BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig5609
         (633 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY830138_1629340 Ipomoea batatas cultivar Beauregard clone BA...   124   1e-27   
gb:AY830138_1629337 Ipomoea batatas cultivar Beauregard clone BA...   121   1e-26   
gb:AY830138_1629338 Ipomoea batatas cultivar Beauregard clone BA...   110   3e-23   
gb:AY830138_1629339 Ipomoea batatas cultivar Beauregard clone BA...   103   2e-21   
gb:AY056240_1563562 Arabidopsis thaliana putative nonsense-media...    33   4.0     
pir|F84452|F84452 probable nonsense-mediated mRNA decay protein ...    33   4.0     Arabidopsis thaliana [mouse-ear cress]
gb:CP000003_861008 Streptococcus pyogenes MGAS10394, complete ge...    32   6.8     
gb:AE014157_304512 Streptococcus pyogenes MGAS315, section 22 of...    32   6.8     
gb:AE006574_220313 Streptococcus pyogenes M1 GAS, section 103 of...    32   6.8     
gb:CP000030_83805 Anaplasma marginale str. St. Maries, complete ...    32   6.8     
gb:AF259052_2223551 HIV-1 patient ACH171 clone 17141rac10 from N...    32   8.9     
gb:AF259049_2223548 HIV-1 patient ACH171 clone 17141d12 from Net...    32   8.9     
gb:AJ630128_1494746 Bacteriophage S-PM2 complete genome.               32   8.9     
gb:AE014187_938566 Plasmodium falciparum 3D7 chromosome 14 compl...    32   8.9     


>gb:AY830138_1629340 Ipomoea batatas cultivar Beauregard clone
           BAC117E14, complete sequence.
          Length = 849

 Score =  124 bits (311), Expect = 1e-27
 Identities = 81/180 (45%), Positives = 108/180 (60%)
 Frame = +2

Query: 8   CVALASLKATIKLEFLQPFPRIPLLHHQEPIIHSFLQMISSLQAFLKESRAAAAIKDLEI 187
           CVAL SL ATI+L+FL+  PR+ +L  + PI   F + +SSLQAFL++   + AI+DLEI
Sbjct: 3   CVALTSLMATIELQFLRSIPRVSILDDELPI--KFFEKLSSLQAFLQQK--SGAIRDLEI 58

Query: 188 KIRDFALKAEDNIEIQLSNFVLAKDKEDQEKXXXXXXXXXXXXXXNASELLSIIDKVSNE 367
           +IRDFAL AED IEIQLSNF+LAK++EDQ+K              NA+ LL    K+SNE
Sbjct: 59  QIRDFALDAEDRIEIQLSNFLLAKNREDQQKAAQKLHQTLIEAAENAAHLL----KISNE 114

Query: 368 ADDDEENEIQQPSIHHWLKHAYSEFENDKFDGSSQCFPELVGGKMVGRHHDREEIINNLI 547
           + DDE NE    S+  W             D S +  P  + G+MVGR +D   + N L+
Sbjct: 115 S-DDESNECH--SLIPW-----------SLDTSLRLQPPKLEGRMVGRRNDYLLVKNQLL 160



>gb:AY830138_1629337 Ipomoea batatas cultivar Beauregard clone
           BAC117E14, complete sequence.
          Length = 406

 Score =  121 bits (303), Expect = 1e-26
 Identities = 82/180 (45%), Positives = 106/180 (58%), Gaps = 1/180 (0%)
 Frame = +2

Query: 8   CVALASLKATIKLEFLQPF-PRIPLLHHQEPIIHSFLQMISSLQAFLKESRAAAAIKDLE 184
           CVAL SL AT+KLEFLQP  PR+ L       I S  + +SSLQAF++E    +  ++LE
Sbjct: 3   CVALTSLIATMKLEFLQPNNPRVSLDDEASLSIKSLFKKLSSLQAFVQEK---SGTRELE 59

Query: 185 IKIRDFALKAEDNIEIQLSNFVLAKDKEDQEKXXXXXXXXXXXXXXNASELLSIIDKVSN 364
           +KIRDFAL+AED IEIQLSNFVLA + EDQ+K              NA+ELL +   +S 
Sbjct: 60  MKIRDFALEAEDRIEIQLSNFVLANNAEDQQKACQKLHHILQEAAENAAELLKLSSSISK 119

Query: 365 EADDDEENEIQQPSIHHWLKHAYSEFENDKFDGSSQCFPELVGGKMVGRHHDREEIINNL 544
           EA    +N   + S+  WLKH          D +S+  P  V   MVGR HDR+ I+N+L
Sbjct: 120 EA---VKNARSEGSVISWLKH----------DSASE--PSNV---MVGRRHDRKVIMNDL 161



>gb:AY830138_1629338 Ipomoea batatas cultivar Beauregard clone
           BAC117E14, complete sequence.
          Length = 846

 Score =  110 bits (274), Expect = 3e-23
 Identities = 80/184 (43%), Positives = 101/184 (54%), Gaps = 4/184 (2%)
 Frame = +2

Query: 8   CVALASLKATIKLEFLQPFPRIPLLHHQEPIIHSFLQMISSLQAFLKE---SRAAAAIKD 178
           CVAL SL ATIKLEFLQP PR+ L    +  + SF + +SSLQ F++E   +R   AI+ 
Sbjct: 3   CVALTSLMATIKLEFLQPNPRVVL---DDEAMESFYEKLSSLQGFVQEKSGARGGTAIRH 59

Query: 179 LEIKIRDFALKAEDNIEIQLSNFVLA-KDKEDQEKXXXXXXXXXXXXXXNASELLSIIDK 355
           LEI+IRDFAL+AED IE QLSNF+LA K+ EDQ+K               A     +++K
Sbjct: 60  LEIQIRDFALEAEDRIETQLSNFLLAIKNPEDQQKAYQQQLLQTLGEA--AQNAAKLVEK 117

Query: 356 VSNEADDDEENEIQQPSIHHWLKHAYSEFENDKFDGSSQCFPELVGGKMVGRHHDREEII 535
                DD E   I    +  WLKH          D +S+  P  V   MVGR  DR  II
Sbjct: 118 SKETDDDKEVVNISGGPVIPWLKH----------DSASE--PSNV---MVGRGRDRMLII 162

Query: 536 NNLI 547
           + LI
Sbjct: 163 DKLI 166



>gb:AY830138_1629339 Ipomoea batatas cultivar Beauregard clone
           BAC117E14, complete sequence.
          Length = 779

 Score =  103 bits (258), Expect = 2e-21
 Identities = 77/188 (40%), Positives = 101/188 (53%), Gaps = 8/188 (4%)
 Frame = +2

Query: 8   CVALASLKATIKLEFLQPFP-RIPLLHHQEPIIHSFLQMISSLQAFLKESRAA----AAI 172
           CVAL SL ATI+LEF+QP   R+PL       I+S  + +SSLQ F+++   A     AI
Sbjct: 3   CVALTSLMATIQLEFVQPNNGRVPLDDEASISINSLFEKLSSLQGFVQQKSGAKGRGTAI 62

Query: 173 KDLEIKIRDFALKAEDNIEIQLSNFVLA-KDKEDQEKXXXXXXXXXXXXXXNASELLSII 349
           + LEI+IRDFAL AED IEIQLSNF+LA K+ EDQ+K              NA+ELL   
Sbjct: 63  RHLEIEIRDFALDAEDRIEIQLSNFLLAIKNPEDQQKAYQKLHQTLGEAAENAAELL--- 119

Query: 350 DKVSNEADDDEE--NEIQQPSIHHWLKHAYSEFENDKFDGSSQCFPELVGGKMVGRHHDR 523
            + S + DD+E   NE + P I     +  SE  N                 MVGRH+D 
Sbjct: 120 -EKSKQTDDEEVVINESEGPLIPSLKHYLVSEPSN----------------IMVGRHYDL 162

Query: 524 EEIINNLI 547
            ++   L+
Sbjct: 163 RQVREKLL 170



>gb:AY056240_1563562 Arabidopsis thaliana putative nonsense-mediated
           mRNA decay protein (At2g03820) mRNA, complete cds.
          Length = 516

 Score = 33.1 bits (74), Expect = 4.0
 Identities = 22/91 (24%), Positives = 40/91 (43%)
 Frame = +2

Query: 122 ISSLQAFLKESRAAAAIKDLEIKIRDFALKAEDNIEIQLSNFVLAKDKEDQEKXXXXXXX 301
           + SL   + +SR     +  + +  +F    E+N E++  N  L +DK+ Q         
Sbjct: 424 LKSLPMEMDDSRGRVDPEKTDKEYEEFLRDLEENPELRF-NISLYRDKDYQASETASMTD 482

Query: 302 XXXXXXXNASELLSIIDKVSNEADDDEENEI 394
                     ELL+ +D    E DDD+E+++
Sbjct: 483 GEGAPSVPIEELLADLDLSFEEEDDDDEDDM 513



>pir|F84452|F84452 probable nonsense-mediated mRNA decay protein
           [imported] - Arabidopsis thaliana>gb:AC007196_1535532
           Arabidopsis thaliana chromosome 2 clone T18C20 map RNS1,
           complete sequence.>gb:AY099778_1576803 Arabidopsis
           thaliana putative nonsense-mediated mRNA decay protein
           (At2g03820) mRNA, complete cds.>gb:AY128878_1580958
           Arabidopsis thaliana putative nonsense-mediated mRNA
           decay protein (At2g03820) mRNA, complete cds.
          Length = 516

 Score = 33.1 bits (74), Expect = 4.0
 Identities = 22/91 (24%), Positives = 40/91 (43%)
 Frame = +2

Query: 122 ISSLQAFLKESRAAAAIKDLEIKIRDFALKAEDNIEIQLSNFVLAKDKEDQEKXXXXXXX 301
           + SL   + +SR     +  + +  +F    E+N E++  N  L +DK+ Q         
Sbjct: 424 LKSLPMEMDDSRGRVDPEKTDKEYEEFLRDLEENPELRF-NISLYRDKDYQASETASMTD 482

Query: 302 XXXXXXXNASELLSIIDKVSNEADDDEENEI 394
                     ELL+ +D    E DDD+E+++
Sbjct: 483 GEGAPSVPIEELLADLDLSFEEEDDDDEDDM 513



>gb:CP000003_861008 Streptococcus pyogenes MGAS10394, complete
           genome.
          Length = 792

 Score = 32.3 bits (72), Expect = 6.8
 Identities = 14/26 (53%), Positives = 20/26 (76%)
 Frame = +3

Query: 258 KTKRIRKKLPSNSIKPCKKQQKTHQS 335
           KTK+ RK + SN IKP KK +KT+++
Sbjct: 34  KTKQSRKGMTSNKIKPIKKSKKTNKT 59



>gb:AE014157_304512 Streptococcus pyogenes MGAS315, section 22 of 37
           of the complete genome.>gb:BA000034_713749 Streptococcus
           pyogenes SSI-1 DNA, complete genome.>gb:AE014074_927691
           Streptococcus pyogenes MGAS315, complete genome.
          Length = 792

 Score = 32.3 bits (72), Expect = 6.8
 Identities = 14/26 (53%), Positives = 20/26 (76%)
 Frame = +3

Query: 258 KTKRIRKKLPSNSIKPCKKQQKTHQS 335
           KTK+ RK + SN IKP KK +KT+++
Sbjct: 34  KTKQSRKGMTSNKIKPIKKSKKTNKT 59



>gb:AE006574_220313 Streptococcus pyogenes M1 GAS, section 103 of
           167 of the complete genome.>gb:AE004092_1106159
           Streptococcus pyogenes M1 GAS, complete genome.
          Length = 792

 Score = 32.3 bits (72), Expect = 6.8
 Identities = 14/26 (53%), Positives = 20/26 (76%)
 Frame = +3

Query: 258 KTKRIRKKLPSNSIKPCKKQQKTHQS 335
           KTK+ RK + SN IKP KK +KT+++
Sbjct: 34  KTKQSRKGMTSNKIKPIKKSKKTNKT 59



>gb:CP000030_83805 Anaplasma marginale str. St. Maries, complete
           genome.
          Length = 426

 Score = 32.3 bits (72), Expect = 6.8
 Identities = 19/44 (43%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = -2

Query: 140 RLAKKKSFARKNGLLVLDDEEEGSLGRVVE-TQA*LLP*EKLKQ 12
           RLAK  S++R N +    D++  S GRVVE T+A L P + L++
Sbjct: 213 RLAKVSSYSRSNAVKGFSDDDIASFGRVVEKTEAFLTPVQFLER 256



>gb:AF259052_2223551 HIV-1 patient ACH171 clone 17141rac10 from
           Netherlands envelope glycoprotein (env) gene, partial
           cds.
          Length = 98

 Score = 32.0 bits (71), Expect = 8.9
 Identities = 17/44 (38%), Positives = 22/44 (50%)
 Frame = +1

Query: 172 QGFGNQNQRLCTQSRRQHRNTTKQLCVGQRQRGSGKSFPATPSS 303
           Q  GN  Q  C  SR Q  NT KQ+ +  R++   K+    PSS
Sbjct: 48  QIIGNIRQAHCNLSRTQWNNTLKQIAIKLRKQYENKTIVFNPSS 91



>gb:AF259049_2223548 HIV-1 patient ACH171 clone 17141d12 from
           Netherlands envelope glycoprotein (env) gene, partial
           cds.>gb:AF259050_2223549 HIV-1 patient ACH171 clone
           17141e9 from Netherlands envelope glycoprotein (env)
           gene, partial cds.>gb:AF259051_2223550 HIV-1 patient
           ACH171 clone 17141raf5 from Netherlands envelope
           glycoprotein (env) gene, partial cds.
          Length = 98

 Score = 32.0 bits (71), Expect = 8.9
 Identities = 17/44 (38%), Positives = 22/44 (50%)
 Frame = +1

Query: 172 QGFGNQNQRLCTQSRRQHRNTTKQLCVGQRQRGSGKSFPATPSS 303
           Q  GN  Q  C  SR Q  NT KQ+ +  R++   K+    PSS
Sbjct: 48  QIIGNIRQAHCNLSRTQWNNTLKQIAIKLRKQYENKTIVFNPSS 91



>gb:AJ630128_1494746 Bacteriophage S-PM2 complete genome.
          Length = 1167

 Score = 32.0 bits (71), Expect = 8.9
 Identities = 33/131 (25%), Positives = 57/131 (43%), Gaps = 17/131 (12%)
 Frame = +2

Query: 50  FLQPFPRIPLLHH--QEPIIHSFLQMISSLQAFLKESRAAAAIKDLEIKIRDFALK---- 211
           F+   P  P+  +   + +  +F Q+ +     +      A   +L I I+   ++    
Sbjct: 473 FIPAEPEEPVKENPSDDNLTKAFNQLSAKFDQLINRKNKKAEQLNLSIDIQQQTVEDSKE 532

Query: 212 --AEDNIEIQLSNFV------LAKDKEDQEKXXXXXXXXXXXXXXNASEL---LSIIDKV 358
              E+N+ I++SN +        KD+ED EK              NA E    LS +DKV
Sbjct: 533 VIKENNVLIKISNEIKKKFLRFNKDQEDTEKKREIE---------NAGEETLDLSGLDKV 583

Query: 359 SNEADDDEENE 391
            N+ DD++E+E
Sbjct: 584 DNKRDDEDEDE 594



>gb:AE014187_938566 Plasmodium falciparum 3D7 chromosome 14 complete
            sequence.>gb:AE014817_1227642 Plasmodium falciparum 3D7
            chromosome 14 section 2 of 13 of the complete sequence.
          Length = 4405

 Score = 32.0 bits (71), Expect = 8.9
 Identities = 33/139 (23%), Positives = 56/139 (40%), Gaps = 12/139 (8%)
 Frame = +2

Query: 170  IKDLEIKIR--DFALKAEDNIEIQLSNFVLAKDKEDQEKXXXXXXXXXXXXXXNASELLS 343
            IK+ E+K    D  +K  DNI+    NF+L +   + ++                   L 
Sbjct: 2426 IKNDEMKDHKIDDNIKENDNIK---DNFILEEQNLESQRT------------------LI 2464

Query: 344  IIDKVSNEADDDEENEIQQPSIHHWLKHAYSEFENDKFDGSSQCFPELVGGKM------- 502
            +I+K  +  DD ++NE  + +I  +     +E   +  + S  CF EL   KM       
Sbjct: 2465 MINKEDDIRDDKKKNEESEQNIEEYFCSKNNESSENNLNNSYACFMELNNNKMNDNNCIY 2524

Query: 503  ---VGRHHDREEIINNLIP 550
               +  +   +E I N IP
Sbjct: 2525 DEHIRYNETEKENIKNTIP 2543


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 564,969,798
Number of Sequences: 1806583
Number of extensions: 10504349
Number of successful extensions: 32636
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 31582
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32609
length of database: 581,917,975
effective HSP length: 119
effective length of database: 366,934,598
effective search space used: 33391048418
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)