago sativa [alfalfa]
gb:MSCHI5_1687081 Malus sp. CHI mRNA for chalcone isomerase (pRA...    53   1e-05   
pir|S29555|S29555 chalcone isomerase (EC 5.5.1.6) - apple tree (...    53   1e-05   Malus sp.
sp|P14298|CFI_PHAVU|CFI_PHAVU Chalcone--flavonone isomerase (EC 5.5.1.6) (...    52   3e-05   Phaseolus vulgaris [French bean]
gb:AB011474_1511366 Arabidopsis thaliana genomic DNA, chromosome...    51   4e-05   
sp|Q43754|CFI_DIACA|CFI_DIACA Chalcone--flavonone isomerase (EC 5.5.1.6) (...    51   4e-05   Dianthus caryophyllus [carnation]
sp|P28013|CFI2_MEDSA|CFI2_MEDSA Chalcone--flavonone isomerase 2 (EC 5.5.1.6...    51   5e-05   Medicago sativa [alfalfa]
gb:AP004846_1845879 Oryza sativa (japonica cultivar-group) genom...    50   6e-05   
gb:AE017341_1754397 Cryptococcus neoformans var. neoformans JEC2...    50   6e-05   
gb:PVCHALIS_1702923 Phaseolus vulgaris gene for chalcone isomerase.    49   2e-04   
pir|S14705|S14705 chalcone isomerase (EC 5.5.1.6) - kidney bean ...    49   2e-04   Phaseolus vulgaris [French bean]
gb:BT005236_1638176 Arabidopsis thaliana At2g26310 mRNA, complet...    48   4e-04   
gb:AY231415_1591603 Arabidopsis thaliana hypothetical protein (A...    48   4e-04   
gb:AP004991_1846848 Oryza sativa (japonica cultivar-group) genom...    45   0.002   
gb:AY231416_1591604 Arabidopsis thaliana hypothetical protein (A...    45   0.003   
gb:AB087208_1524598 Raphanus sativus chi mRNA for chalcone flava...    44   0.006   
pir|T07657|T07657 chalcone isomerase (EC 5.5.1.6) - soybean (fra...    44   0.008   Glycine max [soybeans]
sp|O81980|CFI_SOYBN|CFI_SOYBN Chalcone--flavonone isomerase (EC 5.5.1.6) (...    44   0.008   Glycine max [soybeans]
gb:CR382130_1662992 Yarrowia lipolytica chromosome D of strain C...    42   0.029   
sp|P41089|CFI_PEA|CFI_PEA Chalcone--flavonone isomerase (EC 5.5.1.6) (Ch...    39   0.24    Pisum sativum [garden pea]
sp|O30188|Y048_ARCFU|Y048_ARCFU Hypothetical protein AF0048 precursor.>pir|...    37   0.93    Archaeoglobus fulgidus
gb:AH012458S4_1422490 Canis familiaris transcription factor Tbx4...    36   1.6     
gb:BC076847_2559588 Xenopus laevis MGC83928 protein, mRNA (cDNA ...    35   3.5     
gb:AE016996_374798 Chlamydophila caviae GPIC section 3 of 4 of t...    34   4.6     
gb:AY075134_2075863 Mus musculus T-box 4 (Tbx4) mRNA, complete cds.    34   6.0     
gb:AL592465_2070709 Mouse DNA sequence from clone RP23-36C4 on c...    34   6.0     
gb:CR382138_1670695 Debaryomyces hansenii chromosome F of strain...    34   6.0     
gb:AK028407_1160978 Mus musculus 13 days embryo whole body cDNA,...    34   6.0     
pir|D82628|D82628 hypothetical protein XF1860 [imported] - Xylel...    34   6.0     Xylella fastidiosa
gb:CNS07EGD_1373450 chromosome VI of strain GB-M1 of Encephalito...    33   7.9     


>gb:AY084729_1569815 Arabidopsis thaliana clone 116131 mRNA,
           complete sequence.
          Length = 287

 Score =  294 bits (753), Expect = 2e-78
 Identities = 151/215 (70%), Positives = 180/215 (83%), Gaps = 1/215 (0%)
 Frame = +1

Query: 340 ASSSSVGNAE-YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY 516
           +++SSVGNAE Y EE  T+VKF+RS++LPGC + LSLLGTG+REK FAIIGVKVYAAG Y
Sbjct: 72  SAASSVGNAEDYAEETATSVKFKRSVTLPGCSSPLSLLGTGFREKKFAIIGVKVYAAGYY 131

Query: 517 VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI 696
           VNESIL+ L AW+GRSA E+Q DS LF +IF+A  EKSL IVLVRDVDGKTFWDALDEAI
Sbjct: 132 VNESILSGLSAWKGRSADEIQRDSSLFVSIFQAQAEKSLQIVLVRDVDGKTFWDALDEAI 191

Query: 697 SPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI 876
           SPRIKSPS++D TALSTFR IFQ RPL KG+ I+LTW++ + MLV VSS   P+++DA I
Sbjct: 192 SPRIKSPSSEDTTALSTFRGIFQNRPLNKGSVILLTWINTSNMLVSVSSGGLPTNVDATI 251

Query: 877 ESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL 981
           ES NVTSALFD+F G +PVSP+LK+SVAN L + L
Sbjct: 252 ESGNVTSALFDLFFGDSPVSPTLKSSVANQLAMTL 286



>pir|D96575|D96575 probable chalcone isomerase, 94270-95700
           [imported] - Arabidopsis thaliana>gb:AE005173_893254
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC024260_1539304 Arabidopsis thaliana
           chromosome 1 BAC F22G10 genomic sequence, complete
           sequence.
          Length = 287

 Score =  294 bits (753), Expect = 2e-78
 Identities = 152/215 (70%), Positives = 179/215 (83%), Gaps = 1/215 (0%)
 Frame = +1

Query: 340 ASSSSVGNAE-YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY 516
           +++SSVGNAE Y EE  T+VKF+RS++LPGC + LSLLGTG+REK FAIIGVKVYAAG Y
Sbjct: 72  SAASSVGNAEDYAEETATSVKFKRSVTLPGCSSPLSLLGTGFREKKFAIIGVKVYAAGYY 131

Query: 517 VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI 696
           VNESIL+ L AW GRSA E+Q DS LF +IF+A  EKSL IVLVRDVDGKTFWDALDEAI
Sbjct: 132 VNESILSGLSAWTGRSADEIQRDSSLFVSIFQAQAEKSLQIVLVRDVDGKTFWDALDEAI 191

Query: 697 SPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI 876
           SPRIKSPS++D TALSTFR IFQ RPL KG+ I+LTW++ + MLV VSS   P+++DA I
Sbjct: 192 SPRIKSPSSEDTTALSTFRGIFQNRPLNKGSVILLTWINTSNMLVSVSSGGLPTNVDATI 251

Query: 877 ESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL 981
           ES NVTSALFDVF G +PVSP+LK+SVAN L + L
Sbjct: 252 ESGNVTSALFDVFFGDSPVSPTLKSSVANQLAMTL 286



>gb:T3F20_1724042 Sequence of BAC T3F20 from Arabidopsis thaliana
           chromosome 1, complete sequence.
          Length = 271

 Score =  260 bits (665), Expect = 3e-68
 Identities = 140/215 (65%), Positives = 166/215 (77%), Gaps = 1/215 (0%)
 Frame = +1

Query: 340 ASSSSVGNAE-YVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY 516
           +++SSVGNAE Y EE  T+VKF+RS++LPGC + LSLLGTG+REK FAIIGVKVYAAG Y
Sbjct: 72  SAASSVGNAEDYAEETATSVKFKRSVTLPGCSSPLSLLGTGFREKKFAIIGVKVYAAGYY 131

Query: 517 VNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAI 696
           VNESIL+ L AW GRSA E+Q DS LF +IF+A  EKSL IVLVRDVDGKTFWDALDEAI
Sbjct: 132 VNESILSGLSAWTGRSADEIQRDSSLFVSIFQAQAEKSLQIVLVRDVDGKTFWDALDEAI 191

Query: 697 SPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKI 876
           SPRIKSPS++D TALSTFR IFQ RPL KG+ I+LTW++ + MLV VSS   P+++DA I
Sbjct: 192 SPRIKSPSSEDTTALSTFRGIFQNRPLNKGSVILLTWINTSNMLVSVSSGGLPTNVDATI 251

Query: 877 ESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL 981
           ES                VSP+LK+SVAN L + L
Sbjct: 252 ES----------------VSPTLKSSVANQLAMTL 270



>gb:AP005651_1855503 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OSJNBa0086N11.
          Length = 280

 Score =  205 bits (521), Expect = 2e-51
 Identities = 110/217 (50%), Positives = 152/217 (70%)
 Frame = +1

Query: 331 PRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAG 510
           P AA   +VG+A +V E TTNVKF R +++PG    L +LGTGYREK F    +K+YAA 
Sbjct: 67  PSAAGGGTVGDA-FVIEDTTNVKFPREIAVPGYTEPLVILGTGYREKFF----LKIYAAA 121

Query: 511 LYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE 690
            YV+ SI      WR +   E  + S +F++IFKAP+ KSLSI+LVRDVDGKTF  ALD+
Sbjct: 122 FYVDCSIGVDTMRWREKVGIETFDASSVFDSIFKAPVVKSLSIILVRDVDGKTFVKALDD 181

Query: 691 AISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDA 870
            I+ +IK PSA++E +LSTF+  F GR LK+GT + LTW++P+K+L+ ++ +  P  +DA
Sbjct: 182 IIARQIKKPSAEEEQSLSTFQKTFLGRSLKQGTTVYLTWLEPSKLLISIAGNQDPCQVDA 241

Query: 871 KIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL 981
           +I SA V  AL+D FLG +PVSP+L++S A  LE +L
Sbjct: 242 EITSATVNYALYDGFLGSSPVSPTLRSSTALLLEAIL 278



>gb:AY063786_1565741 Arabidopsis thaliana unknown protein
           (At5g05270) mRNA, complete cds.>gb:AY088019_1573043
           Arabidopsis thaliana clone 40439 mRNA, complete
           sequence.>gb:AY096448_1575992 Arabidopsis thaliana
           unknown protein (At5g05270) mRNA, complete cds.
          Length = 209

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 53/188 (28%), Positives = 91/188 (48%), Gaps = 7/188 (3%)
 Frame = +1

Query: 439 LSLLGTGYREKVFAIIGVKVYAAGLYVNES-ILNKLDAWRGRSAAELQNDSPLFETIFKA 615
           LSLLG G  +     + VK  A G+Y++ S +   LD W+G++  EL  D   F+ +  A
Sbjct: 23  LSLLGQGITDIEIHFLQVKFTAIGVYLDPSDVKTHLDNWKGKTGKELAGDDDFFDALASA 82

Query: 616 PLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSP---SADDETALSTFRTIFQGRPLKKG 786
            +EK + +V+++++ G  +   L+  +  R+        ++ET L      FQ +  K  
Sbjct: 83  EMEKVIRVVVIKEIKGAQYGVQLENTVRDRLAEEDKYEEEEETELEKVVGFFQSKYFKAN 142

Query: 787 TFIVLTWVDPTKMLVCVSSDATPSSID--AKIESANVTSALFDVFL-GRNPVSPSLKASV 957
           +  V+T+    K  +C     T    +   K+E+ANV   +   +L G   VSPS   S+
Sbjct: 143 S--VITYHFSAKDGICEIGFETEGKEEEKLKVENANVVGMMQRWYLSGSRGVSPSTIVSI 200

Query: 958 ANGLEVVL 981
           A+ +  VL
Sbjct: 201 ADSISAVL 208



>gb:AB010692_1511099 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K18I23.
          Length = 205

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 53/188 (28%), Positives = 91/188 (48%), Gaps = 7/188 (3%)
 Frame = +1

Query: 439 LSLLGTGYREKVFAIIGVKVYAAGLYVNES-ILNKLDAWRGRSAAELQNDSPLFETIFKA 615
           LSLLG G  +     + VK  A G+Y++ S +   LD W+G++  EL  D   F+ +  A
Sbjct: 19  LSLLGQGITDIEIHFLQVKFTAIGVYLDPSDVKTHLDNWKGKTGKELAGDDDFFDALASA 78

Query: 616 PLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSP---SADDETALSTFRTIFQGRPLKKG 786
            +EK + +V+++++ G  +   L+  +  R+        ++ET L      FQ +  K  
Sbjct: 79  EMEKVIRVVVIKEIKGAQYGVQLENTVRDRLAEEDKYEEEEETELEKVVGFFQSKYFKAN 138

Query: 787 TFIVLTWVDPTKMLVCVSSDATPSSID--AKIESANVTSALFDVFL-GRNPVSPSLKASV 957
           +  V+T+    K  +C     T    +   K+E+ANV   +   +L G   VSPS   S+
Sbjct: 139 S--VITYHFSAKDGICEIGFETEGKEEEKLKVENANVVGMMQRWYLSGSRGVSPSTIVSI 196

Query: 958 ANGLEVVL 981
           A+ +  VL
Sbjct: 197 ADSISAVL 204



>sp|Q42663|CFI_CALCH Chalcone--flavonone isomerase (EC 5.5.1.6)
           (Chalcone isomerase) (Fragment).>gb:CCCHIMR_1645773
           C.chinensis mRNA for chalcone isomerase.
          Length = 237

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 52/203 (25%), Positives = 94/203 (46%), Gaps = 5/203 (2%)
 Frame = +1

Query: 391 NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWR-GRSA 567
           ++ F  S+  PG   SL L G G R        VK    G+Y+ +  +  L A R G++ 
Sbjct: 14  SIVFPSSVKPPGSTNSLFLGGAGVRGMEIQGNFVKFTGIGVYLEDKAIPLLAAKRKGKTV 73

Query: 568 AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETA 738
           AEL +    F  I   P EK   + ++  + GK + + + E    +   + + +  D T 
Sbjct: 74  AELLDSVEFFRDIVTGPFEKFTQVTMILPLTGKQYSEKVSEMCVGVWKALGTYTDADGTT 133

Query: 739 LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVF 915
           +  F  +F+      G+ I+ T      + +  S D T P + +  +E+  +  A+ +  
Sbjct: 134 IEKFLEVFKDENFLPGSSILFTTSPLGSLTISFSKDGTIPEAANVVLENEKLAQAVIESV 193

Query: 916 LGRNPVSPSLKASVANGLEVVLK 984
           +G+N VSP+ K S+A+ L  ++K
Sbjct: 194 IGKNGVSPATKQSLASRLSDLMK 216



>sp|P11650|CFIA_PETHY Chalcone--flavonone isomerase A (EC 5.5.1.6)
           (Chalcone isomerase A).>pir|S04725|ISPJCA chalcone
           isomerase (EC 5.5.1.6) A - garden
           petunia>gb:PHCHI_1700090 Petunia hybrida mRNA for
           chalcone flavanone isomerase.>gb:PHCHIA_1700091 Petunia
           CHI-A gene for chalcone flavanone isomerase.
          Length = 241

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 53/204 (25%), Positives = 96/204 (47%), Gaps = 6/204 (2%)
 Frame = +1

Query: 391 NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKL-DAWRGRSA 567
           N  F  +++  G   +L L G G+R        VK  A G+Y+ ES +  L + W+G++ 
Sbjct: 14  NYAFAPTVNPAGSTNTLFLAGAGHRGLEIEGKFVKFTAIGVYLEESAIPFLAEKWKGKTP 73

Query: 568 AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETA 738
            EL +    F  +   P EK   + ++  + GK + + + E   A    I + + D+  A
Sbjct: 74  QELTDSVEFFRDVVTGPFEKFTRVTMILPLTGKQYSEKVAENCVAHWKGIGTYTDDEGRA 133

Query: 739 LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVC--VSSDATPSSIDAKIESANVTSALFDV 912
           +  F  +F+      G  I+ T   P  +L       D+   + +A IE+  ++ A+ + 
Sbjct: 134 IEKFLDVFRSETFPPGASIMFTQ-SPLGLLTISFAKDDSVTGTANAVIENKQLSEAVLES 192

Query: 913 FLGRNPVSPSLKASVANGLEVVLK 984
            +G++ VSP+ K SVA  +  +LK
Sbjct: 193 IIGKHGVSPAAKCSVAERVAELLK 216



>pir|JQ0962|ISPJA1 chalcone isomerase (EC 5.5.1.6) A - garden
           petunia (var. V31)
          Length = 241

 Score = 70.1 bits (170), Expect = 8e-11
 Identities = 51/203 (25%), Positives = 96/203 (47%), Gaps = 5/203 (2%)
 Frame = +1

Query: 391 NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKL-DAWRGRSA 567
           N  F  +++  G   +L L G G+R        VK  A G+Y+ ES +  L + W+G++ 
Sbjct: 14  NYVFAPTVNPAGSSNTLFLAGAGHRGLEIQGKFVKFTAIGVYLEESAIPFLAEKWKGKTP 73

Query: 568 AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETA 738
            EL +    F  +   P EK   + ++  + GK + + + E   A    I + + D+  A
Sbjct: 74  EELTDSVEFFRDVVTGPFEKFTRVTMILPLTGKQYSEKVAENCVAHWKGIGTYTDDEGRA 133

Query: 739 LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSD-ATPSSIDAKIESANVTSALFDVF 915
           +  F  +F+      G  I+ T      + +  + D +   + +A IE+  ++ A+ +  
Sbjct: 134 IEKFLDVFRSETFPPGASIMFTQSPLGSLTISFAKDDSLTGTANAVIENKQLSEAVLESI 193

Query: 916 LGRNPVSPSLKASVANGLEVVLK 984
           +G++ VSP+ K SVA  +  +LK
Sbjct: 194 IGKHGVSPAAKCSVAERVAELLK 216



>gb:AF233637_1779471 Petunia x hybrida chalcone isomerase A (chiA)
           mRNA, complete cds.
          Length = 241

 Score = 68.9 bits (167), Expect = 2e-10
 Identities = 52/204 (25%), Positives = 95/204 (46%), Gaps = 6/204 (2%)
 Frame = +1

Query: 391 NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKL-DAWRGRSA 567
           N  F  +++  G   +L L G G+R        VK  A G+Y+ ES +  L + W+G++ 
Sbjct: 14  NYAFAPTVNPAGSTNTLFLAGAGHRGLEIEGKFVKFTAIGVYLEESAIPFLAEKWKGKTP 73

Query: 568 AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETA 738
            EL +    F  +   P EK   +  +  + GK + + + E   A    I + + D+  A
Sbjct: 74  QELTDSVEFFRDVVTGPFEKFTRVTTILPLTGKQYSEKVAENCVAHWKGIGTYTDDEGRA 133

Query: 739 LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVC--VSSDATPSSIDAKIESANVTSALFDV 912
           +  F  +F+      G  I+ T   P  +L       D+   + +A IE+  ++ A+ + 
Sbjct: 134 IEKFLDVFRSETFPPGASIMFT-QSPLGLLTISFAKDDSVTGTANAVIENKQLSEAVLES 192

Query: 913 FLGRNPVSPSLKASVANGLEVVLK 984
            +G++ VSP+ K +VA  +  +LK
Sbjct: 193 IIGKHGVSPAAKCNVAERVAELLK 216



>gb:AB011794_1511575 Citrus sinensis mRNA for chalcone isomerase,
           complete cds.
          Length = 222

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 55/202 (27%), Positives = 91/202 (45%), Gaps = 5/202 (2%)
 Frame = +1

Query: 391 NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSA 567
           NV F  S+  PG   S  L G G R        VK  A G+Y+ +  +  L   W+G++A
Sbjct: 14  NVTFTPSVQPPGSTKSHFLGGAGERGLEIEGKFVKFTAIGVYLEDDAVPLLAGKWKGKTA 73

Query: 568 AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETA 738
            EL      F  +   P EK + + ++  + G  + + + E   AI       +  +  A
Sbjct: 74  EELTESVEFFRDVVTGPFEKFMKVTMILPLTGAQYSEKVAENCIAIWKFFGIYTDAEAKA 133

Query: 739 LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVF 915
           +  F  +F+      G+ I+ T   P  + +  S D + P    A IES  ++ A+ +  
Sbjct: 134 IEKFTEVFKDEIFPPGSSILFTQ-SPGSLTISFSKDGSIPKDGVAVIESNLLSEAVLESM 192

Query: 916 LGRNPVSPSLKASVANGLEVVL 981
           +G+N VSP+ K S+A  L  +L
Sbjct: 193 IGKNGVSPAAKKSLAERLSALL 214



>gb:AF509335_1807039 Saussurea medusa chalcone isomerase (CHI) mRNA,
           complete cds.
          Length = 232

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 48/198 (24%), Positives = 88/198 (44%), Gaps = 5/198 (2%)
 Frame = +1

Query: 391 NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSA 567
           ++ F  S+  PG  T+L L G G R        VK    G+Y+ +  +  L   W+G++A
Sbjct: 14  SIVFPPSVKPPGATTTLFLGGAGVRGMEIQGNFVKFTGIGVYLEDKAIPSLAVKWKGKTA 73

Query: 568 AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISP--RIKSPSADDETA- 738
           AEL +    +  I   P EK   + ++  + GK + + + E      + +    D +TA 
Sbjct: 74  AELTDSVQFYRDIVTGPFEKFSQVTMILPLTGKQYSEKVSEMCIGVWKAQGTYTDADTAT 133

Query: 739 LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVF 915
           +  F  +F+      G+ I+ T      + +  S D   P +    +E+  +   + +  
Sbjct: 134 IEKFLEVFKDENFLPGSSILFTTSPTGSLTISFSKDGNIPEAATVVLENRKLAQTVIESV 193

Query: 916 LGRNPVSPSLKASVANGL 969
           +G + VSP  K S+A+ L
Sbjct: 194 IGEHGVSPEAKQSLASRL 211



>gb:AB054801_1521400 Lotus corniculatus var. japonicus mRNA for
           putative chalcone isomerase, complete cds, clone:LjCHI1.
          Length = 226

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 52/202 (25%), Positives = 90/202 (44%), Gaps = 5/202 (2%)
 Frame = +1

Query: 391 NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSA 567
           N++F  S++ P    S  L G G R        +K    G+Y+ ++ ++ L   W+G+S+
Sbjct: 16  NLQFPASVTSPATAKSYFLGGAGERGLTIEGKFIKFTGIGVYLEDTAVDSLATKWKGKSS 75

Query: 568 AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE---TA 738
            ELQ+    F  I  +P EK +    +R + G  +   + E     +KS     E   TA
Sbjct: 76  QELQDSLDFFRDIISSPSEKLIRGSKLRPLSGVEYSRKVMENCVAHMKSAGTYGEAEATA 135

Query: 739 LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVF 915
           +  F   F+      G+ +        K+ +  S D T P      IE+  ++ A+ +  
Sbjct: 136 IEKFAEAFRKVDFPPGSSVFYRQSTDGKLGLSFSLDDTIPEEEAVVIENKALSEAVLETM 195

Query: 916 LGRNPVSPSLKASVANGLEVVL 981
           +G + VSP LK  +A  L +V+
Sbjct: 196 IGEHAVSPDLKRCLAERLPIVM 217



>gb:AB054802_1521401 Lotus corniculatus var. japonicus mRNA for
           putative chalcone isomerase, complete cds, clone:LjCHI2.
          Length = 221

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 50/204 (24%), Positives = 95/204 (46%), Gaps = 6/204 (2%)
 Frame = +1

Query: 391 NVKFQRSL-SLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRS 564
           NV F  +L   P    +L L G G R        VK  A G+Y+ ++ +  L   W+G+ 
Sbjct: 13  NVAFPPTLIKPPASANTLFLGGAGERGLHIQDKFVKFTAIGIYLQDTAVPSLAVKWKGKP 72

Query: 565 AAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDET 735
             EL      F  I   P EK + + ++  + G+ + + + E   AI   +   + ++  
Sbjct: 73  VDELTESVQFFRDIVTGPFEKFMQVTMILPLTGQQYSEKVSENCVAIWKHLGIYTDEEGK 132

Query: 736 ALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDV 912
           A+  F ++F+ +    G+ I+ T +    + +  S D + P    A I++  ++ A+ + 
Sbjct: 133 AIDKFVSVFKDQTFPPGSSILFTVLPKGSLAISFSKDGSIPEVESAVIDNKLLSEAVLES 192

Query: 913 FLGRNPVSPSLKASVANGLEVVLK 984
            +G + VSP+ K S+A+ L  + K
Sbjct: 193 MIGAHGVSPAAKQSLASRLSELFK 216



>sp|P51117|CFI_VITVI Chalcone--flavonone isomerase (EC 5.5.1.6)
           (Chalcone isomerase).>gb:VVCHI_1727476 V.vinifera CHI
           mRNA for chalcone isomerase.
          Length = 234

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 53/195 (27%), Positives = 84/195 (43%), Gaps = 5/195 (2%)
 Frame = +1

Query: 391 NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSA 567
           NV F  S+  PG    L L G G R        VK  A G+Y+  S +  L   W+G++ 
Sbjct: 14  NVLFPPSVKPPGSTNDLFLGGAGVRGLEIQGKFVKFTAIGVYLENSAVPTLAVKWKGKTV 73

Query: 568 AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPS--ADDET-A 738
            EL +    F  +   P EK   +  +  + G+ + D + E      KS     D E  A
Sbjct: 74  EELADSVDFFRDVVTGPFEKFTKVTTILPLTGRQYSDKVSENCVAFWKSVGIYTDAEAKA 133

Query: 739 LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVF 915
           +  F  + +      G  I+ T      + +  S D + P   +A IE+  +T A+ +  
Sbjct: 134 IEKFNEVLKDETFPPGNSILFTHSPLGALTMSFSKDGSLPEVGNAVIENKLLTEAVLESI 193

Query: 916 LGRNPVSPSLKASVA 960
           +G++ VSP  K S+A
Sbjct: 194 IGKHGVSPEAKKSLA 208



>gb:AB078955_1523807 Eustoma grandiflorum EgCHI mRNA for chalcone
           isomerase, complete cds.
          Length = 217

 Score = 63.5 bits (153), Expect = 7e-09
 Identities = 48/198 (24%), Positives = 89/198 (44%), Gaps = 4/198 (2%)
 Frame = +1

Query: 400 FQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSAAEL 576
           F  +++ P    S  L G G R        VK  A G+Y++E+ +  L   W+G++A EL
Sbjct: 17  FPPTITPPASTKSFLLGGAGVRGLEIGGNFVKFTAIGIYLDETAIPWLAGKWKGKTAEEL 76

Query: 577 QNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSP---SADDETALST 747
            +    F  I   P EK   + L+  + G+ +   + E  + + K+    +  D  A+  
Sbjct: 77  ADSVDFFADIITGPFEKFTQVTLILPLTGQQYSGKVSENCTAQWKAAGVYTPADGKAIEK 136

Query: 748 FRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRN 927
           F  +F+ +    G  I+      +  +    +   P + +A IE+  ++ A+ +  +G  
Sbjct: 137 FLQVFEPQSFSPGDSILFMHSPESLTISFGKAGDIPETSNAVIENKKLSEAVIESVIGEK 196

Query: 928 PVSPSLKASVANGLEVVL 981
            VSP+ K S+A  +  VL
Sbjct: 197 GVSPAAKKSLATRIAHVL 214



>gb:AB080768_1524009 Ipomoea batatas chi mRNA for chalcone
           isomerase, complete cds.
          Length = 243

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 53/200 (26%), Positives = 83/200 (41%), Gaps = 5/200 (2%)
 Frame = +1

Query: 400 FQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSAAEL 576
           F  +   PG   +L L G G R        VK  A G+Y+    +  L   W G+SA EL
Sbjct: 17  FPATAKPPGTAKTLILGGAGARGLNIDGKFVKFTAIGVYLEADAVPSLAVKWNGKSAEEL 76

Query: 577 QNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPS--ADDET-ALST 747
            +    F  I   P EK   I ++  + GK + + + E      K+     D E+ A+  
Sbjct: 77  TDSVQFFRDIVTGPFEKLTRITMILPLSGKQYSEKVSENCVAFWKAAGMYGDAESKAIEK 136

Query: 748 FRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVFLGR 924
           F  +F  +    G  I  T      + +  S + + P    A IE+  ++ A+ +  +G 
Sbjct: 137 FNDVFSDQMFPPGASIFFTQSPHGSLTISFSKEGSMPEIASAVIENKPLSEAVLESIIGS 196

Query: 925 NPVSPSLKASVANGLEVVLK 984
             VSP  K S+A  L  + K
Sbjct: 197 KGVSPEAKQSLAVRLSELFK 216



>sp|P11651|CFIB_PETHY Chalcone--flavonone isomerase B (EC 5.5.1.6)
           (Chalcone isomerase B).>pir|S04726|ISPJCB chalcone
           isomerase (EC 5.5.1.6) B - garden
           petunia>gb:PHCHIB_1700092 Petunia CHI-B gene for
           chalcone flavanone isomerase.
          Length = 220

 Score = 60.8 bits (146), Expect = 5e-08
 Identities = 50/203 (24%), Positives = 86/203 (42%), Gaps = 5/203 (2%)
 Frame = +1

Query: 391 NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKL-DAWRGRSA 567
           N  F  ++  P    +L L G G+R        VK    G+Y+ ES +  L   W+G+SA
Sbjct: 14  NYVFPPTVKPPASTKTLFLGGAGHRGLDVEGKFVKFTVIGVYLEESAVQFLAPKWKGKSA 73

Query: 568 AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDET---A 738
            EL +    F  I   P EK   +  +  + GK F + + E      K+     +    A
Sbjct: 74  EELIHSVDFFRDIVTGPFEKFTRVRFILPLTGKQFSEKVAENCVAHWKATGTYSDAGSRA 133

Query: 739 LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSI-DAKIESANVTSALFDVF 915
           +  F  + +      G  I+ T      + +  + D + S   +A IE+   + A+ +  
Sbjct: 134 IEKFLNVVKSETFLPGASILFTQSPLGSLTISFTKDDSISEAGNAVIENKQFSEAVLETI 193

Query: 916 LGRNPVSPSLKASVANGLEVVLK 984
           +G + VSP+ K S+A  +  + K
Sbjct: 194 IGEHGVSPAAKCSIAARMSELFK 216



>gb:LJA548840_1684985 Lotus japonicus mRNA for chalcone isomerase
           (chi gene).
          Length = 211

 Score = 60.5 bits (145), Expect = 6e-08
 Identities = 49/191 (25%), Positives = 84/191 (43%), Gaps = 5/191 (2%)
 Frame = +1

Query: 391 NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSA 567
           N++F  S++ P    S  L G G R        +K    G+Y+ ++ ++ L   W+G+S+
Sbjct: 16  NLQFPASVTSPATAKSYFLGGAGERGLTIEGKFIKFTGIGVYLEDTAVDSLATKWKGKSS 75

Query: 568 AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE---TA 738
            ELQ+    F  I  +P EK +    +R + G  +   + E     +KS     E   TA
Sbjct: 76  QELQDSLDFFRDIISSPSEKLIRGSKLRPLSGVEYSRKVMENCVAHMKSAGTYGEAEATA 135

Query: 739 LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVF 915
           +  F   F+      G+ +        K+ +  S D T P      IE+  ++ A+ +  
Sbjct: 136 IEKFAEAFRKVDFPPGSSVFYRQSTDGKLGLSFSLDDTIPEEEAVVIENKALSEAVLETM 195

Query: 916 LGRNPVSPSLK 948
           +G + VSP LK
Sbjct: 196 IGEHAVSPDLK 206



>gb:AY700850_1623610 Allium cepa chalcone isomerase (CHI) gene,
           CHI-b allele, complete cds.
          Length = 226

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 46/192 (23%), Positives = 84/192 (43%), Gaps = 5/192 (2%)
 Frame = +1

Query: 421 PGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVN-ESILNKLDAWRGRSAAELQNDSPLF 597
           PG   +  L G G R        +   A G+Y+  +SI    D W+G++  EL      F
Sbjct: 21  PGSSKTHFLGGAGVRGLEIGGKFIAFTAIGIYLETDSIPFLADKWKGKTGEELAGSLDFF 80

Query: 598 ETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETALSTFRTIFQG 768
             I   P EK  ++ ++  + G+ + + + E   A    I   +  + +A+  F+  F+ 
Sbjct: 81  RDICTGPFEKFTNVTMILPLTGEQYSEKVTENCVAYWKAIGIYTDAEASAVDKFKQAFKP 140

Query: 769 RPLKKGTFIVLTWVDPTKMLVCVSSDA-TPSSIDAKIESANVTSALFDVFLGRNPVSPSL 945
                G+ I+ T      + +  S D   P      IE+  +T A+ +  +G + VSP+ 
Sbjct: 141 ESFPPGSSILFTHTPSGTLKIAFSKDGLVPKDEGVLIENKALTQAVLESIIGEHGVSPAA 200

Query: 946 KASVANGLEVVL 981
           K S+A+ L  ++
Sbjct: 201 KLSIASRLSEIM 212



>sp|O22604|CFI_IPOPU Chalcone--flavonone isomerase (EC 5.5.1.6)
           (Chalcone isomerase).>pir|T08006|T08006 chalcone
           isomerase (EC 5.5.1.6) - common
           morning-glory>gb:AF028238_1762337 Ipomoea purpurea
           chalcone isomerase (CHI-FL1) mRNA, complete cds.
          Length = 241

 Score = 60.1 bits (144), Expect = 8e-08
 Identities = 52/192 (27%), Positives = 80/192 (41%), Gaps = 5/192 (2%)
 Frame = +1

Query: 400 FQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSAAEL 576
           F  ++  PG   +L L G G R        VK  A G+Y+    +  L   W G+S  EL
Sbjct: 17  FPATVKPPGTAKTLILGGAGARGLNIDGKFVKFTAIGVYLEADAVPSLAVKWNGKSVEEL 76

Query: 577 QNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPS--ADDET-ALST 747
            +    F  I   P EK   I ++  + GK + + + E      K+     D E+ A+  
Sbjct: 77  TDSVQFFRDIVTGPFEKLTRITMILPLSGKQYSEKVTENCVAFWKAAGMYGDAESKAIDK 136

Query: 748 FRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVFLGR 924
           F  +F  +    G  I  T      + V  S D + P    A IE+  ++ A+ +  +G 
Sbjct: 137 FNDVFSDQMFPPGASIFFTQSPLGSLTVSFSKDGSMPEIASAVIENKPLSEAVLESIIGS 196

Query: 925 NPVSPSLKASVA 960
             VSP  K S+A
Sbjct: 197 KGVSPEAKQSLA 208



>gb:AY541034_1612617 Allium cepa chalcone isomerase mRNA, complete
           cds.>gb:AY700852_1623612 Allium cepa chalcone isomerase
           (CHI) gene, CHI-h allele, complete cds.
          Length = 226

 Score = 59.7 bits (143), Expect = 1e-07
 Identities = 46/192 (23%), Positives = 86/192 (44%), Gaps = 5/192 (2%)
 Frame = +1

Query: 421 PGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVN-ESILNKLDAWRGRSAAELQNDSPLF 597
           PG   +  L G G R        +   A G+Y+  +SI    D W+G++  EL      F
Sbjct: 21  PGSSKTHFLGGAGVRGLEIGGKFIAFTAIGIYLETDSIPFLADKWKGKTGEELAGSLDFF 80

Query: 598 ETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETALSTFRTIFQG 768
             I   P EK  ++ ++  + G+ + + + E   A    I   +  + +A+  F+  F+ 
Sbjct: 81  RDICTGPFEKFTNVTMILPLTGEQYSEKVTENCVAYWKAIGIYTDAEASAVDKFKQAFKP 140

Query: 769 RPLKKGTFIVLTWVDPTKMLVCVSSDATPSSID-AKIESANVTSALFDVFLGRNPVSPSL 945
                G+ I+ T      + +  S D + S  +   IE+  +T A+ +  +G + VSP+ 
Sbjct: 141 ESFPPGSSILFTHTPSGTLKIAFSKDGSVSKDEGVLIENKALTQAVLESIIGEHGVSPAA 200

Query: 946 KASVANGLEVVL 981
           K S+A+ L  ++
Sbjct: 201 KLSIASRLSEIM 212



>gb:AB073787_1523219 Lotus corniculatus var. japonicus mRNA for
           chalcone isomerase, complete cds.
          Length = 225

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 49/202 (24%), Positives = 86/202 (42%), Gaps = 5/202 (2%)
 Frame = +1

Query: 391 NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSA 567
           N++F  S++ P    S  L G G R        +K    G+Y+ +  ++ L   W+G+S+
Sbjct: 15  NLQFPASITSPATAKSYFLGGAGERGLTIEGKFIKFTGLGVYLEDKTVDSLATKWKGKSS 74

Query: 568 AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDE---TA 738
            EL +    +  I  +P EK +    +R + G  +   + E     +KS     E    A
Sbjct: 75  QELLDSLDFYRDIISSPSEKLIRGSKLRPLSGVEYSRKVMENCVAHMKSTGTYGEAEAAA 134

Query: 739 LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVF 915
           +  F   F+      G+ +        ++ +  S D T P      IE+  ++ A+ +  
Sbjct: 135 IGKFAEAFRNLDFPPGSSVFYRQSPDGELGLSFSPDDTLPEKEAVVIENKALSEAVLETM 194

Query: 916 LGRNPVSPSLKASVANGLEVVL 981
           +G + VSP LK  +A  L  VL
Sbjct: 195 IGEHAVSPDLKRCLAERLPAVL 216



>gb:AB037396_1519131 Ipomoea batatas chi mRNA for chalcone
           isomerase, partial cds.
          Length = 242

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 53/200 (26%), Positives = 83/200 (41%), Gaps = 5/200 (2%)
 Frame = +1

Query: 400 FQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSAAEL 576
           F  +   PG   +L L G G R        VK  A G+Y+    +  L   W G+SA EL
Sbjct: 16  FPATAKPPGTAKTLILGGAGARGLNIDGKFVKFTAIGVYLEADAVPSLAVKWNGKSAEEL 75

Query: 577 QNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPS--ADDET-ALST 747
            +    F  I   P EK   I ++  + GK + + + E      K+     D E+ A+  
Sbjct: 76  TDSVQFFRDIVTGPFEKLTRITMILPLSGKQYSEKVSENCVAFWKAAGIYGDAESKAIEK 135

Query: 748 FRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVFLGR 924
           F  +F  +    G  I  T      + +  S + + P    A IE+  ++ A+ +  +G 
Sbjct: 136 FNDVFSDQMFPPGASIFFTQSPLGWLTISFSKEGSMPEIASAVIENKPLSEAVLESIIGS 195

Query: 925 NPVSPSLKASVANGLEVVLK 984
             VSP  K S+A  L  + K
Sbjct: 196 KGVSPEAKQSLAVRLSELFK 215



>gb:AY700851_1623611 Allium cepa chalcone isomerase (CHI) gene,
           CHI-t allele, complete cds.
          Length = 226

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 46/192 (23%), Positives = 83/192 (43%), Gaps = 5/192 (2%)
 Frame = +1

Query: 421 PGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVN-ESILNKLDAWRGRSAAELQNDSPLF 597
           PG   +  L G G R        +   A G+Y+  +SI    D W+G++  EL      F
Sbjct: 21  PGSSKTHFLGGAGVRGLEIGGKFIAFTAIGIYLETDSIPFLADKWKGKTGEELAGSLDFF 80

Query: 598 ETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETALSTFRTIFQG 768
             I   P EK  ++ ++  + G+ + + + E   A    I   +  + +A+  F+  F+ 
Sbjct: 81  RDICTGPFEKFTNVTMILPLTGEQYSEKVTENCVAYWKAIGIYTDAEASAVDKFKQAFKP 140

Query: 769 RPLKKGTFIVLTWVDPTKMLVCVSSDA-TPSSIDAKIESANVTSALFDVFLGRNPVSPSL 945
                G+ I+ T      + +  S D   P      IE+  +T A+ +  +G   VSP+ 
Sbjct: 141 ESFPPGSSILFTHTPSGTLKIAFSKDGLVPKDEGVLIENKALTQAVLESIIGEYGVSPAA 200

Query: 946 KASVANGLEVVL 981
           K S+A+ L  ++
Sbjct: 201 KLSIASRLSEIM 212



>sp|Q9LKC3|CHI_ARALP Chalcone--flavonone isomerase (EC 5.5.1.6)
           (Chalcone isomerase).>gb:ALY287322_1819128 Arabidopsis
           lyrata ssp petraea chi gene for chalcone flavanone
           isomerase, exons 1-4.
          Length = 244

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 50/199 (25%), Positives = 85/199 (42%), Gaps = 6/199 (3%)
 Frame = +1

Query: 391 NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSA 567
           +V F  S+  P     L L G G R        V     G+Y+  + +  L   W+G++ 
Sbjct: 21  SVTFDPSVKSPASSNPLFLGGAGVRGLDIQGKFVIFTVIGVYLESNAVPSLSVKWKGKTT 80

Query: 568 AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETA 738
            EL    P F  I     EK + + +   + G+ + + + E   AI   +   +  +  A
Sbjct: 81  EELSESVPFFREIVTGAFEKFIKVTMKLPLTGQQYSEKVTENCVAIWKSLGIYTDCEAKA 140

Query: 739 LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSS--DATPSSIDAKIESANVTSALFDV 912
           +  F  IF+      G+ I+   + PT  L    S  D+ P +  A IE+  +  A+ + 
Sbjct: 141 VEKFLEIFKEETFPPGSSILFA-LSPTGSLTVAFSRDDSIPETGIAVIENKLLAEAVLES 199

Query: 913 FLGRNPVSPSLKASVANGL 969
            +G+N VSP  + S+A  L
Sbjct: 200 IIGKNGVSPGTRLSIAERL 218



>sp|O65333|CFI_ELAUM Chalcone--flavonone isomerase (EC 5.5.1.6)
           (Chalcone isomerase).>gb:AF061808_1765260 Elaeagnus
           umbellata chalcone isomerase mRNA, complete cds.
          Length = 256

 Score = 57.4 bits (137), Expect = 5e-07
 Identities = 50/207 (24%), Positives = 90/207 (43%), Gaps = 5/207 (2%)
 Frame = +1

Query: 376 EEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-W 552
           E    +V F   +  PG   +L L G G R        +K  A G+Y+ ++ +  L   W
Sbjct: 10  EVQVESVIFPPEVKPPGSSKTLFLGGAGVRGIEIQGKFIKFTAIGVYLEDNAVPSLAVKW 69

Query: 553 RGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKS---PSA 723
           +G+SA EL      F  I   P+EK   +  +  + G+ + + + E      KS    S 
Sbjct: 70  KGKSAQELTESVEFFRDIVTGPMEKFTRVTTILPLTGQQYSEKVSENCVAAWKSLGIYSD 129

Query: 724 DDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSA 900
            +  A+  F  IF+ +        + T      + +  S D + P   +A +E+  ++ A
Sbjct: 130 AEAKAIEKFIEIFKDQTFPPAASNLFTQSPLGSLTMSFSKDGSIPEVGNAVLENKLLSEA 189

Query: 901 LFDVFLGRNPVSPSLKASVANGLEVVL 981
           + +  +G++ VSP  K ++A  L  +L
Sbjct: 190 VLESIIGKHGVSPEAKQNLATRLVQLL 216



>gb:ATH287311_1552297 Arabidopsis thaliana chi gene for chalcone
           flavanone isomerase, exons 1-4, ecotype
           Tv1.>gb:ATH492477_1552710 Arabidopsis thaliana chi gene
           for chalcone flavanone isomerase, exons 1-4, population
           variant RV2.>gb:ATH492478_1552711 Arabidopsis thaliana
           chi gene for chalcone flavanone isomerase, exons 1-4,
           population variant RV9.>gb:ATH492479_1552712 Arabidopsis
           thaliana chi gene for chalcone flavanone isomerase,
           exons 1-4, population variant RV10.>gb:ATH492486_1552719
           Arabidopsis thaliana chi gene for chalcone flavanone
           isomerase, exons 1-4, population variant
           TV2.>gb:ATH492487_1552720 Arabidopsis thaliana chi gene
           for chalcone flavanone isomerase, exons 1-4, population
           variant TV6.>gb:ATH492488_1552721 Arabidopsis thaliana
           chi gene for chalcone flavanone isomerase, exons 1-4,
           population variant TV7.>gb:ATH492489_1552722 Arabidopsis
           thaliana chi gene for chalcone flavanone isomerase,
           exons 1-4, population variant TV8.>gb:ATH492490_1552723
           Arabidopsis thaliana chi gene for chalcone flavanone
           isomerase, exons 1-4, population variant
           TV9.>gb:ATH492491_1552724 Arabidopsis thaliana chi gene
           for chalcone flavanone isomerase, exons 1-4, population
           variant TV10.
          Length = 248

 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 51/203 (25%), Positives = 88/203 (43%), Gaps = 6/203 (2%)
 Frame = +1

Query: 391 NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSA 567
           +V F  S+  P     L L G G R        V     G+Y+  + +  L   W+G++ 
Sbjct: 23  SVTFVPSVKSPASSNPLFLGGAGVRGLDIQGKFVIFTVIGVYLEGNAVPSLSVKWKGKTT 82

Query: 568 AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETA 738
            EL    P F  I     EK + + +   + G+ + + + E   AI  ++   +  +  A
Sbjct: 83  EELTESIPFFREIVTGAFEKFIKVTMKLPLTGQQYSEKVTENCVAIWKQLGLYTDCEAKA 142

Query: 739 LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSS--DATPSSIDAKIESANVTSALFDV 912
           +  F  IF+      G+ I+   + PT  L    S  D+ P +  A IE+  +  A+ + 
Sbjct: 143 VEKFLEIFKEETFPPGSSILFA-LSPTGSLTVAFSKDDSIPETGIAVIENKLLAEAVLES 201

Query: 913 FLGRNPVSPSLKASVANGLEVVL 981
            +G+N VSP  + SVA  L  ++
Sbjct: 202 IIGKNGVSPGTRLSVAERLSQLM 224



>pir|JQ1687|JQ1687 chalcone isomerase (EC 5.5.1.6) - Arabidopsis
           thaliana>gb:ATH287305_1552291 Arabidopsis thaliana chi
           gene for chalcone flavanone isomerase, exons 1-4,
           ecotype Ita-0.>gb:ATH287308_1552294 Arabidopsis thaliana
           chi gene for chalcone flavanone isomerase, exons 1-4,
           ecotype Mh-0.>gb:ATH287310_1552296 Arabidopsis thaliana
           chi gene for chalcone flavanone isomerase, exons 1-4,
           ecotype Rv1.>gb:ATH287312_1552298 Arabidopsis thaliana
           chi gene for chalcone flavanone isomerase, exons 1-4,
           ecotype Wlp1.>gb:ATH287315_1552301 Arabidopsis thaliana
           chi gene for chalcone flavanone isomerase, exons 1-4,
           ecotype Gr-5.>gb:ATH287317_1552303 Arabidopsis thaliana
           chi gene for chalcone flavanone isomerase, exons 1-4,
           ecotype Per-1.>gb:ATH492461_1552694 Arabidopsis thaliana
           chi gene for chalcone flavanone isomerase, exons 1-4,
           population variant Wlp2.>gb:ATH492462_1552695
           Arabidopsis thaliana chi gene for chalcone flavanone
           isomerase, exons 1-4, population variant
           Wlp3.>gb:ATH492463_1552696 Arabidopsis thaliana chi gene
           for chalcone flavanone isomerase, exons 1-4, population
           variant Wlp4.>gb:ATH492464_1552697 Arabidopsis thaliana
           chi gene for chalcone flavanone isomerase, exons 1-4,
           population variant Wlp5.>gb:ATH492465_1552698
           Arabidopsis thaliana chi gene for chalcone flavanone
           isomerase, exons 1-4, population variant
           Wlp6.>gb:ATH492466_1552699 Arabidopsis thaliana chi gene
           for chalcone flavanone isomerase, exons 1-4, population
           variant Wlp7.>gb:ATH492467_1552700 Arabidopsis thaliana
           chi gene for chalcone flavanone isomerase, exons 1-4,
           population variant Wlp8.>gb:ATH492468_1552701
           Arabidopsis thaliana chi gene for chalcone flavanone
           isomerase, exons 1-4, population variant
           Wlp9.>gb:ATH492469_1552702 Arabidopsis thaliana chi gene
           for chalcone flavanone isomerase, exons 1-4, population
           variant Wlp10.>gb:ATH492482_1552715 Arabidopsis thaliana
           chi gene for chalcone flavanone isomerase, exons 1-4,
           population variant RV3.>gb:ATH492483_1552716 Arabidopsis
           thaliana chi gene for chalcone flavanone isomerase,
           exons 1-4, population variant RV4.>gb:ATH492484_1552717
           Arabidopsis thaliana chi gene for chalcone flavanone
           isomerase, exons 1-4, population variant
           RV5.>gb:ATH492485_1552718 Arabidopsis thaliana chi gene
           for chalcone flavanone isomerase, exons 1-4, population
           variant RV8.>gb:ATH492495_1552728 Arabidopsis thaliana
           chi gene for chalcone flavanone isomerase, exons 1-4,
           population variant Gran3.>gb:ATH492499_1552732
           Arabidopsis thaliana chi gene for chalcone flavanone
           isomerase, exons 1-4, population variant
           Gran2.>gb:ATH492500_1552733 Arabidopsis thaliana chi
           gene for chalcone flavanone isomerase, exons 1-4,
           population variant Gran5.>gb:ATH492501_1552734
           Arabidopsis thaliana chi gene for chalcone flavanone
           isomerase, exons 1-4, population variant
           Gran7.>gb:ATH492502_1552735 Arabidopsis thaliana chi
           gene for chalcone flavanone isomerase, exons 1-4,
           population variant Gran8.>gb:ATH492503_1552736
           Arabidopsis thaliana chi gene for chalcone flavanone
           isomerase, exons 1-4, population variant
           Gran10.>gb:ATHCFI_1553102 Arabidopsis thaliana chalcone
           isomerase gene, complete cds.>gb:AY086088_1571146
           Arabidopsis thaliana clone 2122 mRNA, complete sequence.
          Length = 246

 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 51/203 (25%), Positives = 88/203 (43%), Gaps = 6/203 (2%)
 Frame = +1

Query: 391 NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSA 567
           +V F  S+  P     L L G G R        V     G+Y+  + +  L   W+G++ 
Sbjct: 23  SVTFVPSVKSPASSNPLFLGGAGVRGLDIQGKFVIFTVIGVYLEGNAVPSLSVKWKGKTT 82

Query: 568 AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETA 738
            EL    P F  I     EK + + +   + G+ + + + E   AI  ++   +  +  A
Sbjct: 83  EELTESIPFFREIVTGAFEKFIKVTMKLPLTGQQYSEKVTENCVAIWKQLGLYTDCEAKA 142

Query: 739 LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSS--DATPSSIDAKIESANVTSALFDV 912
           +  F  IF+      G+ I+   + PT  L    S  D+ P +  A IE+  +  A+ + 
Sbjct: 143 VEKFLEIFKEETFPPGSSILFA-LSPTGSLTVAFSKDDSIPETGIAVIENKLLAEAVLES 201

Query: 913 FLGRNPVSPSLKASVANGLEVVL 981
            +G+N VSP  + SVA  L  ++
Sbjct: 202 IIGKNGVSPGTRLSVAERLSQLM 224



>sp|P41088|CFI_ARATH Chalcone--flavonone isomerase (EC 5.5.1.6)
           (Chalcone isomerase) (TRANSPARENT TESTA 5
           protein).>pir|T47651|T47651 chalcone isomerase -
           Arabidopsis thaliana>gb:ATH287299_1552285 Arabidopsis
           thaliana chi gene for chalcone flavanone isomerase,
           exons 1-4, ecotype Can-0.>gb:ATH287301_1552287
           Arabidopsis thaliana chi gene for chalcone flavanone
           isomerase, exons 1-4, ecotype
           Col-2.>gb:ATH287302_1552288 Arabidopsis thaliana chi
           gene for chalcone flavanone isomerase, exons 1-4,
           ecotype Condhara.>gb:ATH287303_1552289 Arabidopsis
           thaliana chi gene for chalcone flavanone isomerase,
           exons 1-4, ecotype Gran1.>gb:ATH287304_1552290
           Arabidopsis thaliana chi gene for chalcone flavanone
           isomerase, exons 1-4, ecotype
           Grap1.>gb:ATH287306_1552292 Arabidopsis thaliana chi
           gene for chalcone flavanone isomerase, exons 1-4,
           ecotype Kas-1.>gb:ATH287307_1552293 Arabidopsis thaliana
           chi gene for chalcone flavanone isomerase, exons 1-4,
           ecotype Me-0.>gb:ATH287309_1552295 Arabidopsis thaliana
           chi gene for chalcone flavanone isomerase, exons 1-4,
           ecotype Mr-0.>gb:ATH287313_1552299 Arabidopsis thaliana
           chi gene for chalcone flavanone isomerase, exons 1-4,
           ecotype Cvi-0.>gb:ATH287314_1552300 Arabidopsis thaliana
           chi gene for chalcone flavanone isomerase, exons 1-4,
           ecotype Ed1.>gb:ATH287316_1552302 Arabidopsis thaliana
           chi gene for chalcone flavanone isomerase, exons 1-4,
           ecotype Lu1.>gb:ATH287318_1552304 Arabidopsis thaliana
           chi gene for chalcone flavanone isomerase, exons 1-4,
           ecotype Ri-0.>gb:ATH287319_1552305 Arabidopsis thaliana
           chi gene for chalcone flavanone isomerase, exons 1-4,
           ecotype Tul-0.>gb:ATH287320_1552306 Arabidopsis thaliana
           chi gene for chalcone flavanone isomerase, exons 1-4,
           ecotype Yo-0.>gb:ATH287321_1552307 Arabidopsis thaliana
           chi gene for chalcone flavanone isomerase, exons 1-4,
           ecotype Rub-1.>gb:ATH418046_1552546 Arabidopsis thaliana
           mRNA for chalcone flavanone isomerase (cfi
           gene).>gb:ATH492470_1552703 Arabidopsis thaliana chi
           gene for chalcone flavanone isomerase, exons 1-4,
           population variant LU2.>gb:ATH492471_1552704 Arabidopsis
           thaliana chi gene for chalcone flavanone isomerase,
           exons 1-4, population variant LU3.>gb:ATH492472_1552705
           Arabidopsis thaliana chi gene for chalcone flavanone
           isomerase, exons 1-4, population variant
           LU4.>gb:ATH492473_1552706 Arabidopsis thaliana chi gene
           for chalcone flavanone isomerase, exons 1-4, population
           variant LU5.>gb:ATH492474_1552707 Arabidopsis thaliana
           chi gene for chalcone flavanone isomerase, exons 1-4,
           population variant LU6.>gb:ATH492475_1552708 Arabidopsis
           thaliana chi gene for chalcone flavanone isomerase,
           exons 1-4, population variant LU7.>gb:ATH492476_1552709
           Arabidopsis thaliana chi gene for chalcone flavanone
           isomerase, exons 1-4, population variant
           LU8.>gb:ATH492480_1552713 Arabidopsis thaliana chi gene
           for chalcone flavanone isomerase, exons 1-4, population
           variant RV6.>gb:ATH492481_1552714 Arabidopsis thaliana
           chi gene for chalcone flavanone isomerase, exons 1-4,
           population variant RV7.>gb:ATH492492_1552725 Arabidopsis
           thaliana chi gene for chalcone flavanone isomerase,
           exons 1-4, population variant TV3.>gb:ATH492493_1552726
           Arabidopsis thaliana chi gene for chalcone flavanone
           isomerase, exons 1-4, population variant
           TV4.>gb:ATH492494_1552727 Arabidopsis thaliana chi gene
           for chalcone flavanone isomerase, exons 1-4, population
           variant TV5.>gb:ATH492496_1552729 Arabidopsis thaliana
           chi gene for chalcone flavanone isomerase, exons 1-4,
           population variant Gran6.>gb:ATH492497_1552730
           Arabidopsis thaliana chi gene for chalcone flavanone
           isomerase, exons 1-4, population variant
           Gran9.>gb:ATH492498_1552731 Arabidopsis thaliana chi
           gene for chalcone flavanone isomerase, exons 1-4,
           population variant Gran4.>gb:ATT15C9_1554524 Arabidopsis
           thaliana DNA chromosome 3, BAC clone
           T15C9.>gb:BT004265_1637345 Arabidopsis thaliana clone
           RAFL15-29-K13 (R20894) putative chalcone isomerase
           (At3g55120) mRNA, complete cds.>gb:BT005528_1638468
           Arabidopsis thaliana clone U20894 putative chalcone
           isomerase (At3g55120) mRNA, complete cds.
          Length = 246

 Score = 57.0 bits (136), Expect = 7e-07
 Identities = 51/203 (25%), Positives = 88/203 (43%), Gaps = 6/203 (2%)
 Frame = +1

Query: 391 NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSA 567
           +V F  S+  P     L L G G R        V     G+Y+  + +  L   W+G++ 
Sbjct: 23  SVTFVPSVKSPASSNPLFLGGAGVRGLDIQGKFVIFTVIGVYLEGNAVPSLSVKWKGKTT 82

Query: 568 AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETA 738
            EL    P F  I     EK + + +   + G+ + + + E   AI  ++   +  +  A
Sbjct: 83  EELTESIPFFREIVTGAFEKFIKVTMKLPLTGQQYSEKVTENCVAIWKQLGLYTDCEAKA 142

Query: 739 LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSS--DATPSSIDAKIESANVTSALFDV 912
           +  F  IF+      G+ I+   + PT  L    S  D+ P +  A IE+  +  A+ + 
Sbjct: 143 VEKFLEIFKEETFPPGSSILFA-LSPTGSLTVAFSKDDSIPETGIAVIENKLLAEAVLES 201

Query: 913 FLGRNPVSPSLKASVANGLEVVL 981
            +G+N VSP  + SVA  L  ++
Sbjct: 202 IIGKNGVSPGTRLSVAERLSQLM 224



>gb:ATH287300_1552286 Arabidopsis thaliana chi gene for chalcone
           flavanone isomerase, exons 1-4, ecotype Cha-0.
          Length = 246

 Score = 56.6 bits (135), Expect = 9e-07
 Identities = 51/203 (25%), Positives = 88/203 (43%), Gaps = 6/203 (2%)
 Frame = +1

Query: 391 NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSA 567
           +V F  S+  P     L L G G R        V     G+Y+  + +  L   W+G++ 
Sbjct: 23  SVTFVPSVKSPASSNPLFLGGAGVRGLDIQGKFVIFTVIGVYLEGNAVPSLSVKWKGKTT 82

Query: 568 AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETA 738
            EL    P F  I     EK + + +   + G+ + + + E   AI  ++   +  +  A
Sbjct: 83  EELTESIPFFREIVTGAFEKFIKVTMKLPLTGQQYSEKVTENCVAIWKQLGLYTDCEAKA 142

Query: 739 LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSS--DATPSSIDAKIESANVTSALFDV 912
           +  F  IF+      G+ I+   + PT  L    S  D+ P +  A IE+  +  A+ + 
Sbjct: 143 VEKFLEIFKEETFPPGSSILFA-LSPTGSLTVAFSKDDSIPETGIAVIENKLLAEAVLES 201

Query: 913 FLGRNPVSPSLKASVANGLEVVL 981
            +G+N VSP  + SVA  L  ++
Sbjct: 202 VIGKNGVSPGTRLSVAERLSQLM 224



>sp|O22651|CFI_RAPSA Chalcone--flavonone isomerase (EC 5.5.1.6)
           (Chalcone isomerase).>pir|T08032|T08032 chalcone
           isomerase (EC 5.5.1.6) - radish>gb:AF031921_1762613
           Raphanus sativus chalcone isomerase (CHI) mRNA, complete
           cds.
          Length = 247

 Score = 55.1 bits (131), Expect = 3e-06
 Identities = 48/203 (23%), Positives = 84/203 (41%), Gaps = 5/203 (2%)
 Frame = +1

Query: 391 NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSA 567
           +V F  S+  P    +L L G G R        V     G+Y++   +  L   W G++ 
Sbjct: 20  SVTFPPSVISPASSNTLFLGGAGVRGLEIQGKFVIFTVIGVYLDPVSVPSLSVKWEGKTT 79

Query: 568 AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDE---AISPRIKSPSADDETA 738
            EL    P F  I     EK + + +   + G+ + + + E   AI   +   +  +  A
Sbjct: 80  EELTESVPFFREIVIGAFEKFIKVTMKLPLTGQQYSEKVTENCVAIWKSLGIYTDSEAKA 139

Query: 739 LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSD-ATPSSIDAKIESANVTSALFDVF 915
           +  F  +F+      G  I+        + V  S D + P +  A IE+  +  A+ +  
Sbjct: 140 VERFLEVFKDETFPPGASILFALSPEGSLTVAFSKDDSIPETGKAVIENKLLAEAVLESI 199

Query: 916 LGRNPVSPSLKASVANGLEVVLK 984
           +G+N VSP  +  VA  L  ++K
Sbjct: 200 IGKNRVSPGARLRVAERLAQLMK 222



>gb:MSCHI10_1687080 Malus sp. CHI mRNA for chalcone isomerase (pRAPI
           10).
          Length = 157

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 36/148 (24%), Positives = 70/148 (47%), Gaps = 4/148 (2%)
 Frame = +1

Query: 550 WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADD 729
           W+G++A EL      F  I   P EK + + ++  + G+ + + + E      KS     
Sbjct: 6   WKGKTAEELSESVEFFRDIVTGPFEKFIQVTMILPLTGQQYSEKVSENCVFFWKSVGIYT 65

Query: 730 E---TALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTS 897
           +    A+  F  +F+ +    G  I+ T      + +  S DA+ P + +A IE+  ++ 
Sbjct: 66  DLEGKAIEQFIDVFKDQNFPPGASILFTQSPKGSLTISFSKDASMPEATNAVIENKLLSE 125

Query: 898 ALFDVFLGRNPVSPSLKASVANGLEVVL 981
            + +  +G++ VSP+ K S+A  L  +L
Sbjct: 126 TVLESIVGKHGVSPATKQSLAARLSQLL 153



>pir|S29554|S29554 chalcone isomerase (EC 5.5.1.6) - apple tree
           (fragment)
          Length = 157

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 36/148 (24%), Positives = 70/148 (47%), Gaps = 4/148 (2%)
 Frame = +1

Query: 550 WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADD 729
           W+G++A EL      F  I   P EK + + ++  + G+ + + + E      KS     
Sbjct: 6   WKGKTAEELSESVEFFRDIVTGPFEKFIQVTMILPLTGQQYSEKVSENCVFFWKSVGIYT 65

Query: 730 E---TALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTS 897
           +    A+  F  +F+ +    G  I+ T      + +  S DA+ P + +A IE+  ++ 
Sbjct: 66  DLEGKAIEQFIDVFKDQNFPPGASILFTQSPKGSLTISFSKDASMPEATNAVIENKLLSE 125

Query: 898 ALFDVFLGRNPVSPSLKASVANGLEVVL 981
            + +  +G++ VSP+ K S+A  L  +L
Sbjct: 126 TVLESIVGKHGVSPATKQSLAARLSQLL 153



>sp|Q43056|CFI_PUELO Chalcone--flavonone isomerase (EC 5.5.1.6)
           (Chalcone isomerase).>gb:PUECHI_1702857 Pueraria lobata
           mRNA for chalcone flavanone isomerase, complete cds.
          Length = 224

 Score = 54.3 bits (129), Expect = 4e-06
 Identities = 51/220 (23%), Positives = 91/220 (41%), Gaps = 5/220 (2%)
 Frame = +1

Query: 337 AASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLY 516
           A ++ S    E++E P         ++ P    +  L G G R        +K    G+Y
Sbjct: 6   AVATISAVQVEFLEFPAV-------VTSPASGRTYFLGGAGERGLTIEGKFIKFTGIGVY 58

Query: 517 VNESILNKLDA-WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEA 693
           + +  ++ L A W+G+ + EL      +  I   P EK +    +  + G  +   + E 
Sbjct: 59  LEDKAVSSLAAKWKGKPSEELVETLDFYRDIISGPFEKLIRGSKILPLSGVEYSKKVMEN 118

Query: 694 ISPRIKSPSA---DDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSS 861
               +KS       +  A+  F   F+    + G  +         + +  S D T P +
Sbjct: 119 CVAHMKSVGTYGDAEAAAIEKFAEAFKNVNFQPGATVFYRQSPDGVLGLSFSEDVTIPDN 178

Query: 862 IDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL 981
             A IE+  V++A+ +  +G + VSP LK S+A+ L  VL
Sbjct: 179 EAAVIENKAVSAAVLETMIGEHAVSPDLKRSLASRLPAVL 218



>gb:AF276302_1782637 Glycine max chalcone isomerase (CHI) mRNA,
           complete cds.
          Length = 218

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 48/201 (23%), Positives = 85/201 (42%), Gaps = 5/201 (2%)
 Frame = +1

Query: 394 VKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSAA 570
           ++F   ++ P    +  L G G R        +K    G+Y+ +  +  L A W+G+++ 
Sbjct: 12  LEFPAVVTSPASGKTYFLGGAGERGLTIEGKFIKFTGIGVYLEDKAVPSLAAKWKGKTSE 71

Query: 571 ELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSA---DDETAL 741
           EL +    +  I   P EK +    +  + G  +   + E     +KS       +  A+
Sbjct: 72  ELVHTLHFYRDIISGPFEKLIRGSKILPLAGAEYSKKVMENCVAHMKSVGTYGDAEAAAI 131

Query: 742 STFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVFL 918
             F   F+      G  +         + +  S DAT P    A IE+  V++A+ +  +
Sbjct: 132 EKFAEAFKNVNFAPGASVFYRQSPDGILGLSFSEDATIPEKEAAVIENKAVSAAVLETMI 191

Query: 919 GRNPVSPSLKASVANGLEVVL 981
           G + VSP LK S+A+ L  VL
Sbjct: 192 GEHAVSPDLKRSLASRLPAVL 212



>sp|P28012|CFI1_MEDSA Chalcone--flavonone isomerase 1 (EC 5.5.1.6)
           (Chalcone isomerase 1).>pir|S44371|S44371 chalcone
           isomerase (EC 5.5.1.6) - alfalfa>gb:ALFMSCHI1_1818991
           Medicago sativa (cultivar Iroquois) chalcone isomerase
           (MsCHI-1) mRNA, complete cds.
          Length = 222

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 49/202 (24%), Positives = 85/202 (42%), Gaps = 5/202 (2%)
 Frame = +1

Query: 391 NVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSA 567
           N+++   ++ P    S  L G G R        +K  A G+Y+ +  +  L A W+G+S+
Sbjct: 12  NLEYPAVVTSPVTGKSYFLGGAGERGLTIEGNFIKFTAIGVYLEDIAVASLAAKWKGKSS 71

Query: 568 AELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSA---DDETA 738
            EL      +  I   P EK +    +R++ G  +   + E     +KS       +  A
Sbjct: 72  EELLETLDFYRDIISGPFEKLIRGSKIRELSGPEYSRKVMENCVAHLKSVGTYGDAEAEA 131

Query: 739 LSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVF 915
           +  F   F+      G  +         + +  S D + P    A IE+  V+SA+ +  
Sbjct: 132 MQKFAEAFKPVNFPPGASVFYRQSPDGILGLSFSPDTSIPEKEAALIENKAVSSAVLETM 191

Query: 916 LGRNPVSPSLKASVANGLEVVL 981
           +G + VSP LK  +A  L  +L
Sbjct: 192 IGEHAVSPDLKRCLAARLPALL 213



>gb:MSCHI5_1687081 Malus sp. CHI mRNA for chalcone isomerase (pRAPI
           5).
          Length = 156

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 36/148 (24%), Positives = 69/148 (46%), Gaps = 4/148 (2%)
 Frame = +1

Query: 550 WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADD 729
           W+G++A EL      F  I   P EK + + ++  + G+ + + + E      KS     
Sbjct: 5   WKGKTAEELSESVEFFRDIVTGPFEKFIQVTMILPLTGQQYSEKVSENCVFFWKSVGIYT 64

Query: 730 E---TALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTS 897
           +    A+  F   F+ +    G  I+ T      + +  S DA+ P + +A IE+  ++ 
Sbjct: 65  DLEGKAIEQFIDAFKDQNFPPGASILFTQSPKGSLTISFSKDASMPEATNAVIENKLLSE 124

Query: 898 ALFDVFLGRNPVSPSLKASVANGLEVVL 981
            + +  +G++ VSP+ K S+A  L  +L
Sbjct: 125 TVLESIVGKHGVSPATKQSLAARLSQLL 152



>pir|S29555|S29555 chalcone isomerase (EC 5.5.1.6) - apple tree
           (fragment)
          Length = 156

 Score = 52.8 bits (125), Expect = 1e-05
 Identities = 36/148 (24%), Positives = 69/148 (46%), Gaps = 4/148 (2%)
 Frame = +1

Query: 550 WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADD 729
           W+G++A EL      F  I   P EK + + ++  + G+ + + + E      KS     
Sbjct: 5   WKGKTAEELSESVEFFRDIVTGPFEKFIQVTMILPLTGQQYSEKVSENCVFFWKSVGIYT 64

Query: 730 E---TALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTS 897
           +    A+  F   F+ +    G  I+ T      + +  S DA+ P + +A IE+  ++ 
Sbjct: 65  DLEGKAIEQFIDAFKDQNFPPGASILFTQSPKGSLTISFSKDASMPEATNAVIENKLLSE 124

Query: 898 ALFDVFLGRNPVSPSLKASVANGLEVVL 981
            + +  +G++ VSP+ K S+A  L  +L
Sbjct: 125 TVLESIVGKHGVSPATKQSLAARLSQLL 152



>sp|P14298|CFI_PHAVU Chalcone--flavonone isomerase (EC 5.5.1.6)
           (Chalcone isomerase).>pir|S24784|S24784 chalcone
           isomerase (EC 5.5.1.6) - kidney bean>gb:PVCHISO_1702924
           P.vulgaris gene for chalcone isomerase.
          Length = 221

 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 47/199 (23%), Positives = 80/199 (40%), Gaps = 5/199 (2%)
 Frame = +1

Query: 400 FQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSAAEL 576
           F   ++ P    +  L G G R        +K  A G+Y+ +  +  L   W+G+ + EL
Sbjct: 17  FPAVVTSPATAKTYFLGGAGERGLTIEGKFIKFTAIGVYLEDKAVASLATKWKGKPSEEL 76

Query: 577 QNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSA---DDETALST 747
            N    +  I   P EK +    +  + G  +   + E     +KS       +   +  
Sbjct: 77  INTLDFYRDIISGPFEKLIRGSKILQLSGTEYSRKVMENCVAHLKSVGTYGDAEAKGIEE 136

Query: 748 FRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVFLGR 924
           F   F+      G  +         + +  S DAT P      IE+  V++A+ +  +G 
Sbjct: 137 FAEAFKKVNFPPGASVFYRQSPDGILGLSFSEDATIPGEEAVVIENKAVSAAVLETMIGE 196

Query: 925 NPVSPSLKASVANGLEVVL 981
           + VSP LK S+A+ L  VL
Sbjct: 197 HAVSPDLKRSLASRLPAVL 215



>gb:AB011474_1511366 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K2A18.
          Length = 223

 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 36/169 (21%), Positives = 76/169 (44%), Gaps = 5/169 (2%)
 Frame = +1

Query: 490 VKVYAAGLYVNESILNKLDA-WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGK 666
           V V   G+Y+    L  + A W+G++A EL    P F  +     EK   + + + + G 
Sbjct: 38  VIVTVIGVYLEAMALPSISAKWKGKNAKELTESVPFFRQLVTGEFEKLARVTMKKRLTGI 97

Query: 667 TFWDALDEAISPRIKSP---SADDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCV 837
            + + + E     +K+    +  +  A+  F  +F+ +    G+ I+        + +  
Sbjct: 98  QYSEKVVENCEEIMKASGKYTRSEAKAIDQFLMVFKNQDFPPGSSIIFAICPKGSLTIAF 157

Query: 838 S-SDATPSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGLEVVL 981
           S  +  P +  A I++  +  A+ +  +G+N VSP+ + S+A  L  ++
Sbjct: 158 SKEERVPKTGKAVIKNKLLGEAVLESMIGKNGVSPATRKSLAERLSKLM 206



>sp|Q43754|CFI_DIACA Chalcone--flavonone isomerase (EC 5.5.1.6)
           (Chalcone isomerase).>pir|T10712|T10712 chalcone
           isomerase (EC 5.5.1.6) - clove pink>gb:DCCHIMR_1675659
           D.caryophyllus mRNA for chalcone isomerase.
          Length = 221

 Score = 51.2 bits (121), Expect = 4e-05
 Identities = 44/204 (21%), Positives = 84/204 (41%), Gaps = 5/204 (2%)
 Frame = +1

Query: 364 AEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKL 543
           AE  +    +  F   +  PG   +  L G G R        +K  A  +Y+ +  ++ L
Sbjct: 2   AEITQIQVESHVFPPEVKPPGSDKTFFLGGAGVRGLEIQGKFIKFTAIAVYIEDDAVSSL 61

Query: 544 DA-WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPS 720
              W+G++A EL +    F+ I   P EK   + ++  + G+ + + + E      KS  
Sbjct: 62  AVKWKGKTADELTDSVDFFKDIVTGPFEKFTQVTMILPLTGQQYSEKVVENCVAHWKSVG 121

Query: 721 A---DDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESAN 888
                +  A   F  +F+      G  I+ T      + +  S D + P +    I +  
Sbjct: 122 TYTDAESEATQKFLQVFKNVSNPPGASILFTQSPLGSLTISFSKDGSLPENGKEVIVNKQ 181

Query: 889 VTSALFDVFLGRNPVSPSLKASVA 960
           ++ A+    +G++ VSP  K S++
Sbjct: 182 LSEAVLQSIIGKHGVSPEAKKSLS 205



>sp|P28013|CFI2_MEDSA Chalcone--flavonone isomerase 2 (EC 5.5.1.6)
           (Chalcone isomerase 2) (Fragment).>gb:ALFMSCHI2_1818992
           Medicago sativa (cultivar Iroquois) chalcone isomerase
           (MsCHI-2) mRNA, 3'end.
          Length = 197

 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 47/187 (25%), Positives = 78/187 (41%), Gaps = 5/187 (2%)
 Frame = +1

Query: 436 SLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSAAELQNDSPLFETIFK 612
           S  L G G R        +K  A G+Y+ +  +  L A W+G+S+ EL      +  I  
Sbjct: 2   SYFLGGAGERGLTIEGNFIKFTAIGVYLEDIAVASLAAKWKGKSSEELLETLDFYRDIIS 61

Query: 613 APLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSA---DDETALSTFRTIFQGRPLKK 783
            P EK +    +R++ G  +   + E     +KS       +  A+  F   F+      
Sbjct: 62  GPFEKLIRGSKIRELSGPEYSRKVMENCVAHLKSVGTYGDAEAEAMQKFAEAFKPVNFPP 121

Query: 784 GTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVA 960
           G  +         + +  S D + P    A IE+  V+SA+ +  +G + VSP LK  +A
Sbjct: 122 GASVFYRQSPDGILGLSFSPDTSIPEKEAALIENKAVSSAVLETMIGEHAVSPDLKRCLA 181

Query: 961 NGLEVVL 981
             L  +L
Sbjct: 182 ARLPALL 188



>gb:AP004846_1845879 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1293_A01.
          Length = 427

 Score = 50.4 bits (119), Expect = 6e-05
 Identities = 49/211 (23%), Positives = 98/211 (46%), Gaps = 10/211 (4%)
 Frame = +1

Query: 367 EYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYRE-KVFAIIGVKVYAAGLYVN-ESILNK 540
           E   EP T +KF   L      TS  L+G G+R  ++  +  + +YA GLY+  +SI  +
Sbjct: 218 EDATEPKTGIKFPTLLEDNSNPTSEVLVGMGFRSMRIMRVKNLNLYAFGLYIQPDSICKR 277

Query: 541 LDA-WRGRSAAELQNDSPLFETIFKAPLEKSLSIVL-VRDVDGKTFWDALDEAISPRIKS 714
           L   +     +EL++    +E + +  +  ++ +++    +   T  DA ++++  R++ 
Sbjct: 278 LSPKYASVPVSELKDHPDFYEDLLRENIHMTVRLIVSYNGLSIGTVRDAFEKSLCFRLQK 337

Query: 715 PSAD-DETALSTFRTIF-QGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAK----I 876
            + + D   L TF + F +   +  GT I        +++         + ID K    +
Sbjct: 338 MNPNTDYHCLKTFGSYFSEDICIPAGTKIDFRQTSDGQLI---------TEIDGKQIGAV 388

Query: 877 ESANVTSALFDVFLGRNPVSPSLKASVANGL 969
           +S ++  A FD+++G  PVS   K  +A  +
Sbjct: 389 QSKDLCRAFFDMYIGDPPVSVETKQDIAQNV 419



>gb:AE017341_1754397 Cryptococcus neoformans var. neoformans JEC21
           chromosome 1, complete sequence.
          Length = 313

 Score = 50.4 bits (119), Expect = 6e-05
 Identities = 64/256 (25%), Positives = 104/256 (40%), Gaps = 30/256 (11%)
 Frame = +1

Query: 295 GSLDARLPGLFSPRAASSSSVGNAEYVEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKV 474
           G+   RL    +P    + S     +  +P T+++F  SL L     +L+L+G G R+  
Sbjct: 54  GAESVRLGRWENPLLVHAHSHPQPVFRVDPETSIEFPLSLPLATPSPTLTLVGLGVRKVS 113

Query: 475 FAIIGVKVYAAGLYVNES---ILNKLDAW----------------RGRSAAELQNDSPLF 597
           F  + +KVY+AG Y+ +     L+ +  W                 G +AA   +   L 
Sbjct: 114 F--LKIKVYSAGFYLQDGATRCLHHIPGWATFTAQHLLTAPSPSPAGETAAPQLSGEALM 171

Query: 598 ETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIK------SPSADDET----ALST 747
             +    +  ++ IV  R+ D     DA   A+  R K      + S  DE     A+ T
Sbjct: 172 ANLLDQRIACAVRIVPNRNTDFGHLRDAFTRALIGRQKLERAKGALSEADEVRITEAIQT 231

Query: 748 FRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTSALFDVFLGRN 927
            +T F  + + KG  + L  + P +  + V  + T   I  K+    +   L   +   N
Sbjct: 232 LKTFFPAQTVHKGKSVTL--LRPPEGGIVVEFEGT---ILGKLNDPWIGKQLILTYFADN 286

Query: 928 -PVSPSLKASVANGLE 972
             VS  LK  VA GLE
Sbjct: 287 GAVSDKLKEDVAKGLE 302



>gb:PVCHALIS_1702923 Phaseolus vulgaris gene for chalcone isomerase.
          Length = 202

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 45/195 (23%), Positives = 78/195 (40%), Gaps = 5/195 (2%)
 Frame = +1

Query: 400 FQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSAAEL 576
           F   ++ P    +  L G G R        +K  A G+Y+ +  +  L   W+G+ + EL
Sbjct: 5   FPAVVTSPATAKTYFLGGAGERGLTIEGKFIKFTAIGVYLEDKAVASLATKWKGKPSEEL 64

Query: 577 QNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSA---DDETALST 747
            N    +  I   P EK +    +  + G  +   + E     +KS       +   +  
Sbjct: 65  INTLDFYRDIISGPFEKLIRGSKILQLSGTEYSRKVMENCVAHLKSVGTYGDAEAKGIEE 124

Query: 748 FRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVFLGR 924
           F   F+      G  +         + +  S DAT P      IE+  V++A+ +  +G 
Sbjct: 125 FAEAFKKVNFPPGASVFYRQSPDGILGLSFSEDATIPGEEAVVIENKAVSAAVLETMIGE 184

Query: 925 NPVSPSLKASVANGL 969
           + VSP LK S+A+ L
Sbjct: 185 HAVSPDLKRSLASRL 199



>pir|S14705|S14705 chalcone isomerase (EC 5.5.1.6) - kidney bean
           (fragment)
          Length = 202

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 45/195 (23%), Positives = 78/195 (40%), Gaps = 5/195 (2%)
 Frame = +1

Query: 400 FQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRGRSAAEL 576
           F   ++ P    +  L G G R        +K  A G+Y+ +  +  L   W+G+ + EL
Sbjct: 5   FPAVVTSPATAKTYFLGGAGERGLTIEGKFIKFTAIGVYLEDKAVASLATKWKGKPSEEL 64

Query: 577 QNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSA---DDETALST 747
            N    +  I   P EK +    +  + G  +   + E     +KS       +   +  
Sbjct: 65  INTLDFYRDIISGPFEKLIRGSKILQLSGTEYSRKVMENCVAHLKSVGTYGDAEAKGIEE 124

Query: 748 FRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT-PSSIDAKIESANVTSALFDVFLGR 924
           F   F+      G  +         + +  S DAT P      IE+  V++A+ +  +G 
Sbjct: 125 FAEAFKKVNFPPGASVFYRQSPDGILGLSFSEDATIPGEEAVVIENKAVSAAVLETMIGE 184

Query: 925 NPVSPSLKASVANGL 969
           + VSP LK S+A+ L
Sbjct: 185 HAVSPDLKRSLASRL 199



>gb:BT005236_1638176 Arabidopsis thaliana At2g26310 mRNA, complete
           cds.>gb:AK118033_1816033 Arabidopsis thaliana At2g26310
           mRNA for unknown protein, complete cds, clone:
           RAFL19-25-G17.
          Length = 217

 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 49/209 (23%), Positives = 94/209 (44%), Gaps = 7/209 (3%)
 Frame = +1

Query: 379 EPTTNVKFQRSLSLPGC-CTSLSLLGTGYRE-KVFAIIGVKVYAAGLYVN-ESILNKLD- 546
           EP T ++F   L        S  L+ TG R  K+  I  +KVYA G YV+  S+  KL  
Sbjct: 12  EPRTGIEFPMLLKENASRSNSEVLVATGSRTMKIIRIKSLKVYAFGFYVHPSSVCQKLGR 71

Query: 547 AWRGRSAAELQNDSPLFETIFKAPLEKSLSIVL-VRDVDGKTFWDALDEAISPR-IKSPS 720
            +    A++L     L++ + +  +  S+ +V+    +   T  D  ++++  R +K+  
Sbjct: 72  KYASVPASKLDKCDDLYKDLLREDIVMSVRLVVNYNGLKINTVRDVFEKSLRARLVKANP 131

Query: 721 ADDETALSTFRTIF-QGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTS 897
             D   L+ F + F Q  P+  GT I     +  +++  +       ++   + S ++  
Sbjct: 132 KTDFNCLNDFGSFFRQDIPIPAGTIIDFRRTEDGQLITEIG-----GNLIGAVRSKDLCR 186

Query: 898 ALFDVFLGRNPVSPSLKASVANGLEVVLK 984
           A F +++G  PVS   K  +   +  ++K
Sbjct: 187 AFFGMYIGDVPVSEQTKEEIGRKVVGIIK 215



>gb:AY231415_1591603 Arabidopsis thaliana hypothetical protein
           (At2g26310/T1D16.5) mRNA, complete cds.
          Length = 270

 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 49/209 (23%), Positives = 94/209 (44%), Gaps = 7/209 (3%)
 Frame = +1

Query: 379 EPTTNVKFQRSLSLPGC-CTSLSLLGTGYRE-KVFAIIGVKVYAAGLYVN-ESILNKLD- 546
           EP T ++F   L        S  L+ TG R  K+  I  +KVYA G YV+  S+  KL  
Sbjct: 65  EPRTGIEFPMLLKENASRSNSEVLVATGSRTMKIIRIKSLKVYAFGFYVHPSSVCQKLGR 124

Query: 547 AWRGRSAAELQNDSPLFETIFKAPLEKSLSIVL-VRDVDGKTFWDALDEAISPR-IKSPS 720
            +    A++L     L++ + +  +  S+ +V+    +   T  D  ++++  R +K+  
Sbjct: 125 KYASVPASKLDKCDDLYKDLLREDIVMSVRLVVNYNGLKINTVRDVFEKSLRARLVKANP 184

Query: 721 ADDETALSTFRTIF-QGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTS 897
             D   L+ F + F Q  P+  GT I     +  +++  +       ++   + S ++  
Sbjct: 185 KTDFNCLNDFGSFFRQDIPIPAGTIIDFRRTEDGQLITEIG-----GNLIGAVRSKDLCR 239

Query: 898 ALFDVFLGRNPVSPSLKASVANGLEVVLK 984
           A F +++G  PVS   K  +   +  ++K
Sbjct: 240 AFFGMYIGDVPVSEQTKEEIGRKVVGIIK 268



>gb:AP004991_1846848 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0016O19.
          Length = 428

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 46/208 (22%), Positives = 96/208 (46%), Gaps = 11/208 (5%)
 Frame = +1

Query: 379 EPTTNVKFQRSLSLPGCCTSLSLLGTGYRE-KVFAIIGVKVYAAGLYVNESILNKL--DA 549
           EP T +KF   L      ++  L+G G++  KV  +  + +YA GLY+  + +++     
Sbjct: 224 EPKTGIKFPAFLEDDSSPSTTVLVGMGFKGVKVMRVKNLDLYAFGLYLQPNTISEKLGPK 283

Query: 550 WRGRSAAELQNDSPLFETIFKAPLEKSLSIVL-VRDVDGKTFWDALDEAISPRIKSPSAD 726
           +       L+++   ++ + +  L   + +VL    +      D  ++++  R++  + +
Sbjct: 284 YASVPTINLKDNPDFYDDLLRENLPMRVRLVLHYNGLSIGAVRDVFEKSLGLRLQKMNPN 343

Query: 727 -DETALSTFRTIF-QGRPLKKGTFIVLTWVDPTKMLVCVSSDATP-SSIDAK----IESA 885
            D   L TF + F +  P+  GT          K+  C +SD    + ID +    ++S 
Sbjct: 344 TDYHCLKTFGSYFNEDIPIPAGT----------KIDFCQTSDGQLITEIDGRQIGAVKSK 393

Query: 886 NVTSALFDVFLGRNPVSPSLKASVANGL 969
           ++  ALF +++G +PVS   K  +A  +
Sbjct: 394 DLCRALFGMYIGDSPVSLQAKKDIAQNV 421



>gb:AY231416_1591604 Arabidopsis thaliana hypothetical protein
           (At2g26310/T1D16.5) mRNA, complete cds, alternatively
           spliced.
          Length = 398

 Score = 44.7 bits (104), Expect = 0.003
 Identities = 48/209 (22%), Positives = 93/209 (44%), Gaps = 7/209 (3%)
 Frame = +1

Query: 379 EPTTNVKFQRSLSLPGC-CTSLSLLGTGYRE-KVFAIIGVKVYAAGLYVN-ESILNKLD- 546
           EP T ++F   L        S  L+ TG R  K+  I  +KVYA G YV+  S+  KL  
Sbjct: 193 EPRTGIEFPMLLKENASRSNSEVLVATGSRTMKIIRIKSLKVYAFGFYVHPSSVCQKLGR 252

Query: 547 AWRGRSAAELQNDSPLFETIFKAPLEKSLSIVL-VRDVDGKTFWDALDEAISPR-IKSPS 720
            +    A++L     L++ + +  +  S+ +V+    +   T  D  ++++  R +K+  
Sbjct: 253 KYASVPASKLDKCDDLYKDLLREDIVMSVRLVVNYNGLKINTVRDVFEKSLRARLVKANP 312

Query: 721 ADDETALSTFRTIF-QGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSIDAKIESANVTS 897
             D   L+ F + F Q   +  GT I     +  +++  +       ++   + S ++  
Sbjct: 313 KTDFNCLNDFGSFFRQDIAIPAGTIIDFRRTEDGQLITEIG-----GNLIGAVRSKDLCR 367

Query: 898 ALFDVFLGRNPVSPSLKASVANGLEVVLK 984
           A F +++G  PVS   K  +   +  ++K
Sbjct: 368 AFFGMYIGDVPVSEQTKEEIGRKVVGIIK 396



>gb:AB087208_1524598 Raphanus sativus chi mRNA for chalcone
           flavanone isomerase, partial cds.
          Length = 171

 Score = 43.9 bits (102), Expect = 0.006
 Identities = 36/161 (22%), Positives = 67/161 (41%), Gaps = 5/161 (3%)
 Frame = +1

Query: 472 VFAIIGVKVYAAGLYVNESILNKLDA-WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLV 648
           +F +IGV       Y++   +  L   W G++  EL    P F  I      K + + + 
Sbjct: 16  IFTVIGV-------YLDPVSVPSLSVKWEGKTTEELTESVPFFREIVTGAFGKFIKVTMK 68

Query: 649 RDVDGKTFWDALDE---AISPRIKSPSADDETALSTFRTIFQGRPLKKGTFIVLTWVDPT 819
             + G+ + + + E   AI   +   +  +  A+  F  +F+      G  I+       
Sbjct: 69  LPLTGQQYSEKVTENCVAIWKSLGIYTDSEAKAVERFLEVFKDETFPPGASILFALSPEG 128

Query: 820 KMLVCVSSD-ATPSSIDAKIESANVTSALFDVFLGRNPVSP 939
            + V  S D + P +  A IE+  +  A+ +  +G+N VSP
Sbjct: 129 SLTVAFSKDDSIPETGKAAIENKLLAEAVLESIIGKNGVSP 169



>pir|T07657|T07657 chalcone isomerase (EC 5.5.1.6) - soybean
           (fragment)
          Length = 172

 Score = 43.5 bits (101), Expect = 0.008
 Identities = 37/159 (23%), Positives = 68/159 (42%), Gaps = 5/159 (3%)
 Frame = +1

Query: 508 GLYVNESILNKLDA-WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDAL 684
           G+Y+ +  +  L A W+G+++ EL +    +  I   P EK +    +  + G  +   +
Sbjct: 5   GVYLEDKAVPSLAAKWKGKTSEELVHTLHFYRDIISGPFEKLIRGSKILPLAGAEYSKKV 64

Query: 685 DEAISPRIKSPSA---DDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT- 852
            E     +KS       +  A+  F   F+      G   +        + +  S D T 
Sbjct: 65  MENCVAHMKSVGTYGDAEAAAIEKFAEAFKNVNFAPGPLFLYRQSPDGILGLSFSEDVTI 124

Query: 853 PSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGL 969
           P    A IE+  V++A+ +  +G + VSP LK  +A+ L
Sbjct: 125 PEKEAAVIENKAVSAAVLETMIGEHAVSPDLKRILASRL 163



>sp|O81980|CFI_SOYBN Chalcone--flavonone isomerase (EC 5.5.1.6)
           (Chalcone isomerase) (Fragment).>gb:GMJ004902_1680500
           Glycine max mRNA for chalcone isomerase, partial.
          Length = 172

 Score = 43.5 bits (101), Expect = 0.008
 Identities = 37/159 (23%), Positives = 68/159 (42%), Gaps = 5/159 (3%)
 Frame = +1

Query: 508 GLYVNESILNKLDA-WRGRSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDAL 684
           G+Y+ +  +  L A W+G+++ EL +    +  I   P EK +    +  + G  +   +
Sbjct: 5   GVYLEDKAVPSLAAKWKGKTSEELVHTLHFYRDIISGPFEKLIRGSKILPLAGAEYSKKV 64

Query: 685 DEAISPRIKSPSA---DDETALSTFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDAT- 852
            E     +KS       +  A+  F   F+      G   +        + +  S D T 
Sbjct: 65  MENCVAHMKSVGTYGDAEAAAIEKFAEAFKNVNFAPGPLFLYRQSPDGILGLSFSEDVTI 124

Query: 853 PSSIDAKIESANVTSALFDVFLGRNPVSPSLKASVANGL 969
           P    A IE+  V++A+ +  +G + VSP LK  +A+ L
Sbjct: 125 PEKEAAVIENKAVSAAVLETMIGEHAVSPDLKRILASRL 163



>gb:CR382130_1662992 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 303

 Score = 41.6 bits (96), Expect = 0.029
 Identities = 61/230 (26%), Positives = 91/230 (39%), Gaps = 28/230 (12%)
 Frame = +1

Query: 373 VEEPTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNES-------I 531
           V+ PT+   F   +S  G     SLLG G R   F  +G  VYA GLY+ ES       +
Sbjct: 75  VQPPTSTPPFPTKMSADG--KEWSLLGCGVRRVSF--LGFDVYAIGLYLPESQKREVREL 130

Query: 532 LNKLDAWRGRSAAELQNDSPLFETIFKAP---------LEKSLSIVLVRDVDGKTFWDAL 684
           L     ++  +    +    L + +  A          ++  + IV VR+ D     D  
Sbjct: 131 LQSTSGFQQANGDVEEFKKSLLDPVHGAAKIRWLLDQGIDIRIRIVPVRNTDFGHLRDGF 190

Query: 685 DEAI--SPRIKSPSADDETA--LSTFRTIFQGR-PLKKGTFIVLTWVDPTKMLVCVSSDA 849
              I   P  K  S + E A  LS  +TIF  +  + K   +V+        L     DA
Sbjct: 191 VRTILAHPEAKEASQNKEFADGLSELKTIFSRKMSVPKHNILVMNRKGNNGELKITYYDA 250

Query: 850 TPS------SIDAKIESANVTSALFDVFL-GRNPVSPSLKASVANGLEVV 978
                    S    + +  V+  L   +L G+ P+S +L+ SV NGL  V
Sbjct: 251 KSEADLGEGSELGTVHNPQVSELLLLQYLTGKKPISETLRDSVINGLVTV 300



>sp|P41089|CFI_PEA Chalcone--flavonone isomerase (EC 5.5.1.6)
           (Chalcone isomerase).>pir|T06421|T06421 chalcone
           isomerase (EC 5.5.1.6) - garden pea>gb:PSU03433_1702440
           Pisum sativum var. Alaska chalcone isomerase mRNA,
           complete cds.
          Length = 223

 Score = 38.5 bits (88), Expect = 0.24
 Identities = 44/205 (21%), Positives = 80/205 (39%), Gaps = 5/205 (2%)
 Frame = +1

Query: 382 PTTNVKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDA-WRG 558
           P    +F   ++ P     + L G G R        +K    G+Y+ +     L   W G
Sbjct: 11  PRREHEFPAVVTSPVTENHIFLGGAGERGLTINGTFIKFTCIGVYLEDKADKSLATKWEG 70

Query: 559 RSAAELQNDSPLFETIFKAPLEKSLSIVLVRDVDGKTFWDALDEAISPRIKSPSADDETA 738
           +   EL      +  I   P EK +    ++++ G  +   + E     +KS     +  
Sbjct: 71  K-LEELLETLDFYRDIISGPFEKLIRRSKIKELSGPEYSRKVMENCVAHLKSVGTYGDAE 129

Query: 739 LSTFRTIFQGRPLKKGTFIVL--TWVDPTKMLVCVSSD--ATPSSIDAKIESANVTSALF 906
           +   + + +   +     ++L      P  +L   SS   + P   DA IE+   +SA+ 
Sbjct: 130 VEAIQNLQKLSRMLIFHLVLLKKNRQSPDGILGLSSSKDISIPEKEDAIIENKAASSAVL 189

Query: 907 DVFLGRNPVSPSLKASVANGLEVVL 981
           +  +G + VSP LK  +A  L  +L
Sbjct: 190 ETMIGEHAVSPDLKRCLAARLPALL 214



>sp|O30188|Y048_ARCFU Hypothetical protein AF0048
           precursor.>pir|H69255|H69255 hypothetical protein AF0048
           - Archaeoglobus fulgidus>gb:AE001103_31844 Archaeoglobus
           fulgidus DSM 4304 section 4 of 172 of the complete
           genome.>gb:AE000782_973949 Archaeoglobus fulgidus DSM
           4304 complete genome.
          Length = 413

 Score = 36.6 bits (83), Expect = 0.93
 Identities = 24/87 (27%), Positives = 42/87 (48%)
 Frame = +1

Query: 439 LSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAELQNDSPLFETIFKAP 618
           LS +G+G      A+IG+++YAA   +    ++  + W+G +A +L  D    ET     
Sbjct: 164 LSDIGSGNYVNA-ALIGMRIYAAPYSIERETIDDYEVWQGETAVKLLEDLGFTETF---- 218

Query: 619 LEKSLSIVLVRDVDGKTFWDALDEAIS 699
              + +I L  D +  +     DEA+S
Sbjct: 219 ---NTTIALQSDEEWTSVKQTFDEALS 242



>gb:AH012458S4_1422490 Canis familiaris transcription factor Tbx4
           (Tbx4) gene, exon 8 and complete
           cds.>gb:AY185179_1426841 Canis familiaris transcription
           factor Tbx4 (Tbx4) mRNA, complete cds.
          Length = 554

 Score = 35.8 bits (81), Expect = 1.6
 Identities = 26/102 (25%), Positives = 40/102 (39%), Gaps = 10/102 (9%)
 Frame = +1

Query: 157 SLWISVSAPTKSKITSCNVKPRFSLPLSKTHSYFTIFSTFPSHFSLGSLDARLPGLFSPR 336
           ++W SVS  T   + +    P               + +FP+HF+  ++  RLP + +P 
Sbjct: 427 NMWTSVSPYTSYSVQTMETVP---------------YQSFPTHFTATTMMPRLPAISAP- 470

Query: 337 AASSSSVGNAEY----------VEEPTTNVKFQRSLSLPGCC 432
             SS   GN+ +          V E      FQR   LP  C
Sbjct: 471 --SSQPPGNSHFSVYNQLSQSQVRERGPTTSFQRERGLPSVC 510



>gb:BC076847_2559588 Xenopus laevis MGC83928 protein, mRNA (cDNA
           clone MGC:83928 IMAGE:6861169), complete cds.
          Length = 793

 Score = 34.7 bits (78), Expect = 3.5
 Identities = 24/91 (26%), Positives = 43/91 (47%)
 Frame = -1

Query: 974 TSNPLATDAFKEGETGLRPRNTSNRAEVTFADSILASIEEGVASDDTQTSILVGSTQVNT 795
           T+N   T  F   +   R   TSN++ +   +S++  +E+ +A  + QT    G   ++ 
Sbjct: 286 TTNQSQTKDFSTFKASERDLTTSNQSSLGLLNSMIMEVEQDLAEYERQT----GREVLSA 341

Query: 794 MKVPFLRGLP*KMVRNVERAVSSSAEGDLIL 702
                L G    +V +++R VS   E DL+L
Sbjct: 342 PPAHGLTGFTLSLVSSLKRVVSYLKESDLLL 372



>gb:AE016996_374798 Chlamydophila caviae GPIC section 3 of 4 of the
           complete genome.>gb:AE015925_994477 Chlamydophila caviae
           GPIC complete genome.
          Length = 494

 Score = 34.3 bits (77), Expect = 4.6
 Identities = 40/165 (24%), Positives = 74/165 (44%), Gaps = 9/165 (5%)
 Frame = -1

Query: 731 SSSAEGDLIL---GEIASSNASQKVLPSTSLTKTMLRDFSRGALNMVSNNGESFCSSAAE 561
           S +AE DLI+   G  ASS    KV         +LR  S   LN+++ +G  F    ++
Sbjct: 13  SENAELDLIMTESGSEASSTTDAKVTVPDCCQMAILRSMSDACLNLLNQSGSVFSQLPSQ 72

Query: 560 -RPLQASNLLRMDSLTYSPAA*TLTPIIAKTFSLYPVPSKDKD--VQQPGRLNDLWNFT- 393
            +P  +  L+  + +    ++    P ++   SL    S DK+  ++Q  +L+  ++   
Sbjct: 73  NKPAPSETLMAKNGMLMKSSS---LPNLSSQKSLDTFSSADKNPALRQTNQLSSSFSSVK 129

Query: 392 --LVVGSSTYSAFPTEEDEAALGENRPGSLASNDPNEK*EGNVEK 264
                 S  +S+    +DE+A+   +  ++  N P  K +G  EK
Sbjct: 130 EQKAQASMGFSSCLAPKDESAV--TKTTTVILNLPESKDDGYGEK 172



>gb:AY075134_2075863 Mus musculus T-box 4 (Tbx4) mRNA, complete cds.
          Length = 552

 Score = 33.9 bits (76), Expect = 6.0
 Identities = 31/123 (25%), Positives = 47/123 (38%), Gaps = 15/123 (12%)
 Frame = +1

Query: 109 SSLENKNMAAVGSMPS-----SLWISVSAPTKSKITSCNVKPRFSLPLSKTHSYFTIFST 273
           S  E   ++AV  +P      ++W SVS  T   + +    P               +  
Sbjct: 404 SGPEIAGVSAVDDLPPPPLSCNMWTSVSPYTSYSVQTMETVP---------------YQP 448

Query: 274 FPSHFSLGSLDARLPGLFSPRAASSSSVGNAEY----------VEEPTTNVKFQRSLSLP 423
           FP+HF+  ++  RLP +    A S+   GNA +          V E   +  F R   LP
Sbjct: 449 FPAHFTATTVMPRLPTI---AAQSAQPPGNAHFSVYNQLSQSQVRERGPSASFPRERGLP 505

Query: 424 GCC 432
           G C
Sbjct: 506 GMC 508



>gb:AL592465_2070709 Mouse DNA sequence from clone RP23-36C4 on
           chromosome 11 Contains the Tbx4 gene for T-box 4, a
           ribosomal protein L21 (Rpl21) pseudogene and the 3' end
           of the Brip1 gene for BRCA1 interacting protein
           C-terminal helicase 1, complete sequence.
          Length = 552

 Score = 33.9 bits (76), Expect = 6.0
 Identities = 31/123 (25%), Positives = 47/123 (38%), Gaps = 15/123 (12%)
 Frame = +1

Query: 109 SSLENKNMAAVGSMPS-----SLWISVSAPTKSKITSCNVKPRFSLPLSKTHSYFTIFST 273
           S  E   ++AV  +P      ++W SVS  T   + +    P               +  
Sbjct: 404 SGPEIAGVSAVDDLPPPPLSCNMWTSVSPYTSYSVQTMETVP---------------YQP 448

Query: 274 FPSHFSLGSLDARLPGLFSPRAASSSSVGNAEY----------VEEPTTNVKFQRSLSLP 423
           FP+HF+  ++  RLP +    A S+   GNA +          V E   +  F R   LP
Sbjct: 449 FPAHFTATTVMPRLPTI---AAQSAQPPGNAHFSVYNQLSQSQVRERGPSASFPRERGLP 505

Query: 424 GCC 432
           G C
Sbjct: 506 GMC 508



>gb:CR382138_1670695 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 297

 Score = 33.9 bits (76), Expect = 6.0
 Identities = 48/200 (24%), Positives = 74/200 (37%), Gaps = 22/200 (11%)
 Frame = +1

Query: 433 TSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLD-----------AWRGRSAAELQ 579
           T   LLG G R   F  +  KVY  GLY+    +NK                  S  EL 
Sbjct: 97  TDFQLLGYGVRSVTF--VNFKVYGIGLYIANDDVNKTKKILSPNYLSTFGTENHSLRELL 154

Query: 580 NDSPLFETIFKAPLEKSLSIVL----VRDVDGKTFWDALDEAI--SPRIKSPSADDETAL 741
           +D      +    LE+++   +    VR+ D     D L ++I   P  K         L
Sbjct: 155 SDPEFSAQLISKLLEENVRFAVRISPVRNTDFNHLKDGLIKSILAHPESKENKEIVSNGL 214

Query: 742 STFRTIFQGRPLKKGTFIVLTWVDPTKMLVCVSSDATPSSID----AKIESANVTSALFD 909
              R +F G         VL W++  K      S   P   +     +++   ++  LF 
Sbjct: 215 EELRNVFSGYRGSVPKNHVL-WLEILKQGSLSISYENPVKNELTSMGQVKEPIISKLLFL 273

Query: 910 VFL-GRNPVSPSLKASVANG 966
            +L G+ P+S  L+ S  +G
Sbjct: 274 QYLSGKKPLSEPLRKSCNDG 293



>gb:AK028407_1160978 Mus musculus 13 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:3930401C23
           product:T-box 4, full insert
           sequence.>gb:AL592465_2070710 Mouse DNA sequence from
           clone RP23-36C4 on chromosome 11 Contains the Tbx4 gene
           for T-box 4, a ribosomal protein L21 (Rpl21) pseudogene
           and the 3' end of the Brip1 gene for BRCA1 interacting
           protein C-terminal helicase 1, complete sequence.
          Length = 452

 Score = 33.9 bits (76), Expect = 6.0
 Identities = 31/123 (25%), Positives = 47/123 (38%), Gaps = 15/123 (12%)
 Frame = +1

Query: 109 SSLENKNMAAVGSMPS-----SLWISVSAPTKSKITSCNVKPRFSLPLSKTHSYFTIFST 273
           S  E   ++AV  +P      ++W SVS  T   + +    P               +  
Sbjct: 304 SGPEIAGVSAVDDLPPPPLSCNMWTSVSPYTSYSVQTMETVP---------------YQP 348

Query: 274 FPSHFSLGSLDARLPGLFSPRAASSSSVGNAEY----------VEEPTTNVKFQRSLSLP 423
           FP+HF+  ++  RLP +    A S+   GNA +          V E   +  F R   LP
Sbjct: 349 FPAHFTATTVMPRLPTI---AAQSAQPPGNAHFSVYNQLSQSQVRERGPSASFPRERGLP 405

Query: 424 GCC 432
           G C
Sbjct: 406 GMC 408



>pir|D82628|D82628 hypothetical protein XF1860 [imported] - Xylella
           fastidiosa  (strain 9a5c)>gb:AE004007_49495 Xylella
           fastidiosa 9a5c, section 153 of 229 of the complete
           genome.>gb:AE003849_1116705 Xylella fastidiosa 9a5c,
           complete genome.
          Length = 110

 Score = 33.9 bits (76), Expect = 6.0
 Identities = 23/89 (25%), Positives = 43/89 (48%)
 Frame = +1

Query: 394 VKFQRSLSLPGCCTSLSLLGTGYREKVFAIIGVKVYAAGLYVNESILNKLDAWRGRSAAE 573
           V F  S+SLP        +   YR K+ A+  +  +   L+ + S L+ + AWR  +   
Sbjct: 9   VDFNESISLPPA------VAAAYRRKLSALDDMPAFIDRLFYSNSFLDSISAWRFANCIT 62

Query: 574 LQNDSPLFETIFKAPLEKSLSIVLVRDVD 660
            +    +F ++ +A L++ L   L+ D+D
Sbjct: 63  EEQYVWMFRSV-RAALQRDLG--LISDID 88



>gb:CNS07EGD_1373450 chromosome VI of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 247

 Score = 33.5 bits (75), Expect = 7.9
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 3/47 (6%)
 Frame = +1

Query: 583 DSPLFETIFKAPLEKSLSIVLVRDVDGK--TFW-DALDEAISPRIKS 714
           DSP+    F   L+KS  I+++ D+DG    FW D  +  + P+IKS
Sbjct: 134 DSPVNVVPFVEELKKSNEIIILNDIDGSEVVFWNDTQESPVDPQIKS 180


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,168,028,774
Number of Sequences: 1806583
Number of extensions: 25393951
Number of successful extensions: 68103
Number of sequences better than 10.0: 66
Number of HSP's better than 10.0 without gapping: 65208
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 68041
length of database: 581,917,975
effective HSP length: 126
effective length of database: 354,288,517
effective search space used: 85737821114
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)