BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig5541
         (539 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|F84675|F84675 hypothetical protein At2g27680 [imported] - Ar...   187   1e-46   Arabidopsis thaliana [mouse-ear cress]
gb:AP005558_1854040 Oryza sativa (japonica cultivar-group) genom...   162   3e-39   
gb:AF324984_1786438 Arabidopsis thaliana At2g27680 (At2g27680/F1...   126   2e-28   
gb:BA000012_671624 Mesorhizobium loti MAFF303099 DNA, complete g...    56   4e-07   
gb:AE017231_411876 Mycobacterium avium subsp. paratuberculosis s...    41   0.013   
gb:SME591783_184482 Sinorhizobium meliloti 1021 complete chromos...    40   0.017   
pir|T35322|T35322 hypothetical protein SC5H1.06c - Streptomyces ...    40   0.029   Streptomyces coelicolor
gb:AP006627_565287 Bacillus clausii KSM-K16 DNA, complete genome.      39   0.050   
gb:AE016822_341091 Leifsonia xyli subsp. xyli str. CTCB07, compl...    39   0.065   
gb:BX294154_771620 Pirellula sp. strain 1 complete genome; segme...    38   0.085   
gb:CR382133_1666927 Debaryomyces hansenii chromosome A of strain...    37   0.19    
gb:BA000012_667897 Mesorhizobium loti MAFF303099 DNA, complete g...    37   0.25    
gb:AE008808_244078 Salmonella typhimurium LT2, section 112 of 22...    37   0.25    
gb:STY401270_194137 Salmonella typhimurium partial ORFA, ipd gen...    37   0.25    
gb:CP000026_75343 Salmonella enterica subsp. enterica serovar Pa...    37   0.25    
pir|AB0808|AB0808 probable ion-channel protein STY2647 [imported...    37   0.25    Salmonella enterica subsp. enterica serovar Typhi
gb:AE016937_362046 Bacteroides thetaiotaomicron VPI-5482, sectio...    36   0.32    
gb:AL935262_552921 Lactobacillus plantarum strain WCFS1 complete...    36   0.42    
gb:SAU421825_172269 Stigmatella aurantiaca ORF8, ORF7, ORF6, ORF...    36   0.42    
gb:CR543861_104915 Acinetobacter sp. ADP1 complete genome.             35   0.55    
pir|E85959|E85959 probable reductase Z4354 [imported] - Escheric...    35   0.55    Escherichia coli O157:H7
gb:CP000009_862317 Gluconobacter oxydans 621H, complete genome.        35   0.72    
gb:AE017333_447246 Bacillus licheniformis DSM 13, complete genom...    35   0.72    
gb:AE016766_327720 Escherichia coli CFT073 section 12 of 18 of t...    35   0.72    
gb:AE005674_72631 Shigella flexneri 2a str. 301, complete genome...    35   0.72    
pir|G84352|G84352 general stress protein 69 [imported] - Halobac...    35   0.72    Halobacterium salinarum
sp|Q46851|YGHZ_ECOLI|YGHZ_ECOLI Hypothetical protein yghZ.>pir|G65086|G6508...    35   0.72    Escherichia coli [E. coli]
sp|Q8X529|YGHZ_ECO57|YGHZ_ECO57 Hypothetical protein yghZ.>pir|E91114|E9111...    35   0.72    Escherichia coli O157:H7
gb:CP000011_868181 Burkholderia mallei ATCC 23344 chromosome 2, ...    35   0.94    
gb:BX571966_793589 Burkholderia pseudomallei strain K96243, chro...    35   0.94    
gb:AE013753_299815 Yersinia pestis KIM section 153 of 415 of the...    35   0.94    
gb:AE009819_256073 Pyrobaculum aerophilum strain IM2 section 74 ...    35   0.94    
pir|AE1085|AE1085 oxidoreductases homolog lmo0084 [imported] - L...    35   0.94    Listeria monocytogenes
gb:AY596297_634116 Haloarcula marismortui ATCC 43049 chromosome ...    34   1.2     
gb:AE011965_278114 Xanthomonas axonopodis pv. citri str. 306, se...    34   1.2     
gb:LLU60828_141162 Lactococcus lactis galactose-lactose operon, ...    34   1.2     
pir|B86873|B86873 oxidoreductase yugB [imported] - Lactococcus l...    34   1.2     Lactococcus lactis subsp. lactis
gb:AE014295_311677 Bifidobacterium longum NCC2705, complete genome.    34   1.6     
pir|AE0362|AE0362 probable ion channel protein YPO2980 [imported...    34   1.6     Yersinia pestis Nepal516
pir|AH2062|AH2062 aldo/keto reductase [imported] - Nostoc sp. (s...    34   1.6     Nostoc sp. PCC 7120
gb:BX936398_837346 Yersinia pseudotuberculosis IP32953 genome, c...    33   2.1     
gb:AF333038_502291 Streptomyces viridochromogenes Avilamycin A b...    33   2.1     
pir|AC2764|AC2764 conserved hypothetical protein Atu1524 [import...    33   2.1     Agrobacterium tumefaciens
pir|B95902|B95902 probable aldoketo reductase protein [imported]...    33   2.1     Sinorhizobium meliloti
pir|H90466|H90466 oxidoreductase [imported] - Sulfolobus solfata...    33   2.1     Saccharolobus solfataricus
gb:AP003328_1827944 Oryza sativa (japonica cultivar-group) genom...    33   2.7     
gb:AF359360_1791017 Fusarium sporotrichioides trichothecene gene...    33   2.7     
gb:AX067087_1460446 Sequence 669 from Patent WO0100805.                33   2.7     
gb:BX927151_832843 Corynebacterium glutamicum ATCC 13032, IS fin...    33   2.7     
gb:AE017355_463156 Bacillus thuringiensis serovar konkukian str....    33   2.7     
gb:AE017271_423320 Bacillus cereus ATCC 10987, section 8 of 18 o...    33   2.7     
gb:AE017030_382152 Bacillus anthracis str. Ames section 7 of 18 ...    33   2.7     
gb:AE017004_376943 Bacillus cereus ATCC 14579 section 7 of 18 of...    33   2.7     
gb:AE016857_349807 Pseudomonas syringae pv. tomato str. DC3000 s...    33   2.7     
pir|T50285|T50285 probable oxidoreductase [imported] - fission y...    33   2.7     Schizosaccharomyces pombe
gb:CR380959_1654042 Candida glabrata strain CBS138 chromosome M ...    33   3.6     
gb:AY389593_1178228 Hyacinthus orientalis aldo/keto reductase mR...    33   3.6     
gb:BX248357_762372 Corynebacterium diphtheriae gravis NCTC13129,...    33   3.6     
gb:BA000012_668518 Mesorhizobium loti MAFF303099 DNA, complete g...    33   3.6     
gb:AP006841_571359 Bacteroides fragilis YCH46 DNA, complete genome.    33   3.6     
gb:AE017237_413425 Mycobacterium avium subsp. paratuberculosis s...    33   3.6     
gb:U00012_198757 Mycobacterium leprae cosmid B1308.                    33   3.6     
pir|H75541|H75541 probable oxidoreductase - Deinococcus radiodur...    33   3.6     Deinococcus radiodurans
pir|B97545|B97545 hypothetical protein AGR_C_2811 [imported] - A...    33   3.6     Agrobacterium tumefaciens
gb:FSU22463_1679322 Fusarium sporotrichioides T-2 toxin biosynth...    32   4.7     
gb:CR382126_1659213 Kluyveromyces lactis strain NRRL Y-1140 chro...    32   4.7     
gb:AE016959_1022605 Oryza sativa (japonica cultivar-group) chrom...    32   4.7     
gb:BA000045_741692 Gloeobacter violaceus PCC 7421 DNA, complete ...    32   4.7     
gb:BA000039_726839 Thermosynechococcus elongatus BP-1 DNA, compl...    32   4.7     
gb:AE017322_442540 Listeria monocytogenes str. 4b F2365, section...    32   4.7     
gb:SME591788_185940 Sinorhizobium meliloti 1021 complete chromos...    32   4.7     
pir|D98252|D98252 general stress protein 69 (gsp69) [imported] -...    32   4.7     Agrobacterium fabrum str. C58
pir|D90187|D90187 oxidoreductase [imported] - Sulfolobus solfata...    32   4.7     Saccharolobus solfataricus
sp|Q04212|YMT1_YEAST|YMT1_YEAST Hypothetical 38.2 kDa protein in SUB1-ARGR1...    32   4.7     Saccharomyces cerevisiae [brewer's yeast]
gb:AE016815_1746328 Ashbya gossypii (= Eremothecium gossypii) AT...    32   6.1     
gb:BA000040_731070 Bradyrhizobium japonicum USDA 110 DNA, comple...    32   6.1     
pir|D96011|D96011 probable oxidoreductase protein SMb20648 [impo...    32   6.1     Sinorhizobium meliloti
gb:BX572599_801763 Rhodopseudomonas palustris CGA009 complete ge...    32   8.0     
gb:BA000012_671262 Mesorhizobium loti MAFF303099 DNA, complete g...    32   8.0     
gb:AE017136_388375 Yersinia pestis biovar Medievalis str. 91001 ...    32   8.0     
pir|AF2090|AF2090 hypothetical protein all2277 [imported] - Nost...    32   8.0     Nostoc sp. PCC 7120
sp|P42972|YCSN_BACSU|YCSN_BACSU Hypothetical oxidoreductase ycsN (EC 1.-.-....    32   8.0     Bacillus subtilis
sp|P80874|GS69_BACSU|GS69_BACSU General stress protein 69 (GSP69).>pir|D698...    32   8.0     Bacillus subtilis


>pir|F84675|F84675 hypothetical protein At2g27680 [imported] -
           Arabidopsis thaliana>gb:AC005824_1533044 Arabidopsis
           thaliana chromosome 2 clone F15K20 map B68, complete
           sequence.>gb:AY078008_1567977 Arabidopsis thaliana
           At2g27680/F15K20.22 mRNA, complete
           cds.>gb:AF385689_1794583 Arabidopsis thaliana
           At2g27680/F15K20.22 mRNA, complete cds.
          Length = 384

 Score =  187 bits (474), Expect = 1e-46
 Identities = 81/102 (79%), Positives = 96/102 (94%)
 Frame = +1

Query: 232 CTAVVEEKNRTVTLKNGNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTF 411
           C+  + E +R+V LKNGNDSL+ICR+LNGMWQTSGGWG+IDRNDAV++ML++ADAGL+TF
Sbjct: 36  CSVEITEADRSVKLKNGNDSLEICRVLNGMWQTSGGWGKIDRNDAVDSMLRYADAGLSTF 95

Query: 412 DMADHYGPAEDLYGIFINKVRRERPPEYLETVRGLTKWVPPP 537
           DMADHYGPAEDLYGIFIN+VRRERPPEYLE ++GLTKWVPPP
Sbjct: 96  DMADHYGPAEDLYGIFINRVRRERPPEYLEKIKGLTKWVPPP 137



>gb:AP005558_1854040 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OJ1155_H10.
          Length = 385

 Score =  162 bits (410), Expect = 3e-39
 Identities = 72/93 (77%), Positives = 83/93 (89%)
 Frame = +1

Query: 259 RTVTLKNGNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHYGPA 438
           +  T+ N  DSL ICR+LNGMWQTSGGWGRIDR+ AV+AML +ADAGL+TFDMADHYGPA
Sbjct: 47  KVCTVSNRGDSLAICRVLNGMWQTSGGWGRIDRDAAVDAMLAYADAGLSTFDMADHYGPA 106

Query: 439 EDLYGIFINKVRRERPPEYLETVRGLTKWVPPP 537
           EDLYG+FIN+VRRERPPE LE ++GLTKWVPPP
Sbjct: 107 EDLYGLFINRVRRERPPELLEEIKGLTKWVPPP 139



>gb:AF324984_1786438 Arabidopsis thaliana At2g27680
           (At2g27680/F15K20.22) mRNA, complete cds.
          Length = 326

 Score =  126 bits (316), Expect = 2e-28
 Identities = 54/65 (83%), Positives = 64/65 (98%)
 Frame = +1

Query: 343 GRIDRNDAVEAMLKHADAGLTTFDMADHYGPAEDLYGIFINKVRRERPPEYLETVRGLTK 522
           G+IDRNDA+++ML++ADAGL+TFDMADHYGPAEDLYGIFIN+VRRERPPEYLE ++GLTK
Sbjct: 15  GKIDRNDAIDSMLRYADAGLSTFDMADHYGPAEDLYGIFINRVRRERPPEYLEKIKGLTK 74

Query: 523 WVPPP 537
           WVPPP
Sbjct: 75  WVPPP 79



>gb:BA000012_671624 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 351

 Score = 55.8 bits (133), Expect = 4e-07
 Identities = 30/78 (38%), Positives = 44/78 (56%)
 Frame = +1

Query: 298 ICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHYGPAEDLYGIFINKVRR 477
           I R++ G WQ +GG G IDR+ AV  ++   DAG+ T+D AD Y   E+L G    ++  
Sbjct: 14  ISRVIRGGWQLAGGHGAIDRSQAVTDLIATFDAGIWTYDCADIYTGVEELIGAARLRLAS 73

Query: 478 ERPPEYLETVRGLTKWVP 531
           ER  +    ++  TK VP
Sbjct: 74  ERGLDVAAKMKVHTKLVP 91



>gb:AE017231_411876 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 5 of 16 of the complete
           genome.>gb:AE016958_1055280 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 328

 Score = 40.8 bits (94), Expect = 0.013
 Identities = 17/55 (30%), Positives = 26/55 (47%)
 Frame = +1

Query: 268 TLKNGNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHYG 432
           T+  G   L++ R+  G W+    WG  D + A+  +    D G+  FD A  YG
Sbjct: 3   TITFGKTGLEVSRLAFGTWEFCSDWGHADEDAAITMIRSARDLGINFFDTAQQYG 57



>gb:SME591783_184482 Sinorhizobium meliloti 1021 complete
           chromosome; segment 2/12.
          Length = 328

 Score = 40.4 bits (93), Expect = 0.017
 Identities = 19/51 (37%), Positives = 23/51 (45%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHYG 432
           G     I  I  G WQ  G WG +   D   A+    D+G+T  D AD YG
Sbjct: 7   GRTGATISEIGFGAWQIGGSWGDVSEEDGKRALNAALDSGITFIDTADVYG 57



>pir|T35322|T35322 hypothetical protein SC5H1.06c - Streptomyces
           coelicolor>gb:SCO939131_180952 Streptomyces coelicolor
           A3(2) complete genome; segment 28/29.
          Length = 327

 Score = 39.7 bits (91), Expect = 0.029
 Identities = 16/39 (41%), Positives = 23/39 (58%)
 Frame = +1

Query: 316 GMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHYG 432
           G WQ    WG +D  +A+  +   A++G+T FD AD YG
Sbjct: 19  GTWQLGADWGDVDDKEALAVLEAAAESGVTFFDTADVYG 57



>gb:AP006627_565287 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 329

 Score = 38.9 bits (89), Expect = 0.050
 Identities = 29/92 (31%), Positives = 42/92 (45%), Gaps = 7/92 (7%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAV--EAMLKHADAGLTTFDMADHYGP----AE 441
           G   L +  I  G+WQ  G     D + A   E + +  D G+T FD+A++YGP    AE
Sbjct: 18  GKSGLKLPAISLGLWQNFGA----DTSQAKVKEKIFRAFDLGITHFDLANNYGPPPGSAE 73

Query: 442 DLYGIFIN-KVRRERPPEYLETVRGLTKWVPP 534
              G  +N ++ R R    + T  G   W  P
Sbjct: 74  AAMGTILNSELNRYRDELIISTKAGYDMWPGP 105



>gb:AE016822_341091 Leifsonia xyli subsp. xyli str. CTCB07, complete
           genome.
          Length = 346

 Score = 38.5 bits (88), Expect = 0.065
 Identities = 28/98 (28%), Positives = 46/98 (46%), Gaps = 5/98 (5%)
 Frame = +1

Query: 256 NRTVTLKNGNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHYGP 435
           +R +  + G   LD+  +  G+WQ  G    ++   A+  + +  D G+T FD+A++YGP
Sbjct: 11  DRMLYRRTGRSGLDLPVLSLGLWQNFGDDRPLETQRAI--VRRAFDLGITHFDLANNYGP 68

Query: 436 ----AEDLYG-IFINKVRRERPPEYLETVRGLTKWVPP 534
               AE  +G I    +R  R    L +  G   W  P
Sbjct: 69  PYGAAETAFGRILKEDLRPYRDEIVLSSKAGWDMWPGP 106



>gb:BX294154_771620 Pirellula sp. strain 1 complete genome; segment
           22/24.
          Length = 332

 Score = 38.1 bits (87), Expect = 0.085
 Identities = 30/96 (31%), Positives = 44/96 (45%), Gaps = 10/96 (10%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHA-DAGLTTFDMADHYGP--AEDLY 450
           G+D   + R+  G W   G WG  D ++A  A L+HA + G+T  D A  YG   +E + 
Sbjct: 7   GHDGFPVSRLGFGGWALGGQWGAQD-DEASLAALQHAIEHGITFIDTAPGYGDGRSEQVI 65

Query: 451 GIFINKVRRERPPEYLETVRGLTK-------WVPPP 537
           G F+    ++ P    E +   TK       W P P
Sbjct: 66  GQFL----KQLPASIREKIHVATKTPPSEGPWPPSP 97



>gb:CR382133_1666927 Debaryomyces hansenii chromosome A of strain
           CBS767 of Debaryomyces hansenii.
          Length = 347

 Score = 37.0 bits (84), Expect = 0.19
 Identities = 31/77 (40%), Positives = 37/77 (48%), Gaps = 7/77 (9%)
 Frame = +1

Query: 274 KNGNDSLDICRILNGMWQTSG---GWGRIDRNDAVEAMLKHADAGLTTFDMADHY--GPA 438
           K G   L I  I+ G   T G    WG  +    +E + K  D GL TFD AD Y  G +
Sbjct: 8   KLGASGLSISPIIIGC-MTFGDFHSWGITEEETVMEILKKCYDKGLRTFDTADVYSNGKS 66

Query: 439 EDLYGIFINK--VRRER 483
           E L G FI K  + RER
Sbjct: 67  EILLGKFIRKYNIPRER 83



>gb:BA000012_667897 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 306

 Score = 36.6 bits (83), Expect = 0.25
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 2/68 (2%)
 Frame = +1

Query: 286 DSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHYG--PAEDLYGIF 459
           D + + R++ G W+   G  R D +     +    D GLT+FD AD YG    E  +G  
Sbjct: 12  DGVSLSRLVFGAWRLLDGGVRPDADQVARLIGTAVDLGLTSFDHADIYGNYEVEAAFGAG 71

Query: 460 INKVRRER 483
           +++ R +R
Sbjct: 72  LSRWRGKR 79



>gb:AE008808_244078 Salmonella typhimurium LT2, section 112 of 220
           of the complete genome.>gb:AE006468_1001160 Salmonella
           typhimurium LT2, complete genome.
          Length = 332

 Score = 36.6 bits (83), Expect = 0.25
 Identities = 28/104 (26%), Positives = 48/104 (46%), Gaps = 9/104 (8%)
 Frame = +1

Query: 250 EKNRTVTLKN---GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHA-DAGLTTFDM 417
           ++NR  T++    G   + +  I  G+W   G   R++ +    A+L+ A D G+T FD+
Sbjct: 6   DENRYHTMEYRRCGRSGVKLPAISLGLWHNFGDTTRVENS---RALLQRAFDLGITHFDL 62

Query: 418 ADHYGPAEDLYGIFINKVRRE-----RPPEYLETVRGLTKWVPP 534
           A++YGP          ++ +E     R    + T  G T W  P
Sbjct: 63  ANNYGPPPGSAECNFGRILQEDFLPWRDELIISTKAGYTMWDGP 106



>gb:STY401270_194137 Salmonella typhimurium partial ORFA, ipd gene,
           ORFB and ORFC.
          Length = 149

 Score = 36.6 bits (83), Expect = 0.25
 Identities = 28/104 (26%), Positives = 48/104 (46%), Gaps = 9/104 (8%)
 Frame = +1

Query: 250 EKNRTVTLKN---GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHA-DAGLTTFDM 417
           ++NR  T++    G   + +  I  G+W   G   R++ +    A+L+ A D G+T FD+
Sbjct: 6   DENRYHTMEYRRCGRSGVKLPAISLGLWHNFGDTTRVENS---RALLQRAFDLGITHFDL 62

Query: 418 ADHYGPAEDLYGIFINKVRRE-----RPPEYLETVRGLTKWVPP 534
           A++YGP          ++ +E     R    + T  G T W  P
Sbjct: 63  ANNYGPPPGSAECNFGRILQEDFLPWRDELIISTKAGYTMWDGP 106



>gb:CP000026_75343 Salmonella enterica subsp. enterica serovar
           Paratypi A str. ATCC 9150.
          Length = 332

 Score = 36.6 bits (83), Expect = 0.25
 Identities = 28/104 (26%), Positives = 48/104 (46%), Gaps = 9/104 (8%)
 Frame = +1

Query: 250 EKNRTVTLKN---GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHA-DAGLTTFDM 417
           ++NR  T++    G   + +  I  G+W   G   R++ +    A+L+ A D G+T FD+
Sbjct: 6   DENRYHTMEYRRCGRSGVKLPAISLGLWHNFGDTTRVENS---RALLQRAFDLGITHFDL 62

Query: 418 ADHYGPAEDLYGIFINKVRRE-----RPPEYLETVRGLTKWVPP 534
           A++YGP          ++ +E     R    + T  G T W  P
Sbjct: 63  ANNYGPPPGSAECNFGRILQEDFLPWRDELVISTKAGYTMWDGP 106



>pir|AB0808|AB0808 probable ion-channel protein STY2647 [imported] -
           Salmonella enterica subsp. enterica serovar Typhi
           (strain CT18)>gb:AE016835_344630 Salmonella enterica
           subsp. enterica serovar Typhi Ty2, section 2 of 16 of
           the complete genome.>gb:AL627274_542778 Salmonella
           enterica serovar Typhi (Salmonella typhi) strain CT18,
           complete chromosome; segment 10/20.>gb:AE014613_981962
           Salmonella enterica subsp. enterica serovar Typhi Ty2,
           complete genome.
          Length = 332

 Score = 36.6 bits (83), Expect = 0.25
 Identities = 28/104 (26%), Positives = 48/104 (46%), Gaps = 9/104 (8%)
 Frame = +1

Query: 250 EKNRTVTLKN---GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHA-DAGLTTFDM 417
           ++NR  T++    G   + +  I  G+W   G   R++ +    A+L+ A D G+T FD+
Sbjct: 6   DENRYHTMEYRRCGRSGVKLPAISLGLWHNFGDTTRVENS---RALLQRAFDLGITHFDL 62

Query: 418 ADHYGPAEDLYGIFINKVRRE-----RPPEYLETVRGLTKWVPP 534
           A++YGP          ++ +E     R    + T  G T W  P
Sbjct: 63  ANNYGPPPGSAECNFGRILQEDFLPWRDELVISTKAGYTMWDGP 106



>gb:AE016937_362046 Bacteroides thetaiotaomicron VPI-5482, section
           12 of 21 of the complete genome.>gb:AE015928_988534
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 335

 Score = 36.2 bits (82), Expect = 0.32
 Identities = 27/91 (29%), Positives = 41/91 (45%), Gaps = 6/91 (6%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHA-DAGLTTFDMADHYGP----AED 444
           G   L +  I  G+W     +G +D       M+K+A D G+T FD+A++YGP    AE 
Sbjct: 23  GKSGLQLPLISLGLWHN---FGSVDNFSVATDMIKYAFDHGITHFDLANNYGPVPGSAET 79

Query: 445 LYG-IFINKVRRERPPEYLETVRGLTKWVPP 534
            +G I     +  R    + +  G   W  P
Sbjct: 80  NFGRILKENFQGYRDEMIISSKAGHDMWAGP 110



>gb:AL935262_552921 Lactobacillus plantarum strain WCFS1 complete
           genome; segment 11/11.
          Length = 340

 Score = 35.8 bits (81), Expect = 0.42
 Identities = 27/91 (29%), Positives = 43/91 (47%), Gaps = 6/91 (6%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHA-DAGLTTFDMADHYGP----AED 444
           GN  L +  I  G+W     +G +D     +A++  A D G+T +D+A++YGP    AE 
Sbjct: 18  GNSGLKLSAIGLGLWNN---FGSVDPIANQKAIIHQAFDLGITYYDLANNYGPEPGSAET 74

Query: 445 LYG-IFINKVRRERPPEYLETVRGLTKWVPP 534
            +G I    +R  R    + +  G   W  P
Sbjct: 75  NFGRIMATDMRPYRDEMVIASKAGYVMWPGP 105



>gb:SAU421825_172269 Stigmatella aurantiaca ORF8, ORF7, ORF6, ORF5,
           ORF4, ORF3, ORF2, ORF1, stiA gene, stiB gene, stiC gene,
           stiD gene, stiE gene, stiF gene, stiG gene, stiH gene,
           stiJ gene, stiK gene, stiL gene and ORF9.
          Length = 369

 Score = 35.8 bits (81), Expect = 0.42
 Identities = 24/69 (34%), Positives = 33/69 (47%), Gaps = 2/69 (2%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHYG--PAEDLYG 453
           G   L +  I  G W T G   +++   AV  +    D G+TTFD AD Y    AE++ G
Sbjct: 42  GRSGLMVSEISYGNWLTHGS--QVEEAAAVACVRAALDEGITTFDTADVYAGTRAEEVLG 99

Query: 454 IFINKVRRE 480
             +   RRE
Sbjct: 100 RALQGQRRE 108



>gb:CR543861_104915 Acinetobacter sp. ADP1 complete genome.
          Length = 352

 Score = 35.4 bits (80), Expect = 0.55
 Identities = 23/74 (31%), Positives = 34/74 (45%), Gaps = 8/74 (10%)
 Frame = +1

Query: 280 GNDSLDICRI------LNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHY--GP 435
           GN  L +  +      L G  Q    WG+ D+N+A   +    DAG+  FD AD Y  G 
Sbjct: 11  GNSGLQVSELGFGAGTLGGKGQIFSAWGQPDQNEANRLIKICLDAGINYFDTADVYSDGA 70

Query: 436 AEDLYGIFINKVRR 477
           +E + G  +   R+
Sbjct: 71  SETMLGRGLGSERK 84



>pir|E85959|E85959 probable reductase Z4354 [imported] - Escherichia
           coli  (strain O157:H7, substrain
           EDL933)>gb:AE005174_68136 Escherichia coli O157:H7
           EDL933, complete genome.
          Length = 346

 Score = 35.4 bits (80), Expect = 0.55
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 6/91 (6%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHA-DAGLTTFDMADHYGP----AED 444
           G   L +  +  G+W     +G ++  ++  A+L+ A D G+T FD+A++YGP    AE+
Sbjct: 19  GKSGLRLPALSLGLWHN---FGHVNALESQRAILRKAFDLGITHFDLANNYGPPPGSAEE 75

Query: 445 LYGIFINK-VRRERPPEYLETVRGLTKWVPP 534
            +G  + +     R    + T  G   W  P
Sbjct: 76  NFGRLLREDFAAYRDELIISTXAGYDMWPGP 106



>gb:CP000009_862317 Gluconobacter oxydans 621H, complete genome.
          Length = 281

 Score = 35.0 bits (79), Expect = 0.72
 Identities = 25/74 (33%), Positives = 39/74 (52%), Gaps = 2/74 (2%)
 Frame = +1

Query: 259 RTVTLKNGNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHY--G 432
           +TVTL+NG   + +  +  G W       R  R+D +E++ +  +AGL   D A+ Y  G
Sbjct: 2   KTVTLRNG---VTVPALGMGTWNIGDSAAR--RSDEIESLRQGLEAGLRVVDTAEMYGNG 56

Query: 433 PAEDLYGIFINKVR 474
            +E+L G  I  VR
Sbjct: 57  RSEELVGEAIADVR 70



>gb:AE017333_447246 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_857058 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 330

 Score = 35.0 bits (79), Expect = 0.72
 Identities = 25/90 (27%), Positives = 40/90 (44%), Gaps = 5/90 (5%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHYGP----AEDL 447
           G+  L +  +  G+W   G    +    A+  + K  D G+T FD+A++YGP    AE+ 
Sbjct: 19  GHSGLKLPALSLGLWHNFGEAASLQNAKAL--LRKAFDLGITHFDLANNYGPPPGSAEET 76

Query: 448 YGIFI-NKVRRERPPEYLETVRGLTKWVPP 534
           +G  +       R    + T  G T W  P
Sbjct: 77  FGKALKTDFAGYRDEMVISTKAGYTMWPGP 106



>gb:AE016766_327720 Escherichia coli CFT073 section 12 of 18 of the
           complete genome.>gb:AE014075_958304 Escherichia coli
           CFT073 complete genome.
          Length = 346

 Score = 35.0 bits (79), Expect = 0.72
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 6/91 (6%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHA-DAGLTTFDMADHYGP----AED 444
           G   L +  +  G+W     +G ++  ++  A+L+ A D G+T FD+A++YGP    AE+
Sbjct: 19  GKSGLRLPALSLGLWHN---FGHVNALESQRAILRKAFDLGITHFDLANNYGPPPGSAEE 75

Query: 445 LYGIFINK-VRRERPPEYLETVRGLTKWVPP 534
            +G  + +     R    + T  G   W  P
Sbjct: 76  NFGRLLREDFAAYRDELIISTKAGYDMWPGP 106



>gb:AE005674_72631 Shigella flexneri 2a str. 301, complete
           genome.>gb:AE016988_372784 Shigella flexneri 2a str.
           2457T section 11 of 16 of the complete
           genome.>gb:AE014073_997534 Shigella flexneri 2a str.
           2457T complete genome.
          Length = 346

 Score = 35.0 bits (79), Expect = 0.72
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 6/91 (6%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHA-DAGLTTFDMADHYGP----AED 444
           G   L +  +  G+W     +G ++  ++  A+L+ A D G+T FD+A++YGP    AE+
Sbjct: 19  GKSGLRLPALSLGLWHN---FGHVNALESQRAILRKAFDLGITHFDLANNYGPPPGSAEE 75

Query: 445 LYGIFINK-VRRERPPEYLETVRGLTKWVPP 534
            +G  + +     R    + T  G   W  P
Sbjct: 76  NFGRLLREDFAAYRDELIISTKAGYDMWPGP 106



>pir|G84352|G84352 general stress protein 69 [imported] -
           Halobacterium sp. NRC-1>gb:AE005096_63347 Halobacterium
           sp. NRC-1 section 127 of 170 of the complete
           genome.>gb:AE004437_888266 Halobacterium sp. NRC-1
           complete genome.
          Length = 352

 Score = 35.0 bits (79), Expect = 0.72
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 3/61 (4%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQT-SGGWGRIDRNDAVEAMLKHADAGLTTFDMADHY--GPAEDLY 450
           G+  +++  +  G W   +  WG  D +DA+E +    D G+T FD  D Y  G +E+L 
Sbjct: 7   GDSGVEVSEVGFGAWVVGTDWWGDRDEDDALEMVEYALDHGITYFDTGDVYGHGRSEELL 66

Query: 451 G 453
           G
Sbjct: 67  G 67



>sp|Q46851|YGHZ_ECOLI Hypothetical protein yghZ.>pir|G65086|G65086
           hypothetical protein b3001 - Escherichia coli (strain
           K-12)>gb:ECU28377_133737 Escherichia coli K-12 genome;
           approximately 65 to 68 minutes.>gb:U00096_202018
           Escherichia coli K-12 MG1655 complete genome.
          Length = 346

 Score = 35.0 bits (79), Expect = 0.72
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 6/91 (6%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHA-DAGLTTFDMADHYGP----AED 444
           G   L +  +  G+W     +G ++  ++  A+L+ A D G+T FD+A++YGP    AE+
Sbjct: 19  GKSGLRLPALSLGLWHN---FGHVNALESQRAILRKAFDLGITHFDLANNYGPPPGSAEE 75

Query: 445 LYGIFINK-VRRERPPEYLETVRGLTKWVPP 534
            +G  + +     R    + T  G   W  P
Sbjct: 76  NFGRLLREDFAAYRDELIISTKAGYDMWPGP 106



>sp|Q8X529|YGHZ_ECO57 Hypothetical protein yghZ.>pir|E91114|E91114
           probable reductase [imported] - Escherichia coli (strain
           O157:H7, substrain RIMD 0509952)>gb:BA000007_661897
           Escherichia coli O157:H7 DNA, complete genome.
          Length = 346

 Score = 35.0 bits (79), Expect = 0.72
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 6/91 (6%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHA-DAGLTTFDMADHYGP----AED 444
           G   L +  +  G+W     +G ++  ++  A+L+ A D G+T FD+A++YGP    AE+
Sbjct: 19  GKSGLRLPALSLGLWHN---FGHVNALESQRAILRKAFDLGITHFDLANNYGPPPGSAEE 75

Query: 445 LYGIFINK-VRRERPPEYLETVRGLTKWVPP 534
            +G  + +     R    + T  G   W  P
Sbjct: 76  NFGRLLREDFAAYRDELIISTKAGYDMWPGP 106



>gb:CP000011_868181 Burkholderia mallei ATCC 23344 chromosome 2,
           complete sequence.
          Length = 323

 Score = 34.7 bits (78), Expect = 0.94
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 2/60 (3%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHY--GPAEDLYG 453
           G   L +  +  G W T G   ++DR  A E++    DAG+  FD A+ Y  G +E++ G
Sbjct: 7   GRSGLQVSELSIGSWVTYGN--QVDRRAARESLAAARDAGVNFFDNAEVYAGGKSEEIMG 64



>gb:BX571966_793589 Burkholderia pseudomallei strain K96243,
           chromosome 2, complete sequence.
          Length = 323

 Score = 34.7 bits (78), Expect = 0.94
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 2/60 (3%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHY--GPAEDLYG 453
           G   L +  +  G W T G   ++DR  A E++    DAG+  FD A+ Y  G +E++ G
Sbjct: 7   GRSGLQVSELSIGSWVTYGN--QVDRRAARESLAAARDAGVNFFDNAEVYAGGKSEEIMG 64



>gb:AE013753_299815 Yersinia pestis KIM section 153 of 415 of the
           complete genome.>gb:AE009952_929998 Yersinia pestis KIM
           complete genome.
          Length = 329

 Score = 34.7 bits (78), Expect = 0.94
 Identities = 26/90 (28%), Positives = 44/90 (48%), Gaps = 5/90 (5%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHYGP----AEDL 447
           G+  L +  I  G+W   G   R + + ++  + +  D G+T FD+A++YGP    AE  
Sbjct: 19  GHSGLKLPAISLGLWHNFGDSTRYENSRSL--IHRAFDHGITHFDLANNYGPPPGSAELN 76

Query: 448 YG-IFINKVRRERPPEYLETVRGLTKWVPP 534
           +G I   ++R  R    + +  G T W  P
Sbjct: 77  FGRILQQELRPYRDELIIASKAGYTMWPGP 106



>gb:AE009819_256073 Pyrobaculum aerophilum strain IM2 section 74 of
           201 of the complete genome.>gb:AE009441_898699
           Pyrobaculum aerophilum strain IM2 complete genome.
          Length = 314

 Score = 34.7 bits (78), Expect = 0.94
 Identities = 23/79 (29%), Positives = 36/79 (45%)
 Frame = +1

Query: 289 SLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHYGPAEDLYGIFINK 468
           SL++ +I  G WQ  GG  R+D  +   A     D G+   D A+ YG  +     F+ +
Sbjct: 5   SLEVGKIGLGAWQAGGGAWRVDFAELKRAYEYALDHGIKFIDTAEVYGSGKS--EEFVAE 62

Query: 469 VRRERPPEYLETVRGLTKW 525
           + R RP   + T    + W
Sbjct: 63  LIRNRPHVVVATKVAGSNW 81



>pir|AE1085|AE1085 oxidoreductases homolog lmo0084 [imported] -
           Listeria monocytogenes (strain EGD-e)>gb:AL591973_534576
           Listeria monocytogenes strain EGD, complete genome,
           segment 1/12.
          Length = 327

 Score = 34.7 bits (78), Expect = 0.94
 Identities = 17/36 (47%), Positives = 23/36 (63%), Gaps = 2/36 (5%)
 Frame = +1

Query: 352 DRNDAVEAMLKHADAGLTTFDMADHYGP--AEDLYG 453
           DRN+ +E +    DAG+T FD A+ YGP   E+L G
Sbjct: 32  DRNEMIEVVRTAMDAGITMFDTAEVYGPYTNEELVG 67



>gb:AY596297_634116 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 350

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 23/71 (32%), Positives = 39/71 (54%), Gaps = 4/71 (5%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQT-SGGWGRIDRNDAVEAMLKHA-DAGLTTFDMADHY--GPAEDL 447
           GN  +++  +  G W   +  WG   R+DA++ M++HA D  +T FD  D Y  G +E++
Sbjct: 7   GNSGVEVSEVGFGAWVVGTDWWGDRTRDDAID-MVQHALDEDVTFFDTGDVYGHGDSEEI 65

Query: 448 YGIFINKVRRE 480
            G  + + R E
Sbjct: 66  IGEALAEHRDE 76



>gb:AE011965_278114 Xanthomonas axonopodis pv. citri str. 306,
           section 343 of 469 of the complete
           genome.>gb:AE008923_919889 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 346

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 28/91 (30%), Positives = 39/91 (42%), Gaps = 6/91 (6%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHA-DAGLTTFDMADHYGPAEDLYGI 456
           G   L +  +  G+W   G    ID      A+L+ A D G+T FD+A++YGP      I
Sbjct: 19  GRSGLVLPALSLGLWHNFGDSTPIDTQ---RALLRTAFDLGITHFDLANNYGPPYGSAEI 75

Query: 457 FINKVRRE-----RPPEYLETVRGLTKWVPP 534
              ++ RE     R    L T  G   W  P
Sbjct: 76  NFGRLLREDFKPYRDELILSTKAGWDMWPGP 106



>gb:LLU60828_141162 Lactococcus lactis galactose-lactose operon,
           complete sequence.
          Length = 334

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 27/91 (29%), Positives = 42/91 (46%), Gaps = 6/91 (6%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHA-DAGLTTFDMADHYGP----AED 444
           GN  L +  +  G+W     +G +D  +    M+  A D G+T FD+A++YGP    AE 
Sbjct: 19  GNSGLLLPALSLGLWHN---FGSVDDFENARDMIHTAFDLGITHFDLANNYGPEPGSAER 75

Query: 445 LYG-IFINKVRRERPPEYLETVRGLTKWVPP 534
            +G I     ++ R    + T  G   W  P
Sbjct: 76  NFGRILKEDFQKLRDELIISTKAGYPMWPGP 106



>pir|B86873|B86873 oxidoreductase yugB [imported] - Lactococcus
           lactis subsp. lactis (strain IL1403)>gb:AE006429_218888
           Lactococcus lactis subsp. lactis IL1403 section 191 of
           218 of the complete genome.>gb:AE005176_1095961
           Lactococcus lactis subsp. lactis IL1403, complete
           genome.
          Length = 287

 Score = 34.3 bits (77), Expect = 1.2
 Identities = 27/91 (29%), Positives = 42/91 (46%), Gaps = 6/91 (6%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHA-DAGLTTFDMADHYGP----AED 444
           GN  L +  +  G+W     +G +D  +    M+  A D G+T FD+A++YGP    AE 
Sbjct: 19  GNSGLLLPALSLGLWHN---FGSVDDFENARDMIHTAFDLGITHFDLANNYGPEPGSAER 75

Query: 445 LYG-IFINKVRRERPPEYLETVRGLTKWVPP 534
            +G I     ++ R    + T  G   W  P
Sbjct: 76  NFGRILKEDFQKLRDELIISTKAGYPMWPGP 106



>gb:AE014295_311677 Bifidobacterium longum NCC2705, complete genome.
          Length = 336

 Score = 33.9 bits (76), Expect = 1.6
 Identities = 26/91 (28%), Positives = 42/91 (46%), Gaps = 6/91 (6%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHA-DAGLTTFDMADHYGP----AED 444
           G   L +  +  G W     +G I   D +++++  A D G+T FD+A++YGP    AE 
Sbjct: 24  GTSGLKLPAVSLGFWHN---FGDITPFDQMKSLVFTAFDNGITHFDLANNYGPEPGQAEK 80

Query: 445 LYGIFINK-VRRERPPEYLETVRGLTKWVPP 534
             G+ + K  +  R    + T  G   W  P
Sbjct: 81  NCGLLLAKYFKHHRDELVISTKAGYEMWTGP 111



>pir|AE0362|AE0362 probable ion channel protein YPO2980 [imported] -
           Yersinia pestis (strain CO92)>gb:AJ414154_524754
           Yersinia pestis strain CO92 complete genome; segment
           14/20.
          Length = 329

 Score = 33.9 bits (76), Expect = 1.6
 Identities = 26/90 (28%), Positives = 43/90 (47%), Gaps = 5/90 (5%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHYGP----AEDL 447
           G+  L +  I  G+W   G   R + + ++  + +  D G+T FD+A++YGP    AE  
Sbjct: 19  GHSGLKLPAISLGLWHNFGDSTRYENSRSL--IHRAFDHGITHFDLANNYGPPPGSAELN 76

Query: 448 YG-IFINKVRRERPPEYLETVRGLTKWVPP 534
           +G I    +R  R    + +  G T W  P
Sbjct: 77  FGRILQQDLRPYRDELIIASKAGYTMWPGP 106



>pir|AH2062|AH2062 aldo/keto reductase [imported] - Nostoc sp.
           (strain PCC 7120)>gb:BA000019_683043 Nostoc sp. PCC 7120
           DNA, complete genome.
          Length = 319

 Score = 33.9 bits (76), Expect = 1.6
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 1/52 (1%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGG-WGRIDRNDAVEAMLKHADAGLTTFDMADHYG 432
           G   + I  IL G WQ     W  I+  D+++ +    +AG+TT D A+ YG
Sbjct: 7   GTSDVKISPILMGTWQAGKKMWVGIEDADSIKTIRAAFEAGITTIDTAEVYG 58



>gb:BX936398_837346 Yersinia pseudotuberculosis IP32953 genome,
           complete sequence.
          Length = 329

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 26/90 (28%), Positives = 42/90 (46%), Gaps = 5/90 (5%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHYGP----AEDL 447
           G   L +  I  G+W   G   R + + ++  + +  D G+T FD+A++YGP    AE  
Sbjct: 19  GRSGLKLPAISLGLWHNFGDSTRYENSRSL--IHRAFDHGITHFDLANNYGPPPGSAELN 76

Query: 448 YG-IFINKVRRERPPEYLETVRGLTKWVPP 534
           +G I    +R  R    + +  G T W  P
Sbjct: 77  FGRILQQDLRPYRDELIIASKAGYTMWPGP 106



>gb:AF333038_502291 Streptomyces viridochromogenes Avilamycin A
           biosynthetic gene cluster, complete sequence.
          Length = 330

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 18/51 (35%), Positives = 24/51 (47%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHYG 432
           G    ++  +  G W  SG WG      AVEA+ +  D G+  FD A  YG
Sbjct: 7   GRQGPEVSSVCLGTWALSGFWGS-RTEPAVEAVRRAFDLGVNFFDTAHAYG 56



>pir|AC2764|AC2764 conserved hypothetical protein Atu1524 [imported]
           - Agrobacterium tumefaciens (strain C58,
           Dupont)>gb:AE009111_248556 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 137 of 256 of the
           complete sequence.>gb:AE008688_1086399 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.
          Length = 343

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 29/103 (28%), Positives = 46/103 (44%), Gaps = 9/103 (8%)
 Frame = +1

Query: 253 KNRTVTLKN---GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHA-DAGLTTFDMA 420
           +NR  ++K    G   L +  I  G+W     +G    +   +A+ + A D G+T FD+A
Sbjct: 7   ENRYASMKYNHCGKTGLKLPAISLGLWHN---FGNDTPHQTKQAICRRAFDLGITHFDLA 63

Query: 421 DHYGP----AEDLYG-IFINKVRRERPPEYLETVRGLTKWVPP 534
           ++YGP    AE  +G I     R  R    + +  G   W  P
Sbjct: 64  NNYGPPPGSAETAFGEILKTDFRGYRDEMIISSKAGYNMWPGP 106



>pir|B95902|B95902 probable aldoketo reductase protein [imported] -
           Sinorhizobium meliloti (strain 1021) magaplasmid
           pSymB>gb:RME591985_165130 Sinorhizobium meliloti 1021
           complete pSymB.
          Length = 331

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 3/49 (6%)
 Frame = +1

Query: 316 GMWQTSGG-WGRIDRNDAVEAMLKHADAGLTTFDMADHY--GPAEDLYG 453
           G W   G  WG  D  ++V A+    DAG+T  D A  Y  G AE++ G
Sbjct: 23  GTWAIGGWMWGGTDERESVAAIQASLDAGVTLIDTAPAYGLGRAEEIVG 71



>pir|H90466|H90466 oxidoreductase [imported] - Sulfolobus
           solfataricus>gb:AE006881_223606 Sulfolobus solfataricus
           P2 section 240 of 272 of the complete
           genome.>gb:AE006641_1109454 Sulfolobus solfataricus P2,
           complete genome.
          Length = 304

 Score = 33.5 bits (75), Expect = 2.1
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 2/63 (3%)
 Frame = +1

Query: 298 ICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHYGP--AEDLYGIFINKV 471
           I  ++ G W+  G    ID N+A++A+ +  + G+   D A+ YG   +E + G  I+K 
Sbjct: 13  ISPLILGSWEF-GTPSIIDENNAIKAIQRAIELGINAIDTAESYGNGLSETIIGRAISKF 71

Query: 472 RRE 480
           +RE
Sbjct: 72  KRE 74



>gb:AP003328_1827944 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1040D09.
          Length = 344

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 22/78 (28%), Positives = 40/78 (51%), Gaps = 1/78 (1%)
 Frame = +1

Query: 271 LKNGNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHA-DAGLTTFDMADHYGPAEDL 447
           +K G   L++ ++  G    +G +     +DA  A++ HA   G+T FD +D YGP  + 
Sbjct: 13  VKLGTRGLEVSKLGFGCMGLTGAYNSPLDDDAGAAVIAHAFRRGVTFFDTSDVYGPLAN- 71

Query: 448 YGIFINKVRRERPPEYLE 501
             I + K  ++ P E ++
Sbjct: 72  -EILLGKALKQLPREQVQ 88



>gb:AF359360_1791017 Fusarium sporotrichioides trichothecene gene
           cluster, complete sequence.
          Length = 441

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 22/60 (36%), Positives = 28/60 (46%)
 Frame = -3

Query: 531 WHPFGKTSDSFQIFWGSLSAYFVDEDAIKIFCRSIVVGHVESGETGVGVFEHSLNGVVSV 352
           W P  KT      F+GSL    + ED I+  CR I       G+ GV V+ H L G + V
Sbjct: 325 WGPPMKTKLPTLAFFGSLVVGIIIEDTIQALCRRITGEKRRDGDDGVPVW-HKLVGYIWV 383



>gb:AX067087_1460446 Sequence 669 from Patent WO0100805.
          Length = 290

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 26/92 (28%), Positives = 41/92 (44%), Gaps = 7/92 (7%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHA--DAGLTTFDMADHYGP----AE 441
           GN  L +  I  G+W   G     D+  + +  + H   D G+T FD+A++YGP    AE
Sbjct: 7   GNSGLKLPAISLGLWHNFGD----DKPLSTQRSIIHRAFDRGVTHFDLANNYGPPAGSAE 62

Query: 442 DLYG-IFINKVRRERPPEYLETVRGLTKWVPP 534
             +G I    ++  R    + +  G   W  P
Sbjct: 63  TNFGRILREDLKSHRDELIISSKAGWDMWPGP 94



>gb:BX927151_832843 Corynebacterium glutamicum ATCC 13032, IS
           fingerprint type 4-5, complete genome; segment
           4/10.>gb:AX813971_1475705 Sequence 211 from Patent
           WO03040292.
          Length = 361

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 26/92 (28%), Positives = 41/92 (44%), Gaps = 7/92 (7%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHA--DAGLTTFDMADHYGP----AE 441
           GN  L +  I  G+W   G     D+  + +  + H   D G+T FD+A++YGP    AE
Sbjct: 22  GNSGLKLPAISLGLWHNFGD----DKPLSTQRSIIHRAFDRGVTHFDLANNYGPPAGSAE 77

Query: 442 DLYG-IFINKVRRERPPEYLETVRGLTKWVPP 534
             +G I    ++  R    + +  G   W  P
Sbjct: 78  TNFGRILREDLKSHRDELIISSKAGWDMWPGP 109



>gb:AE017355_463156 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.
          Length = 300

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 25/87 (28%), Positives = 44/87 (50%), Gaps = 3/87 (3%)
 Frame = +1

Query: 286 DSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHYG--PAEDLYGIF 459
           ++L+  RI+ G W+ +  W  + + + +  +    D G+TTFD AD YG    E L+G  
Sbjct: 8   ETLEFSRIIQGFWRLAE-WN-MTKQELLSFIEDCMDMGITTFDHADIYGGYTCEGLFGEA 65

Query: 460 INKVRRERPPEYLETVRGLTK-WVPPP 537
           +     +  P   E ++ +TK  + PP
Sbjct: 66  L-----QLKPSLRENMQIITKCGIAPP 87



>gb:AE017271_423320 Bacillus cereus ATCC 10987, section 8 of 18 of
           the complete genome.>gb:AE017194_1061739 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 300

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 25/87 (28%), Positives = 44/87 (50%), Gaps = 3/87 (3%)
 Frame = +1

Query: 286 DSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHYG--PAEDLYGIF 459
           ++L+  RI+ G W+ +  W  + + + +  +    D G+TTFD AD YG    E L+G  
Sbjct: 8   ETLEFSRIIQGFWRLAE-WN-MTKQELLSFIEDCMDMGITTFDHADIYGGYTCEGLFGEA 65

Query: 460 INKVRRERPPEYLETVRGLTK-WVPPP 537
           +     +  P   E ++ +TK  + PP
Sbjct: 66  L-----QLKPSLRENMQIITKSGIAPP 87



>gb:AE017030_382152 Bacillus anthracis str. Ames section 7 of 18 of
           the complete genome.>gb:AE017225_407269 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_452000 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:CP000001_852447 Bacillus
           cereus ZK, complete genome.>gb:AE016879_1011857 Bacillus
           anthracis str. Ames complete genome.
          Length = 300

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 25/87 (28%), Positives = 44/87 (50%), Gaps = 3/87 (3%)
 Frame = +1

Query: 286 DSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHYG--PAEDLYGIF 459
           ++L+  RI+ G W+ +  W  + + + +  +    D G+TTFD AD YG    E L+G  
Sbjct: 8   ETLEFSRIIQGFWRLAE-WN-MTKQELLSFIEDCMDMGITTFDHADIYGGYTCEGLFGEA 65

Query: 460 INKVRRERPPEYLETVRGLTK-WVPPP 537
           +     +  P   E ++ +TK  + PP
Sbjct: 66  L-----QLKPSLRENMQIITKCGIAPP 87



>gb:AE017004_376943 Bacillus cereus ATCC 14579 section 7 of 18 of
           the complete genome.>gb:AE016877_1017193 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 300

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 25/87 (28%), Positives = 44/87 (50%), Gaps = 3/87 (3%)
 Frame = +1

Query: 286 DSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHYG--PAEDLYGIF 459
           ++L+  RI+ G W+ +  W  + + + +  +    D G+TTFD AD YG    E L+G  
Sbjct: 8   ETLEFSRIIQGFWRLAE-WN-MTKQELLSFIEDCMDMGITTFDHADIYGAYTCEGLFGEA 65

Query: 460 INKVRRERPPEYLETVRGLTK-WVPPP 537
           +     +  P   E ++ +TK  + PP
Sbjct: 66  L-----QLKPSLRENMQIITKCGIAPP 87



>gb:AE016857_349807 Pseudomonas syringae pv. tomato str. DC3000
           section 2 of 21 of the complete
           genome.>gb:AE016853_1034982 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 345

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 27/93 (29%), Positives = 42/93 (45%), Gaps = 6/93 (6%)
 Frame = +1

Query: 274 KNGNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHA-DAGLTTFDMADHYGP----A 438
           + G   L +  +  G+W   G    ID      AML+ A D G+  FD+A++YGP    A
Sbjct: 17  RTGRSGLVLPALSLGLWHNFGDSTPIDTQ---RAMLRTAFDLGINHFDLANNYGPPYGSA 73

Query: 439 EDLYGIFINK-VRRERPPEYLETVRGLTKWVPP 534
           E  +G  + +  +R R    + +  G   W  P
Sbjct: 74  EINFGRLLREDFKRYRDELIISSKAGWDMWPGP 106



>pir|T50285|T50285 probable oxidoreductase [imported] - fission
           yeast  (Schizosaccharomyces pombe)>gb:SPAC977_1718505
           S.pombe chromosome I cosmid c977.
          Length = 351

 Score = 33.1 bits (74), Expect = 2.7
 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 10/73 (13%)
 Frame = +1

Query: 280 GNDSLDICRILNGM--------WQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHY-- 429
           GN  L + +++ G         W+    W   D  +  + M    DAG+ TFD A+ Y  
Sbjct: 13  GNSGLKVSKLILGCMSYGKKEYWED---WVLEDEEEVFKIMKAAYDAGIRTFDTANCYSA 69

Query: 430 GPAEDLYGIFINK 468
           G +E+L G FI K
Sbjct: 70  GVSEELVGKFIRK 82



>gb:CR380959_1654042 Candida glabrata strain CBS138 chromosome M
           complete sequence.
          Length = 1446

 Score = 32.7 bits (73), Expect = 3.6
 Identities = 13/32 (40%), Positives = 19/32 (59%)
 Frame = +3

Query: 444 SLWHLHQQSTPRATPRIFGNCQRSYQMGATTS 539
           S+WHL +Q+T   +P +  N Q SY   +T S
Sbjct: 690 SIWHLQEQTTKAVSPALSSNSQFSYNSNSTKS 721



>gb:AY389593_1178228 Hyacinthus orientalis aldo/keto reductase mRNA,
           complete cds.
          Length = 209

 Score = 32.7 bits (73), Expect = 3.6
 Identities = 20/79 (25%), Positives = 39/79 (49%), Gaps = 1/79 (1%)
 Frame = +1

Query: 268 TLKNGNDSLDICRILNGMWQTSGGWGR-IDRNDAVEAMLKHADAGLTTFDMADHYGPAED 444
           T+K G   L + ++  G    +G +   I   DA+  +L     G++ FD +D YGP ++
Sbjct: 11  TVKFGTQGLQVSKLGFGCMGLTGVYNSPIHEEDAISLILYAFSHGISFFDTSDAYGPLKN 70

Query: 445 LYGIFINKVRRERPPEYLE 501
              + + K  ++ P E ++
Sbjct: 71  --EVLLGKALKQLPREKVQ 87



>gb:BX248357_762372 Corynebacterium diphtheriae gravis NCTC13129,
           complete genome; segment 4/8.
          Length = 365

 Score = 32.7 bits (73), Expect = 3.6
 Identities = 20/67 (29%), Positives = 32/67 (47%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHYGPAEDLYGIF 459
           G+  L +  I  G W   G    +    A+  + +  D G+T FD+A++YGP E    I 
Sbjct: 27  GHSGLRLPAISLGFWHNFGDDKPLANQRAI--VRRAFDRGITHFDLANNYGPPEGSAEIN 84

Query: 460 INKVRRE 480
             ++ RE
Sbjct: 85  FGRIFRE 91



>gb:BA000012_668518 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 348

 Score = 32.7 bits (73), Expect = 3.6
 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 6/91 (6%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHA-DAGLTTFDMADHYGP----AED 444
           G   L +  I  G+W     +G    +   +A+++ A D G+T FD+A++YGP    AE 
Sbjct: 19  GRSGLKLPAISLGLWHN---FGNDTPHKTKQAIVRKAFDLGITHFDLANNYGPPPGSAET 75

Query: 445 LYG-IFINKVRRERPPEYLETVRGLTKWVPP 534
            +G I        R    + T  G   W  P
Sbjct: 76  AFGEILRTDFSAYRDELIISTKAGYEMWAGP 106



>gb:AP006841_571359 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 333

 Score = 32.7 bits (73), Expect = 3.6
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 9/76 (11%)
 Frame = +1

Query: 334 GGWGRIDRNDAVEAMLKHA----DAGLTTFDMADHYGP----AEDLYGIFINK-VRRERP 486
           G W      D +   L+ A    D G+T FD+A++YGP    AE+ +G+ + K     R 
Sbjct: 35  GLWHNFGDVDTLANSLRMAHFAFDKGITHFDLANNYGPSYGSAEETFGLIMKKSFMPYRD 94

Query: 487 PEYLETVRGLTKWVPP 534
             ++ T  G   W  P
Sbjct: 95  ELFISTKAGHDMWEGP 110



>gb:AE017237_413425 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 11 of 16 of the complete
           genome.>gb:AE016958_1056829 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 308

 Score = 32.7 bits (73), Expect = 3.6
 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 3/87 (3%)
 Frame = +1

Query: 184 RAGGWKNPRGAVAVRCCTAVVEEKNRTVTLKNGNDSLDICRILNGMWQTSGG--WGR-ID 354
           R G  +   G V        + + + T+TL  G D L + R+  G  + +G   WG   D
Sbjct: 3   RRGARRGSAGTVGGVSAPQTIAQASGTLTL--GGD-LTVNRLGFGAMRLTGAGVWGPPAD 59

Query: 355 RNDAVEAMLKHADAGLTTFDMADHYGP 435
           R++ V  + +  + G+   D AD YGP
Sbjct: 60  RDECVRVLRRAVELGVNFIDTADSYGP 86



>gb:U00012_198757 Mycobacterium leprae cosmid B1308.
          Length = 118

 Score = 32.7 bits (73), Expect = 3.6
 Identities = 13/48 (27%), Positives = 26/48 (54%)
 Frame = +1

Query: 241 VVEEKNRTVTLKNGNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLK 384
           V      T+++ +GND  D+C I + +     G+ RI+  +A+  +L+
Sbjct: 61  VAGSSQNTLSIDSGNDDDDVCAIADTLGDVDAGFERIENREALSLLLE 108



>pir|H75541|H75541 probable oxidoreductase - Deinococcus radiodurans
           (strain R1)>gb:AE001886_40533 Deinococcus radiodurans R1
           section 23 of 229 of the complete chromosome
           1.>gb:AE000513_881428 Deinococcus radiodurans R1
           complete chromosome 1.
          Length = 357

 Score = 32.7 bits (73), Expect = 3.6
 Identities = 20/38 (52%), Positives = 21/38 (55%), Gaps = 1/38 (2%)
 Frame = +1

Query: 343 GRIDRNDAVEAMLKHA-DAGLTTFDMADHYGPAEDLYG 453
           GR D  D   AML  A DAGL  FD A  YG AE+  G
Sbjct: 72  GRDDLRDHTWAMLDAAWDAGLRVFDAARSYGRAEEFLG 109



>pir|B97545|B97545 hypothetical protein AGR_C_2811 [imported] -
           Agrobacterium tumefaciens (strain C58,
           Cereon)>gb:AE008076_233255 Agrobacterium tumefaciens
           str. C58 circular chromosome, section 134 of 254 of the
           complete sequence.>gb:AE007869_1082924 Agrobacterium
           tumefaciens str. C58 circular chromosome, complete
           sequence.
          Length = 331

 Score = 32.7 bits (73), Expect = 3.6
 Identities = 26/91 (28%), Positives = 40/91 (43%), Gaps = 6/91 (6%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHA-DAGLTTFDMADHYGP----AED 444
           G   L +  I  G+W     +G    +   +A+ + A D G+T FD+A++YGP    AE 
Sbjct: 7   GKTGLKLPAISLGLWHN---FGNDTPHQTKQAICRRAFDLGITHFDLANNYGPPPGSAET 63

Query: 445 LYG-IFINKVRRERPPEYLETVRGLTKWVPP 534
            +G I     R  R    + +  G   W  P
Sbjct: 64  AFGEILKTDFRGYRDEMIISSKAGYNMWPGP 94



>gb:FSU22463_1679322 Fusarium sporotrichioides T-2 toxin
           biosynthesis proteins (TRI8), (TRI7); and
           15-decalonectrin 15-O-acetyltransferase (TRI3) genes,
           complete cds.
          Length = 398

 Score = 32.3 bits (72), Expect = 4.7
 Identities = 21/57 (36%), Positives = 27/57 (47%)
 Frame = -3

Query: 531 WHPFGKTSDSFQIFWGSLSAYFVDEDAIKIFCRSIVVGHVESGETGVGVFEHSLNGV 361
           W P  KT      F+GSL    + ED I+  CR I       G+ GV V+ H L G+
Sbjct: 325 WGPPMKTKLPTLAFFGSLVVGIIIEDTIQALCRRITGEKRRDGDDGVPVW-HKLVGL 380



>gb:CR382126_1659213 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 344

 Score = 32.3 bits (72), Expect = 4.7
 Identities = 34/87 (39%), Positives = 40/87 (45%), Gaps = 6/87 (6%)
 Frame = +1

Query: 280 GNDSLDICRILNG-MWQTSGGWGRI--DRNDAVEAMLKHA-DAGLTTFDMADHY--GPAE 441
           G   L I  IL G M   S  W     D  + + + LK+  D GL TFD AD Y  G +E
Sbjct: 10  GRSGLKISPILIGCMSYGSKDWAAWVEDDKEKIFSTLKYCYDHGLRTFDTADFYSNGLSE 69

Query: 442 DLYGIFINKVRRERPPEYLETVRGLTK 522
            L G F+ K    R     ETV  LTK
Sbjct: 70  KLVGEFLKKYNIRR-----ETVVILTK 91



>gb:AE016959_1022605 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017095_1752424
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 49 of 77 of the complete sequence.
          Length = 434

 Score = 32.3 bits (72), Expect = 4.7
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 3/74 (4%)
 Frame = +1

Query: 271 LKNGNDSLDICRILNGMWQTSGGWGR-IDRNDAVEAMLKHADAGLTTFDMADHYGP--AE 441
           +K G   L++ ++  G    +G +   +   D V  + +  +AG+T FD +D YGP   E
Sbjct: 9   VKLGTQGLEVSKLGFGCMGLTGVYNAPVAEEDGVAVVRRAFEAGVTFFDTSDAYGPHTNE 68

Query: 442 DLYGIFINKVRRER 483
            L G  + ++ RE+
Sbjct: 69  VLLGKALKQLPREK 82



>gb:BA000045_741692 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 314

 Score = 32.3 bits (72), Expect = 4.7
 Identities = 26/89 (29%), Positives = 38/89 (42%), Gaps = 6/89 (6%)
 Frame = +1

Query: 268 TLKNGNDSLDICRILNGMWQTSG----GWGRIDRNDAVEAMLKHADAGLTTFDMADHY-- 429
           T + G +   I  I  G W   G    GWG +D  ++  A+    DAG+   D A  Y  
Sbjct: 3   TRRLGTNGPHITTIGFGAWAVDGPWQFGWGPVDDRESAAAIRAALDAGVNWIDTAAVYGF 62

Query: 430 GPAEDLYGIFINKVRRERPPEYLETVRGL 516
           G +E + G     V+  R   ++ T  GL
Sbjct: 63  GHSEKIVG---EAVKGRRDEVFIATKCGL 88



>gb:BA000039_726839 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 320

 Score = 32.3 bits (72), Expect = 4.7
 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 1/52 (1%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWG-RIDRNDAVEAMLKHADAGLTTFDMADHYG 432
           G   + I  ++ G WQ    W   I+  +++  +    +AG+TT D A+ YG
Sbjct: 7   GRTEIQITPLILGTWQAGKRWWVGIEDEESIRTIRAAVEAGMTTIDTAEVYG 58



>gb:AE017322_442540 Listeria monocytogenes str. 4b F2365, section 1
           of 10 of the complete genome.>gb:AE017262_1074896
           Listeria monocytogenes str. 4b F2365, complete genome.
          Length = 327

 Score = 32.3 bits (72), Expect = 4.7
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 2/36 (5%)
 Frame = +1

Query: 352 DRNDAVEAMLKHADAGLTTFDMADHYGP--AEDLYG 453
           DR + +E +    DAG+T FD A+ YGP   E+L G
Sbjct: 32  DRKEMIEVVRTAMDAGITMFDTAEVYGPYTNEELVG 67



>gb:SME591788_185940 Sinorhizobium meliloti 1021 complete
           chromosome; segment 7/12.
          Length = 342

 Score = 32.3 bits (72), Expect = 4.7
 Identities = 20/66 (30%), Positives = 30/66 (45%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHYGPAEDLYGIF 459
           G   L +  I  G+W   GG    +R   V+      D G+T FD+A++YGP      I 
Sbjct: 19  GRSGLKLPAISLGLWHNFGGDTPHERK--VDMCRTAFDLGITHFDLANNYGPPPGSAEIA 76

Query: 460 INKVRR 477
             ++ R
Sbjct: 77  FGEIMR 82



>pir|D98252|D98252 general stress protein 69 (gsp69) [imported] -
           Agrobacterium tumefaciens (strain C58,
           Cereon)>pir|AH3033|AH3033 aldo-keto reductase Atu3877
           [imported] - Agrobacterium tumefaciens (strain C58,
           Dupont)>gb:AE008296_235484 Agrobacterium tumefaciens
           str. C58 linear chromosome, section 100 of 187 of the
           complete sequence.>gb:AE009318_250713 Agrobacterium
           tumefaciens str. C58 linear chromosome, section 88 of
           187 of the complete sequence.>gb:AE007870_1080597
           Agrobacterium tumefaciens str. C58 linear chromosome,
           complete sequence.>gb:AE008689_1088556 Agrobacterium
           tumefaciens str. C58 linear chromosome, complete
           sequence.
          Length = 332

 Score = 32.3 bits (72), Expect = 4.7
 Identities = 17/61 (27%), Positives = 26/61 (42%), Gaps = 1/61 (1%)
 Frame = +1

Query: 253 KNRTVTLKNGNDSLDICRILNGMWQTSGG-WGRIDRNDAVEAMLKHADAGLTTFDMADHY 429
           +N  +T   G   +    +  G W   G  WG  D   ++ A+    DAG++  D A  Y
Sbjct: 3   ENAILTRTIGGSGISASAVGLGTWAIGGWMWGGTDERQSIAAIQASIDAGISLIDTAPAY 62

Query: 430 G 432
           G
Sbjct: 63  G 63



>pir|D90187|D90187 oxidoreductase [imported] - Sulfolobus
           solfataricus>gb:AE006676_221353 Sulfolobus solfataricus
           P2 section 35 of 272 of the complete
           genome.>gb:AE006641_1107201 Sulfolobus solfataricus P2,
           complete genome.
          Length = 354

 Score = 32.3 bits (72), Expect = 4.7
 Identities = 14/51 (27%), Positives = 25/51 (49%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHYG 432
           G+ ++ +  I  G+W     W   D N A + + +  + G+  +D AD YG
Sbjct: 35  GDTNITVSEIGIGVWSLVTDWWGADTNKAEDIIRRAYEVGINFYDTADTYG 85



>sp|Q04212|YMT1_YEAST Hypothetical 38.2 kDa protein in SUB1-ARGR1
           intergenic region.>pir|S52890|S52890 hypothetical
           protein YMR041c - yeast (Saccharomyces
           cerevisiae)>gb:SC9532X_1705996 S.cerevisiae chromosome
           XIII cosmid 9532.
          Length = 335

 Score = 32.3 bits (72), Expect = 4.7
 Identities = 15/41 (36%), Positives = 27/41 (65%), Gaps = 1/41 (2%)
 Frame = +1

Query: 367 VEAMLKHADA-GLTTFDMADHYGPAEDLYGIFINKVRRERP 486
           +E ++K+A + G+   D + +YGP+E LYG  ++ +R E P
Sbjct: 37  LEDIIKYAFSHGINAIDTSPYYGPSEVLYGRALSNLRNEFP 77



>gb:AE016815_1746328 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome II, complete sequence.
          Length = 359

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 13/34 (38%), Positives = 21/34 (61%)
 Frame = +1

Query: 391 DAGLTTFDMADHYGPAEDLYGIFINKVRRERPPE 492
           +AG+   D + +YG +E++YG  +  VR E P E
Sbjct: 65  EAGICAIDTSPYYGKSEEIYGEALAAVRDEHPRE 98



>gb:BA000040_731070 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 286

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 18/54 (33%), Positives = 25/54 (46%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHYGPAE 441
           G    ++  I  G W    G    DR  A+ A+ +  D G+T  D A+ YG AE
Sbjct: 14  GKTGANVSVIGQGTWYLDHG----DRKRAIAALQRGLDLGMTHIDTAEMYGDAE 63



>pir|D96011|D96011 probable oxidoreductase protein SMb20648
           [imported] - Sinorhizobium meliloti (strain 1021)
           magaplasmid pSymB>gb:RME591985_166004 Sinorhizobium
           meliloti 1021 complete pSymB.
          Length = 345

 Score = 32.0 bits (71), Expect = 6.1
 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 3/47 (6%)
 Frame = +1

Query: 301 CRILNGMWQTSG---GWGRIDRNDAVEAMLKHADAGLTTFDMADHYG 432
           C  + G +   G   GWG +D   ++ A+    D G +  D AD YG
Sbjct: 28  CWAIGGFFTLDGKADGWGEVDDEQSIRAIHVGLDMGASLIDTADAYG 74



>gb:BX572599_801763 Rhodopseudomonas palustris CGA009 complete
           genome; segment 7/16.
          Length = 277

 Score = 31.6 bits (70), Expect = 8.0
 Identities = 18/44 (40%), Positives = 22/44 (50%)
 Frame = +1

Query: 316 GMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHYGPAEDL 447
           G W    G    DR  A+ A+ +  D GLT  D A+ YG AE L
Sbjct: 17  GTWYIDQG----DRASALAALRRGLDLGLTHIDTAEMYGDAEPL 56



>gb:BA000012_671262 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 319

 Score = 31.6 bits (70), Expect = 8.0
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 11/66 (16%)
 Frame = +1

Query: 346 RIDRNDAVEAMLKHADAGLTTFDMADHYGP--AEDLYGIFINKVRRE---------RPPE 492
           RI     +E + +  +AG+T +D+A  YG   AE ++G F ++ R           RPP+
Sbjct: 26  RIGARQGIETLERAYEAGVTWYDVAPSYGDGMAESIWGEFASRKRDRVCVCTKVGMRPPK 85

Query: 493 YLETVR 510
              T+R
Sbjct: 86  TSATMR 91



>gb:AE017136_388375 Yersinia pestis biovar Medievalis str. 91001
           section 10 of 16 of the complete
           genome.>gb:AE017042_1144941 Yersinia pestis biovar
           Medievalis str. 91001 complete genome.
          Length = 329

 Score = 31.6 bits (70), Expect = 8.0
 Identities = 28/92 (30%), Positives = 40/92 (43%), Gaps = 7/92 (7%)
 Frame = +1

Query: 280 GNDSLDICRILNGMWQTSGG--WGRIDRNDAVEAMLKHADAGLTTFDMADHYGP----AE 441
           G+  L +  I  G+W   G   W    R+    A     D G+T FD+A++YGP    AE
Sbjct: 19  GHSGLKLPAISLGLWHNFGDSTWYENSRSLIHRAF----DHGITHFDLANNYGPPPGSAE 74

Query: 442 DLYG-IFINKVRRERPPEYLETVRGLTKWVPP 534
             +G I    +R  R    + +  G T W  P
Sbjct: 75  LNFGRILQQDLRPYRDELIIASKAGYTMWPGP 106



>pir|AF2090|AF2090 hypothetical protein all2277 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_683266 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 281

 Score = 31.6 bits (70), Expect = 8.0
 Identities = 17/48 (35%), Positives = 25/48 (52%)
 Frame = +1

Query: 310 LNGMWQTSGGWGRIDRNDAVEAMLKHADAGLTTFDMADHYGPAEDLYG 453
           L G  QT   W    +++A   + K  + G+  FD A  YGP+ED +G
Sbjct: 18  LGGAGQTPLSWEG-KQSEAEAIIYKALELGIRYFDTAASYGPSEDYFG 64



>sp|P42972|YCSN_BACSU Hypothetical oxidoreductase ycsN (EC
           1.-.-.-).>pir|I39903|I39903 aryl-alcohol dehydrogenase
           homolog ycsN - Bacillus subtilis>gb:D50453_120148
           Bacillus subtilis DNA for 25-36 degree region containing
           the amyE-srfA region, complete cds.>gb:BAC39R_744737
           Bacillus subtilis genome around 39 degrees region
           encoding 17 ORFs, complete cds.>gb:BSUB0003_752380
           Bacillus subtilis complete genome (section 3 of 21):
           from 415769 to 611680.
          Length = 300

 Score = 31.6 bits (70), Expect = 8.0
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 4/60 (6%)
 Frame = +1

Query: 286 DSLDICRILNGMWQTSGGWGRIDRN--DAVEAMLKHADAGLTTFDMADHYG--PAEDLYG 453
           + L   R+++G+W+ +  W   D      +E  + H   G+TTFD AD YG    E L+G
Sbjct: 8   EDLQFSRVIHGLWRLNE-WNYSDAELLSLIEWCIDH---GITTFDHADIYGGYTCEKLFG 63



>sp|P80874|GS69_BACSU General stress protein 69
           (GSP69).>pir|D69826|D69826 aldo/keto reductase homolog
           yhdN - Bacillus subtilis>gb:BSUB0006_752918 Bacillus
           subtilis complete genome (section 6 of 21): from 1011039
           to 1209781.>gb:BSY14082_756302 Bacillus subtilis
           chromosomal DNA, region 72 to 75 degrees: spoVR to sspB.
          Length = 331

 Score = 31.6 bits (70), Expect = 8.0
 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 3/57 (5%)
 Frame = +1

Query: 292 LDICRILNGMWQTSGG-WGRIDRNDAVEAMLKHADAGLTTFDMADHY--GPAEDLYG 453
           ++  RI  G W   G  WG  D   ++E +    D G+T  D A  Y  G +E++ G
Sbjct: 11  IEASRIGLGTWAIGGTMWGGTDEKTSIETIRAALDQGITLIDTAPAYGFGQSEEIVG 67


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 519,693,949
Number of Sequences: 1806583
Number of extensions: 9752442
Number of successful extensions: 32581
Number of sequences better than 10.0: 83
Number of HSP's better than 10.0 without gapping: 31366
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 32563
length of database: 581,917,975
effective HSP length: 117
effective length of database: 370,547,764
effective search space used: 22973961368
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)