BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig5476
         (671 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|E86245|E86245 hypothetical protein [imported] - Arabidopsis ...   265   4e-70   Arabidopsis thaliana [mouse-ear cress]
gb:OSJN00083_1694591 Oryza sativa genomic DNA, chromosome 4, BAC...   263   2e-69   
pir|A96638|A96638 hypothetical protein F11P17.7 [imported] - Ara...   260   1e-68   Arabidopsis thaliana [mouse-ear cress]
gb:BT002053_1635656 Arabidopsis thaliana putative protein (At5g2...   252   4e-66   
gb:AB018110_1513757 Arabidopsis thaliana genomic DNA, chromosome...   245   6e-64   
gb:ATF8L15_1551226 Arabidopsis thaliana DNA chromosome 5, BAC cl...   239   3e-62   
gb:AP003224_1825590 Oryza sativa (japonica cultivar-group) genom...   239   4e-62   
gb:AF052433_1236753 Strongylocentrotus purpuratus katanin p80 su...   208   6e-53   
gb:AE016959_1023236 Oryza sativa (japonica cultivar-group) chrom...   207   1e-52   
gb:BT007777_2150709 Synthetic construct Homo sapiens katanin p80...   195   5e-49   
gb:BC001353_1967515 Homo sapiens katanin p80 (WD repeat containi...   195   5e-49   
gb:AK034103_1163633 Mus musculus adult male diencephalon cDNA, R...   195   5e-49   
gb:AK031630_1162530 Mus musculus 13 days embryo male testis cDNA...   195   5e-49   
gb:AK010364_1155709 Mus musculus ES cells cDNA, RIKEN full-lengt...   195   5e-49   
gb:BC067983_2554967 Xenopus tropicalis hypothetical protein MGC6...   194   9e-49   
gb:BC043772_2548233 Xenopus laevis katanin p80 (WD40-containing)...   194   1e-48   
gb:BC077273_2559987 Xenopus laevis cDNA clone IMAGE:4031030, par...   191   8e-48   
gb:AF052432_1879229 Homo sapiens katanin p80 subunit mRNA, compl...   191   1e-47   
gb:BC047819_2549905 Danio rerio zgc:56071, mRNA (cDNA clone MGC:...   183   2e-45   
gb:AJ720686_2502873 Gallus gallus mRNA for hypothetical protein,...   182   4e-45   
gb:AY597210_1617101 Chlamydomonas reinhardtii katanin p80 subuni...   174   2e-42   
gb:AY089556_1297212 Drosophila melanogaster LD44201 full insert ...   120   2e-26   
gb:AE014298_1125928 Drosophila melanogaster chromosome X, comple...   120   2e-26   
gb:AF223065_1252599 Drosophila melanogaster putative microtubule...   120   3e-26   
sp|Q8YRI1|YY46_ANASP|YY46_ANASP Hypothetical WD-repeat protein alr3466.>pir...   112   8e-24   Anabaena sp.
gb:AF323585_1786295 Podospora anserina beta transducin-like prot...   108   8e-23   
gb:BA000045_742963 Gloeobacter violaceus PCC 7421 DNA, complete ...   105   5e-22   
gb:AF323583_1786293 Podospora anserina beta transducin-like prot...   103   2e-21   
sp|Q00808|HET1_PODAN|HET1_PODAN Vegetatible incompatibility protein HET-E-1...   103   2e-21   Podospora anserina
gb:AF323584_1786294 Podospora anserina beta transducin-like prot...   103   3e-21   
gb:AF323582_1786292 Podospora anserina beta transducin-like prot...   103   3e-21   
pir|AI2493|AI2493 WD-repeat protein [imported] - Nostoc sp. (str...   100   3e-20   Nostoc sp. PCC 7120
pir|AB2202|AB2202 hypothetical protein all3169 [imported] - Nost...    99   7e-20   Nostoc sp. PCC 7120
gb:BA000045_741250 Gloeobacter violaceus PCC 7421 DNA, complete ...    99   9e-20   
gb:BA000045_744431 Gloeobacter violaceus PCC 7421 DNA, complete ...    98   1e-19   
gb:BA000045_742040 Gloeobacter violaceus PCC 7421 DNA, complete ...    97   3e-19   
gb:BA000045_744426 Gloeobacter violaceus PCC 7421 DNA, complete ...    97   3e-19   
pir|AE1861|AE1861 serine/threonine kinase with WD-40 repeat [imp...    96   4e-19   Nostoc sp. PCC 7120
pir|AE1810|AE1810 WD-40 repeat protein [imported] - Nostoc sp. (...    96   7e-19   Nostoc sp. PCC 7120
sp|Q8YV57|YL24_ANASP|YL24_ANASP Hypothetical WD-repeat protein all2124.>pir...    95   1e-18   Anabaena sp.
sp|Q8YTC2|YS00_ANASP|YS00_ANASP Hypothetical WD-repeat protein alr2800.>pir...    94   2e-18   Anabaena sp.
gb:CR382136_1669275 Debaryomyces hansenii chromosome D of strain...    92   1e-17   
gb:BA000045_742896 Gloeobacter violaceus PCC 7421 DNA, complete ...    92   1e-17   
gb:AE016818_1747903 Ashbya gossypii (= Eremothecium gossypii) AT...    91   2e-17   
gb:AE017344_1756343 Cryptococcus neoformans var. neoformans JEC2...    90   4e-17   
gb:AC058781_1205242 Leishmania major strain Friedlin chromosome ...    90   4e-17   
gb:CR382128_1660923 Yarrowia lipolytica chromosome B of strain C...    89   5e-17   
pir|AH2195|AH2195 hypothetical protein alr3119 [imported] - Nost...    89   7e-17   Nostoc sp. PCC 7120
gb:AF536325_1809659 Ustilago maydis G-protein beta subunit Bpp1 ...    89   9e-17   
gb:AF391288_1267431 Branchiostoma floridae cosmid MPMGc117G0971,...    89   9e-17   
sp|P38129|TAF5_YEAST|TAF5_YEAST Transcription initiation factor TFIID subun...    89   9e-17   Saccharomyces cerevisiae [brewer's yeast]
gb:BC075582_2558678 Xenopus tropicalis TAF5-like RNA polymerase ...    88   1e-16   
gb:HSA9770_2009927 Homo sapiens mRNA for putative transcription ...    88   1e-16   
pir|AC1842|AC1842 WD-40 repeat protein [imported] - Nostoc sp. (...    88   1e-16   Nostoc sp. PCC 7120
sp|O75529|TA5L_HUMAN|TA5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associ...    88   1e-16   Homo sapiens [man]
gb:BC077313_2560027 Xenopus laevis TAF5-like RNA polymerase II, ...    88   2e-16   
gb:BC075548_2558648 Xenopus tropicalis MGC89488 protein, mRNA (c...    88   2e-16   
gb:AF306867_1260835 Aedes triseriatus unknown mRNA.                    88   2e-16   
sp|Q9V3J8|WDS_DROME|WDS_DROME Will die slowly protein.>gb:AE014298_1124067...    88   2e-16   Drosophila melanogaster
gb:AC135228_1742183 Oryza sativa chromosome 3 BAC OSJNBb0122C16 ...    87   2e-16   
gb:AE014297_1138788 Drosophila melanogaster chromosome 3R, compl...    87   2e-16   
sp|Q91WQ5|TA5L_MOUSE|TA5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associ...    87   2e-16   Mus musculus [mouse]
gb:AF044334_2052254 Mus musculus pleiotropic regulator 1 (PLRG1)...    87   3e-16   
gb:BC020786_1977204 Homo sapiens pleiotropic regulator 1 (PRL1 h...    87   3e-16   
gb:AK089463_1175945 Mus musculus B6-derived CD11 +ve dendritic c...    87   3e-16   
sp|Q9WUC8|PLR1_RAT|PLR1_RAT Pleiotropic regulator 1.>gb:AF128241_2055602 ...    87   3e-16   Rattus norvegicus [brown rat]
sp|Q922V4|PLR1_MOUSE|PLR1_MOUSE Pleiotropic regulator 1.>gb:AK075993_117115...    87   3e-16   Mus musculus [mouse]
sp|O43660|PLR1_HUMAN|PLR1_HUMAN Pleiotropic regulator 1.>gb:AX878187_147733...    87   3e-16   Homo sapiens [man]
gb:HSA011376_2000038 Homo sapiens mRNA for hypothetical protein ...    87   3e-16   
sp|P61964|WDR5_HUMAN|WDR5_HUMAN WD-repeat protein 5.>sp|P61965|WDR5_MOUSE W...    87   3e-16   Homo sapiens [man]
sp|P46800|GBLP_DICDI|GBLP_DICDI Guanine nucleotide-binding protein beta sub...    87   3e-16   Dictyostelium discoideum
gb:BC067651_2554823 Danio rerio cDNA clone IMAGE:6963216, partia...    86   4e-16   
gb:BC062834_2553423 Danio rerio zgc:77675, mRNA (cDNA clone MGC:...    86   4e-16   
gb:BC064237_2553790 Xenopus tropicalis hypothetical protein LOC3...    86   6e-16   
gb:BA000045_740981 Gloeobacter violaceus PCC 7421 DNA, complete ...    86   6e-16   
sp|P49695|PKWA_THECU|PKWA_THECU Probable serine/threonine-protein kinase pk...    86   6e-16   Thermomonospora curvata
gb:BC077844_2560496 Xenopus laevis WD repeat domain 5, mRNA (cDN...    86   8e-16   
gb:BC074136_2557654 Xenopus laevis MGC81859 protein, mRNA (cDNA ...    86   8e-16   
gb:BC066132_2554253 Xenopus tropicalis hypothetical protein MGC7...    86   8e-16   
gb:AE016818_1748408 Ashbya gossypii (= Eremothecium gossypii) AT...    86   8e-16   
gb:AB007645_1510148 Arabidopsis thaliana genomic DNA, chromosome...    86   8e-16   
gb:BC084871_2564115 Xenopus laevis hypothetical LOC495399, mRNA ...    85   1e-15   
gb:BC081008_2561918 Xenopus laevis WD repeat domain 5, mRNA (cDN...    85   1e-15   
gb:BC052124_2550472 Danio rerio zgc:76895, mRNA (cDNA clone MGC:...    85   1e-15   
gb:AK097409_1914851 Homo sapiens cDNA FLJ40090 fis, clone TESTI2...    85   1e-15   
gb:AF091120_1767420 Filobasidiella neoformans G-protein beta sub...    85   1e-15   
gb:CR380959_1653880 Candida glabrata strain CBS138 chromosome M ...    85   1e-15   
gb:BOVPAF45K_1435710 Bovine mRNA for PAF acetylhydrolase 45 kDa ...    85   1e-15   
gb:ASPDRUH_582995 Anabaena sp. PCC 7120 DNA downstream region of...    85   1e-15   
gb:AE012949_287446 Chlorobium tepidum TLS section 170 of 194 of ...    85   1e-15   
pir|AF1890|AF1890 WD-repeat protein [imported] - Nostoc sp. (str...    85   1e-15   Nostoc sp. PCC 7120
sp|Q17963|YKY4_CAEEL|YKY4_CAEEL Hypothetical 40.4 kDa Trp-Asp repeats conta...    85   1e-15   Caenorhabditis elegans [roundworm]
sp|P43033|LIS1_BOVIN|LIS1_BOVIN Platelet-activating factor acetylhydrolase ...    85   1e-15   Bos taurus [bovine]
gb:BC055275_2551353 Danio rerio zgc:63538, mRNA (cDNA clone MGC:...    85   1e-15   
gb:AY032881_2508795 Xenopus laevis LIS1 mRNA, complete cds.            85   1e-15   
gb:AK127882_1916943 Homo sapiens cDNA FLJ45988 fis, clone PUAEN2...    85   1e-15   
gb:AK098821_1915232 Homo sapiens cDNA FLJ25955 fis, clone TST03904.    85   1e-15   
gb:AE017348_1758402 Cryptococcus neoformans var. neoformans JEC2...    85   1e-15   
gb:CR382138_1671323 Debaryomyces hansenii chromosome F of strain...    85   1e-15   
gb:BC088497_2565630 Xenopus tropicalis cDNA clone MGC:97562 IMAG...    84   2e-15   
gb:BC086465_2564881 Xenopus laevis hypothetical LOC495838, mRNA ...    84   2e-15   
gb:BC064252_2553805 Xenopus tropicalis hypothetical protein MGC7...    84   2e-15   
gb:CR382136_1669320 Debaryomyces hansenii chromosome D of strain...    84   2e-15   
gb:AY064077_1293671 Aedes aegypti clone unKRc2 unknown protein (...    84   2e-15   
gb:AY064076_1293670 Aedes aegypti clone unKMc3 unknown protein (...    84   2e-15   
gb:AF326340_1262805 Aedes aegypti unknown protein i8 mRNA, compl...    84   2e-15   
gb:AF326339_1262804 Aedes aegypti unknown protein i8 mRNA, compl...    84   2e-15   
gb:AF079369_1239501 Dictyostelium discoideum transcriptional rep...    84   2e-15   
gb:BC056820_2552003 Danio rerio TAF5-like RNA polymerase II, p30...    84   2e-15   
gb:MUSLISB_2128749 Mus musculus LIS mRNA, partial cds.                 84   2e-15   
gb:MMPAFALIS4_2116876 Mus musculus Pafaha/Lis1 exon 4, Pafaha/Li...    84   2e-15   
gb:BC043494_1983422 Homo sapiens WD repeat domain 5B, mRNA (cDNA...    84   2e-15   
gb:AY665285_1958590 Pan troglodytes platelet-activating factor a...    84   2e-15   
gb:AF400434_1901097 Homo sapiens platelet-activating factor acet...    84   2e-15   
gb:AF208837_1890045 Homo sapiens isolate 3 Miller-Dieker lissenc...    84   2e-15   
gb:AC092779_1735711 Oryza sativa chromosome 3 BAC OSJNBb0024N19 ...    84   2e-15   
gb:AC087851_1734183 Oryza sativa chromosome 3 BAC OSJNBb0072E24 ...    84   2e-15   
gb:CR382132_1666041 Yarrowia lipolytica chromosome F of strain C...    84   2e-15   
gb:CR382125_1658273 Kluyveromyces lactis strain NRRL Y-1140 chro...    84   2e-15   
gb:CR857638_1181860 Pongo pygmaeus mRNA; cDNA DKFZp469A0528 (fro...    84   2e-15   
pir|S48052|S48052 platelet-activating factor acetylhydrolase 45K...    84   2e-15   Bos taurus [bovine]
pir|S36113|S36113 LIS-1 protein - human                                84   2e-15   Homo sapiens [man]
sp|P43035|LIS1_MOUSE|LIS1_MOUSE Platelet-activating factor acetylhydrolase ...    84   2e-15   Mus musculus [mouse]
sp|P43034|LIS1_HUMAN|LIS1_HUMAN Platelet-activating factor acetylhydrolase ...    84   2e-15   Homo sapiens [man]
gb:BC059759_2552703 Xenopus tropicalis hypothetical protein MGC7...    84   3e-15   
gb:BC044530_2548832 Danio rerio platelet-activating factor acety...    84   3e-15   
gb:AF113946_2474699 Gallus gallus LIS1 (LIS1) mRNA, complete cds.      84   3e-15   
gb:HUMLIS1C_2034077 Homo sapiens (clone 6-1) Miller-Dieker lisse...    84   3e-15   
gb:CR457333_1993540 Homo sapiens full open reading frame cDNA cl...    84   3e-15   
gb:BC007417_1970712 Homo sapiens WD repeat domain 51A, mRNA (cDN...    84   3e-15   
gb:AY461709_1329432 Bombyx mori will die slowly mRNA, complete cds.    84   3e-15   
gb:AK013114_1157333 Mus musculus 10, 11 days embryo whole body c...    84   3e-15   
gb:AK010283_1155647 Mus musculus ES cells cDNA, RIKEN full-lengt...    84   3e-15   
gb:AK009247_1155025 Mus musculus adult male tongue cDNA, RIKEN f...    84   3e-15   
sp|O13282|TAF5_SCHPO|TAF5_SCHPO Transcription initiation factor TFIID subun...    84   3e-15   Schizosaccharomyces pombe
gb:BC085620_2564502 Danio rerio cDNA clone MGC:86603 IMAGE:68919...    83   4e-15   
gb:BC045888_2549405 Danio rerio zgc:56055, mRNA (cDNA clone MGC:...    83   4e-15   
gb:AY648817_2541645 Danio rerio pleiotropic regulator 1 mRNA, co...    83   4e-15   
gb:AJ720488_2502675 Gallus gallus mRNA for hypothetical protein,...    83   4e-15   
gb:HSU75309_2025968 Human TBP-associated factor (hTAFII100) mRNA...    83   4e-15   
gb:HSTAFII10_2020620 H.sapiens mRNA for TAFII100 protein.              83   4e-15   
gb:BC052268_1984779 Homo sapiens TAF5 RNA polymerase II, TATA bo...    83   4e-15   
gb:AL591408_1930058 Human DNA sequence from clone RP11-792D24 on...    83   4e-15   
gb:AF100786_1883061 Homo sapiens G protein beta subunit-like pro...    83   4e-15   
gb:CR382131_1664617 Yarrowia lipolytica chromosome E of strain C...    83   4e-15   
gb:CQ783423_1452458 Sequence 3563 from Patent EP1396543.>gb:AK07...    83   4e-15   
gb:PFMAL3P8_1394642 Plasmodium falciparum MAL3P8, complete seque...    83   4e-15   
gb:AK088953_1175721 Mus musculus 2 days neonate thymus thymic ce...    83   4e-15   
sp|Q15542|TAF5_HUMAN|TAF5_HUMAN Transcription initiation factor TFIID subun...    83   4e-15   Homo sapiens [man]
gb:BC089247_2566129 Xenopus laevis cDNA clone MGC:85213 IMAGE:33...    83   5e-15   
gb:BC084093_2563499 Xenopus laevis hypothetical LOC495006, mRNA ...    83   5e-15   
gb:BC056099_2551681 Xenopus laevis hypothetical protein MGC69111...    83   5e-15   
gb:AY422998_2532084 Danio rerio TUWD12 (TUWD12) mRNA, complete cds.    83   5e-15   
gb:AY391450_2531586 Danio rerio pleiotropic regulator 1 (PLRG1) ...    83   5e-15   
gb:CR380956_1652130 Candida glabrata strain CBS138 chromosome J ...    83   5e-15   
gb:AF319658_1418326 Sus scrofa platelet-activating factor acetyl...    83   5e-15   
gb:DDI512336_1376967 Dictyostelium discoideum mRNA for LIS1 prot...    83   5e-15   
gb:CR857562_1181788 Pongo pygmaeus mRNA; cDNA DKFZp469J1511 (fro...    83   5e-15   
gb:AK007246_1153889 Mus musculus adult male testis cDNA, RIKEN f...    83   5e-15   
gb:AB083321_1871858 Macaca fascicularis pafah1b1 mRNA for platel...    82   6e-15   
gb:AF323581_1786291 Podospora anserina beta transducin-like prot...    82   6e-15   
gb:AE017344_1756510 Cryptococcus neoformans var. neoformans JEC2...    82   6e-15   
gb:AE016816_1746827 Ashbya gossypii (= Eremothecium gossypii) AT...    82   6e-15   
gb:AY003872_1285908 Plasmodium vivax YAC 1H14, complete sequence.      82   6e-15   
gb:AK016201_1158645 Mus musculus adult male testis cDNA, RIKEN f...    82   6e-15   
gb:BC053205_2550597 Danio rerio platelet-activating factor acety...    82   8e-15   
gb:BC071846_1988821 Homo sapiens APG16 autophagy 16-like (S. cer...    82   8e-15   
gb:BC037320_1982178 Homo sapiens F-box and WD-40 domain protein ...    82   8e-15   
gb:AY398617_1949793 Homo sapiens APG16L beta mRNA, complete cds.       82   8e-15   
gb:AF443204_1800322 Chlamydomonas reinhardtii WD40-repeat-contai...    82   8e-15   
gb:AF056182_1764686 Emericella nidulans G-protein beta subunit (...    82   8e-15   
gb:AE014298_1125350 Drosophila melanogaster chromosome X, comple...    82   8e-15   
gb:CZA382_119892 Amycolatopsis orientalis cosmid pCZA382.              82   8e-15   
pir|AE2415|AE2415 WD-repeat protein [imported] - Nostoc sp. (str...    82   8e-15   Nostoc sp. PCC 7120
sp|Q8C092|TAF5_MOUSE|TAF5_MOUSE Transcription initiation factor TFIID subun...    82   8e-15   Mus musculus [mouse]
gb:AE017344_1756215 Cryptococcus neoformans var. neoformans JEC2...    82   1e-14   
gb:AF063022_1237374 Crithidia fasciculata CACK protein (GCACK) g...    82   1e-14   
pir|S33263|S33263 transcription initiation factor IID-associated...    82   1e-14   Drosophila melanogaster
pir|AG2375|AG2375 WD-40 repeat-protein [imported] - Nostoc sp. (...    82   1e-14   Nostoc sp. PCC 7120
sp|P49846|TAF5_DROME|TAF5_DROME Transcription initiation factor TFIID subun...    82   1e-14   Drosophila melanogaster
gb:BC049122_2099936 Mus musculus APG16 autophagy 16-like (S. cer...    81   1e-14   
gb:AB087881_2047869 Mus musculus mRNA for Apg16L gamma, complete...    81   1e-14   
gb:AB087880_2047868 Mus musculus mRNA for Apg16L beta, complete ...    81   1e-14   
gb:AB087879_2047867 Mus musculus mRNA for Apg16L alpha, complete...    81   1e-14   
gb:AF090988_1882483 Homo sapiens U5 snRNP-specific 40 kDa protei...    81   1e-14   
gb:AX883194_1479234 Sequence 18099 from Patent EP1074617.>gb:AK0...    81   1e-14   
gb:AF164430_1246631 Caenorhabditis elegans LIS-1 (lis-1) mRNA, c...    81   1e-14   
gb:AF098070_1240741 Drosophila melanogaster Lis1 homolog mRNA, c...    81   1e-14   
gb:CR859089_1183226 Pongo pygmaeus mRNA; cDNA DKFZp469O1320 (fro...    81   1e-14   
gb:AK030983_1162244 Mus musculus adult male thymus cDNA, RIKEN f...    81   1e-14   
gb:AK012342_1156901 Mus musculus 11 days embryo whole body cDNA,...    81   1e-14   
gb:AE013599_1132149 Drosophila melanogaster chromosome 2R, compl...    81   1e-14   
pir|AG1889|AG1889 WD-40 repeat protein [imported] - Nostoc sp. (...    81   1e-14   Nostoc sp. PCC 7120
pir|T40283|T40283 beta-transducin - fission yeast (Schizosacchar...    81   1e-14   Schizosaccharomyces pombe
sp|P90648|KMHB_DICDI|KMHB_DICDI Myosin heavy chain kinase B (EC 2.7.1.129) ...    81   1e-14   Dictyostelium discoideum
gb:BC051783_2550450 Danio rerio zgc:56312, mRNA (cDNA clone MGC:...    81   2e-14   
gb:AJ720459_2502646 Gallus gallus mRNA for hypothetical protein,...    81   2e-14   
gb:AF490391_2066997 Mus musculus sperm-associated WD repeat prot...    81   2e-14   
gb:AX878269_1477372 Sequence 13174 from Patent EP1074617.>gb:AK0...    81   2e-14   
gb:CQ783661_1452567 Sequence 3801 from Patent EP1396543.>gb:AK07...    81   2e-14   
gb:HSM804229_1187124 Homo sapiens mRNA; cDNA DKFZp762M0115 (from...    81   2e-14   
gb:AK014865_1158168 Mus musculus adult male testis cDNA, RIKEN f...    81   2e-14   
gb:AE014296_1134707 Drosophila melanogaster chromosome 3L, compl...    81   2e-14   
pir|T46032|T46032 WD-40 repeat regulatory protein tup1 homolog -...    81   2e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AB099715_2464872 Oryzias latipes Ol-Gb1 mRNA for guanine nucl...    80   2e-14   
gb:BC034901_2097799 Mus musculus RIKEN cDNA 2510040D07 gene, mRN...    80   2e-14   
gb:AY392427_2084491 Cricetulus griseus guanine nucleotide bindin...    80   2e-14   
gb:AF427101_2065587 Mus musculus F-box protein (Fbwd6) mRNA, com...    80   2e-14   
gb:AF383178_1900017 Homo sapiens F-box protein FBX30 mRNA, parti...    80   2e-14   
gb:AF053883_1764476 Emericella nidulans coatomer alpha subunit (...    80   2e-14   
gb:AY661671_1620416 Lentinula edodes guanine nucleotide binding ...    80   2e-14   
gb:AX877849_1477188 Sequence 12754 from Patent EP1074617.>gb:AK0...    80   2e-14   
gb:AX722159_1473864 Sequence 17 from Patent WO03024999.>gb:AY008...    80   2e-14   
gb:AX722147_1473863 Sequence 5 from Patent WO03024999.>gb:AF4119...    80   2e-14   
gb:CR859650_1183756 Pongo pygmaeus mRNA; cDNA DKFZp459C1034 (fro...    80   2e-14   
gb:AK032174_1162787 Mus musculus adult male olfactory brain cDNA...    80   2e-14   
gb:AK011064_1156171 Mus musculus 13 days embryo liver cDNA, RIKE...    80   2e-14   
sp|Q12417|PR46_YEAST|PR46_YEAST Pre-mRNA splicing factor PRP46.>pir|S65162|...    80   2e-14   Saccharomyces cerevisiae [brewer's yeast]
sp|Q8VBV4|FBW7_MOUSE|FBW7_MOUSE F-box/WD-repeat protein 7 (F-box and WD-40 ...    80   2e-14   Mus musculus [mouse]
sp|Q969H0|FBW7_HUMAN|FBW7_HUMAN F-box/WD-repeat protein 7 (F-box and WD-40 ...    80   2e-14   Homo sapiens [man]
gb:RNU88324_2137869 Rattus norvegicus G protein beta1 subunit (r...    80   3e-14   
gb:AY120781_1579663 Arabidopsis thaliana WD40-repeat protein (At...    80   3e-14   
gb:AY056281_1563595 Arabidopsis thaliana putative WD40-repeat pr...    80   3e-14   
gb:AK077037_1171628 Mus musculus adult male testis cDNA, RIKEN f...    80   3e-14   
gb:BA000039_726273 Thermosynechococcus elongatus BP-1 DNA, compl...    80   3e-14   
pir|T51507|T51507 WD40-repeat protein - Arabidopsis thaliana>gb:...    80   3e-14   Arabidopsis thaliana [mouse-ear cress]
gb:AJ719967_2502154 Gallus gallus mRNA for hypothetical protein,...    80   4e-14   
gb:CR382126_1658855 Kluyveromyces lactis strain NRRL Y-1140 chro...    80   4e-14   
gb:AK016977_1158973 Mus musculus adult male testis cDNA, RIKEN f...    80   4e-14   
gb:BC058365_2103177 Mus musculus U5 snRNP-specific protein (Prp8...    79   5e-14   
gb:AF083383_1881616 Homo sapiens 38kDa splicing factor mRNA, com...    79   5e-14   
gb:CR380959_1653747 Candida glabrata strain CBS138 chromosome M ...    79   5e-14   
gb:AY080732_1568450 Arabidopsis thaliana unknown protein (At1g71...    79   5e-14   
gb:DDU27537_1377318 Dictyostelium discoideum G beta like protein...    79   5e-14   
gb:BA000045_742319 Gloeobacter violaceus PCC 7421 DNA, complete ...    79   5e-14   
gb:BC044482_2548786 Danio rerio guanine nucleotide binding prote...    79   7e-14   
gb:HUMTRNB1_2037888 Human transducin beta-1 subunit mRNA, 3' end.      79   7e-14   
gb:AY358182_1947061 Homo sapiens clone DNA178573 SSGL9393 (UNQ93...    79   7e-14   
gb:AF070603_1880754 Homo sapiens clone 24584 beta-subunit signal...    79   7e-14   
gb:AB071106_1871172 Macaca fascicularis testis cDNA clone:QtsA-1...    79   7e-14   
gb:AB071095_1871161 Macaca fascicularis testis cDNA clone:QtsA-1...    79   7e-14   
gb:AB070162_1871033 Macaca fascicularis testis cDNA clone:QtsA-1...    79   7e-14   
gb:AE016817_1747461 Ashbya gossypii (= Eremothecium gossypii) AT...    79   7e-14   
gb:SCYDL144C_1711717 S.cerevisiae chromosome IV reading frame OR...    79   7e-14   
gb:SCASCOPI_1706528 S.cerevisiae DNA for alpha subunit of coatom...    79   7e-14   
gb:CR382135_1668127 Debaryomyces hansenii chromosome C of strain...    79   7e-14   
gb:CQ782448_1451984 Sequence 2588 from Patent EP1396543.>gb:AL45...    79   7e-14   
gb:BTTRDBR_1437413 Bovine retinal mRNA for transducin beta-subunit.    79   7e-14   
gb:CEF55B12_1364502 Caenorhabditis elegans cosmid F55B12, comple...    79   7e-14   
gb:CR860734_1184787 Pongo pygmaeus mRNA; cDNA DKFZp459O1427 (fro...    79   7e-14   
gb:CR860672_1184728 Pongo pygmaeus mRNA; cDNA DKFZp459M2115 (fro...    79   7e-14   
gb:CR857310_1181554 Pongo pygmaeus mRNA; cDNA DKFZp469N2132 (fro...    79   7e-14   
pir|AG2400|AG2400 WD-repeat protein [imported] - Nostoc sp. (str...    79   7e-14   Nostoc sp. PCC 7120
pir|T22703|T22703 hypothetical protein F55B12.3 - Caenorhabditis...    79   7e-14   Caenorhabditis elegans [roundworm]
pir|T19550|T19550 hypothetical protein D1054.15 - Caenorhabditis...    79   7e-14   Caenorhabditis elegans [roundworm]
sp|Q93794|SE10_CAEEL|SE10_CAEEL F-box/WD-repeat protein sel-10 (Suppressor/...    79   7e-14   Caenorhabditis elegans [roundworm]
sp|P54311|GBB1_RAT|GBB1_RAT Guanine nucleotide-binding protein G(I)/G(S)/...    79   7e-14   Rattus norvegicus [brown rat]
sp|P04901|GBB1_HUMAN|GBB1_HUMAN Guanine nucleotide-binding protein G(I)/G(S...    79   7e-14   Homo sapiens [man]
sp|P53622|COPA_YEAST|COPA_YEAST Coatomer alpha subunit (Alpha-coat protein)...    79   7e-14   Saccharomyces cerevisiae [brewer's yeast]
gb:BC056708_2551901 Danio rerio guanine nucleotide binding prote...    79   9e-14   
gb:AF208838_1890046 Homo sapiens isolate 4 Miller-Dieker lissenc...    79   9e-14   
gb:AF339501_1787722 Pichia angusta alpha-COP-like protein (OPU27...    79   9e-14   
gb:AE016817_1747302 Ashbya gossypii (= Eremothecium gossypii) AT...    79   9e-14   
gb:BT012225_1641431 Arabidopsis thaliana At5g13480 gene, complet...    79   9e-14   
gb:CR858112_1182299 Pongo pygmaeus mRNA; cDNA DKFZp469O1927 (fro...    79   9e-14   
gb:AF299085_497399 Myxococcus xanthus Bap1 (bap1) gene, complete...    79   9e-14   
pir|AD1842|AD1842 WD-40 repeat protein [imported] - Nostoc sp. (...    79   9e-14   Nostoc sp. PCC 7120
gb:AK131120_2069731 Mus musculus premature mRNA for mFLJ00045 pr...    78   1e-13   
gb:AF127799_1885230 Homo sapiens G protein beta subunit-like pro...    78   1e-13   
gb:AP003517_1830286 Oryza sativa (japonica cultivar-group) genom...    78   1e-13   
gb:AK005181_1152870 Mus musculus adult male cerebellum cDNA, RIK...    78   1e-13   
gb:AK002371_1151155 Mus musculus adult male kidney cDNA, RIKEN f...    78   1e-13   
pir|AG1837|AG1837 WD-40 repeat protein [imported] - Nostoc sp. (...    78   1e-13   Nostoc sp. PCC 7120
pir|A96741|A96741 hypothetical protein F14O23.22 [imported] - Ar...    78   1e-13   Arabidopsis thaliana [mouse-ear cress]
gb:BC076910_2559649 Xenopus tropicalis guanine nucleotide bindin...    78   2e-13   
gb:BC045034_2548989 Xenopus laevis U5 snRNP-specific 40 kDa prot...    78   2e-13   
gb:AY485643_1608486 Hordeum vulgare subsp. vulgare BAC 615K1, co...    78   2e-13   
gb:BC084263_2563650 Xenopus laevis beta 1 subunit of heterotrime...    77   2e-13   
gb:BC054992_2551194 Xenopus laevis hypothetical protein MGC64565...    77   2e-13   
gb:AF277161_2483898 Ambystoma tigrinum G-protein B1 subunit mRNA...    77   2e-13   
gb:CR382135_1668291 Debaryomyces hansenii chromosome C of strain...    77   2e-13   
gb:CR382126_1658565 Kluyveromyces lactis strain NRRL Y-1140 chro...    77   2e-13   
gb:AY524667_1333026 Pinctada fucata G protein beta subunit mRNA,...    77   2e-13   
sp|P79959|GBB1_XENLA|GBB1_XENLA Guanine nucleotide-binding protein G(I)/G(S...    77   2e-13   
gb:AP004273_1839586 Oryza sativa (japonica cultivar-group) genom...    77   3e-13   
gb:BT002991_1636574 Arabidopsis thaliana clone RAFL15-17-A08 (R2...    77   3e-13   
gb:AY084972_1570054 Arabidopsis thaliana clone 123113 mRNA, comp...    77   3e-13   
gb:AT23KB_1542661 A.thaliana RH1, TC1, G14587-5, G14587-6, and P...    77   3e-13   
gb:SCO939118_177541 Streptomyces coelicolor A3(2) complete genom...    77   3e-13   
pir|T42045|T42045 beta transducin-like protein homolog - Strepto...    77   3e-13   
sp|Q42384|PRL1_ARATH|PRL1_ARATH PP1/PP2A phosphatases pleiotropic regulator...    77   3e-13   
sp|P87053|POF1_SCHPO|POF1_SCHPO F-box/WD-repeat protein pof1 (Skp1-binding ...    77   3e-13   
gb:AJ719919_2502106 Gallus gallus mRNA for hypothetical protein,...    77   4e-13   
gb:AJ719819_2502006 Gallus gallus mRNA for hypothetical protein,...    77   4e-13   
gb:AL354928_1923557 Human DNA sequence from clone RP11-175D17 on...    77   4e-13   
gb:AE017347_1757946 Cryptococcus neoformans var. neoformans JEC2...    77   4e-13   
gb:CNS09S4S_1648290 DNA centromeric region sequence from BAC DP2...    77   4e-13   
gb:AF125254_1242994 Leishmania panamensis activated protein kina...    77   4e-13   
gb:AC117075_1207781 Dictyostelium discoideum chromosome 2 map 52...    77   4e-13   
pir|G85034|G85034 probable WD-repeat protein [imported] - Arabid...    77   4e-13   
pir|AE1866|AE1866 WD-40 repeat protein [imported] - Nostoc sp. (...    77   4e-13   
sp|Q08706|GBB_LYMST|GBB_LYMST Guanine nucleotide-binding protein beta subu...    77   4e-13   
gb:BC085436_2564385 Danio rerio zgc:101778, mRNA (cDNA clone MGC...    76   5e-13   
gb:AY608603_1617762 Exophiala dermatitidis Tup1p gene, complete ...    76   5e-13   
gb:AE014297_1142042 Drosophila melanogaster chromosome 3R, compl...    76   5e-13   
gb:AE014297_1142041 Drosophila melanogaster chromosome 3R, compl...    76   5e-13   
gb:AE014297_1142040 Drosophila melanogaster chromosome 3R, compl...    76   5e-13   
gb:AE014296_1135687 Drosophila melanogaster chromosome 3L, compl...    76   5e-13   
pir|S19487|S19487 hypothetical protein YCR072c - yeast (Saccharo...    76   5e-13   
sp|P25382|YCW2_YEAST|YCW2_YEAST Hypothetical WD-repeat protein YCR072C.>gb:...    76   5e-13   
gb:AF357839_1265102 Leishmania donovani LACK protective antigen ...    76   6e-13   
gb:AE014186_938430 Plasmodium falciparum 3D7 chromosome 11 compl...    76   6e-13   
pir|T50983|T50983 probable pleiotropic regulator 1 (PLRG1) [impo...    76   6e-13   
sp|O13615|PRP5_SCHPO|PRP5_SCHPO Pre-mRNA splicing protein prp5.>gb:AB004535...    76   6e-13   
gb:BC056720_2551913 Danio rerio PRP4 pre-mRNA processing factor ...    75   8e-13   
gb:BC085125_2109076 Rattus norvegicus beta-transducin repeat con...    75   8e-13   
gb:AF112979_2054942 Mus musculus beta-transducin repeat containi...    75   8e-13   
gb:AF081887_2053835 Mus musculus ubiquitin ligase FWD1 mRNA, com...    75   8e-13   
gb:CR382137_1670331 Debaryomyces hansenii chromosome E of strain...    75   8e-13   
gb:CR380958_1653104 Candida glabrata strain CBS138 chromosome L ...    75   8e-13   
gb:CR380955_1651673 Candida glabrata strain CBS138 chromosome I ...    75   8e-13   
gb:AB070844_1522704 Aspergillus oryzae sconB gene for sulfur met...    75   8e-13   
gb:AX019507_1456592 Sequence 1 from Patent WO9938969.>gb:AF12953...    75   8e-13   
gb:AY457171_1327891 Leishmania amazonensis antigenic WD protein ...    75   8e-13   
gb:CR857777_1181989 Pongo pygmaeus mRNA; cDNA DKFZp469O1137 (fro...    75   8e-13   
gb:CR749295_1180924 Homo sapiens mRNA; cDNA DKFZp781N011 (from c...    75   8e-13   
gb:AK045302_1167348 Mus musculus 9.5 days embryo parthenogenote ...    75   8e-13   
gb:AK016991_1158982 Mus musculus adult male testis cDNA, RIKEN f...    75   8e-13   
gb:AE014296_1136763 Drosophila melanogaster chromosome 3L, compl...    75   8e-13   
gb:AE014134_1126817 Drosophila melanogaster chromosome 2L, compl...    75   8e-13   
pir|T16607|T16607 hypothetical protein K10B2.1 - Caenorhabditis ...    75   8e-13   
pir|AE2490|AE2490 WD-repeat protein [imported] - Nostoc sp. (str...    75   8e-13   
sp|Q93847|YZLL_CAEEL|YZLL_CAEEL Hypothetical 43.1 kDa Trp-Asp repeats conta...    75   8e-13   
sp|Q09990|LI23_CAEEL|LI23_CAEEL F-box/WD-repeat protein lin-23.>gb:AF275253...    75   8e-13   
sp|P36408|GBB_DICDI|GBB_DICDI Guanine nucleotide-binding protein beta subu...    75   8e-13   
sp|Q9Y297|FW1A_HUMAN|FW1A_HUMAN F-box/WD-repeat protein 1A (F-box and WD-re...    75   8e-13   
gb:AJ719544_2501731 Gallus gallus mRNA for hypothetical protein,...    75   1e-12   
gb:AF268195_2060958 Mus musculus strain BALB/c IRA1 mRNA, comple...    75   1e-12   
gb:CR382133_1666880 Debaryomyces hansenii chromosome A of strain...    75   1e-12   
gb:AY463620_1607709 Arabidopsis thaliana TAF5 (At5g25150) mRNA, ...    75   1e-12   
gb:AX882446_1478938 Sequence 17351 from Patent EP1074617.>gb:AK0...    75   1e-12   
gb:AK030547_1162058 Mus musculus adult male pituitary gland cDNA...    75   1e-12   
gb:AE014296_1134228 Drosophila melanogaster chromosome 3L, compl...    75   1e-12   
pir|AI2099|AI2099 WD-40 repeat protein [imported] - Nostoc sp. (...    75   1e-12   
sp|Q9QXE7|TBLX_MOUSE|TBLX_MOUSE F-box-like/WD-repeat protein TBL1X (Transdu...    75   1e-12   
sp|Q8BHJ5|TBLR_MOUSE|TBLR_MOUSE F-box-like/WD-repeat protein TBLR1 (Nuclear...    75   1e-12   
sp|Q9BZK7|TBLR_HUMAN|TBLR_HUMAN F-box-like/WD-repeat protein TBLR1 (Nuclear...    75   1e-12   
sp|P93107|PF20_CHLRE|PF20_CHLRE Flagellar WD-repeat protein PF20.>pir|T0818...    75   1e-12   
gb:BC056809_2551992 Danio rerio zgc:63728, mRNA (cDNA clone MGC:...    75   1e-12   
gb:BC041755_2548033 Xenopus laevis coatomer protein complex, sub...    75   1e-12   
gb:AF306565_1784516 Pneumocystis carinii guanine nucleotide-bind...    75   1e-12   
gb:AE017347_1757676 Cryptococcus neoformans var. neoformans JEC2...    75   1e-12   
gb:AC082645_1733161 Oryza sativa chromosome 3 BAC OSJNBb0033N16 ...    75   1e-12   
gb:YSCMET30PA_1729887 Saccharomyces cerevisiae Met30p gene, comp...    75   1e-12   
gb:SPU92792_1722273 Schizosaccharomyces pombe general transcript...    75   1e-12   
gb:CR382131_1663652 Yarrowia lipolytica chromosome E of strain C...    75   1e-12   
gb:AY205294_1309687 Sitobion avenae heterotrimeric guanine nucle...    75   1e-12   
gb:BA000045_742730 Gloeobacter violaceus PCC 7421 DNA, complete ...    75   1e-12   
pir|T39490|T39490 transcription initiation factor TFIID subunitb...    75   1e-12   
sp|Q9UUG8|TU12_SCHPO|TU12_SCHPO Transcriptional repressor tup12.>pir|T38992...    75   1e-12   
sp|Q00659|SCOB_EMENI|SCOB_EMENI Sulfur metabolite repression control protei...    75   1e-12   
sp|P39014|MT30_YEAST|MT30_YEAST MET30 protein.>pir|S49932|S49932 MET30 prot...    75   1e-12   
gb:BC073215_2557068 Xenopus laevis cDNA clone MGC:80502 IMAGE:51...    74   2e-12   
gb:AY225088_2520401 Xenopus laevis nuclear receptor co-repressor...    74   2e-12   
gb:AJ721075_2503262 Gallus gallus mRNA for hypothetical protein,...    74   2e-12   
gb:AF277162_2483899 Ambystoma tigrinum G-protein B3 subunit mRNA...    74   2e-12   
gb:BC008547_2090728 Mus musculus WD repeat domain 5, mRNA (cDNA ...    74   2e-12   
gb:AF110396_2054867 Mus musculus beta-transducin repeat-containi...    74   2e-12   
gb:AF268193_1893996 Homo sapiens IRA1 mRNA, complete cds, altern...    74   2e-12   
gb:DME011114_1378701 Drosophila melanogaster mRNA for coatomer a...    74   2e-12   
sp|Q9HAV0|GBB4_HUMAN|GBB4_HUMAN Guanine nucleotide-binding protein beta sub...    74   2e-12   
gb:BC061324_2553100 Xenopus tropicalis hypothetical protein MGC7...    74   2e-12   
gb:AB057374_2462759 Oryzias latipes Ol-Gb mRNA for guaninenucleo...    74   2e-12   
gb:BC052304_1984804 Homo sapiens transducin (beta)-like 1X-linke...    74   2e-12   
gb:AC082645_1733162 Oryza sativa chromosome 3 BAC OSJNBb0033N16 ...    74   2e-12   
gb:AY626793_1341614 Litopenaeus vannamei G protein beta 1 subuni...    74   2e-12   
gb:AK036064_1164339 Mus musculus 16 days neonate cerebellum cDNA...    74   2e-12   
gb:AE017188_1054024 Takifugu rubripes target 1 genomic scaffold.       74   2e-12   
pir|AH2154|AH2154 WD-repeat protein [imported] - Nostoc sp. (str...    74   2e-12   
pir|AB2410|AB2410 WD-repeat protein [imported] - Nostoc sp. (str...    74   2e-12   
pir|JS0669|RGMSB4 GTP-binding regulatory protein beta-4 chain - ...    74   2e-12   
sp|O60907|TBLX_HUMAN|TBLX_HUMAN F-box-like/WD-repeat protein TBL1X (Transdu...    74   2e-12   
sp|P78706|RCO1_NEUCR|RCO1_NEUCR Transcriptional repressor rco-1.>gb:NCU5706...    74   2e-12   
sp|P17343|GBB1_CAEEL|GBB1_CAEEL Guanine nucleotide-binding protein beta sub...    74   2e-12   
gb:AY294011_2525274 Danio rerio coatomer protein complex subunit...    74   3e-12   
gb:BC018512_2092753 Mus musculus transducin (beta)-like 1X-linke...    74   3e-12   
gb:AP003735_1832638 Oryza sativa (japonica cultivar-group) genom...    74   3e-12   
gb:DME6523_1379471 Drosophila melanogaster mRNA for the coatomer...    74   3e-12   
gb:AY089600_1297256 Drosophila melanogaster RE19540 full insert ...    74   3e-12   
gb:AF034793_1234787 Leishmania donovani activated protein kinase...    74   3e-12   
gb:AE013599_1132492 Drosophila melanogaster chromosome 2R, compl...    74   3e-12   
pir|S09591|RGKWB GTP-binding regulatory protein beta chain - Cae...    74   3e-12   
sp|Q55563|Y163_SYNY3|Y163_SYNY3 Hypothetical WD-repeat protein sll0163.>pir...    74   3e-12   
sp|Q25306|GBLP_LEIMA|GBLP_LEIMA Guanine nucleotide-binding protein beta sub...    74   3e-12   
sp|Q27434|GBLP_LEICH|GBLP_LEICH Guanine nucleotide-binding protein beta sub...    74   3e-12   
sp|O62621|COPP_DROME|COPP_DROME Coatomer beta' subunit (Beta'-coat protein)...    74   3e-12   
gb:XLU63922_2583467 Xenopus laevis beta-transducin repeat contai...    73   4e-12   
gb:BC074250_2557765 Xenopus laevis MGC84000 protein, mRNA (cDNA ...    73   4e-12   
gb:AY648754_2541582 Danio rerio cotamer alpha mRNA, complete cds.      73   4e-12   
gb:BC088397_2110521 Rattus norvegicus coatomer protein complex, ...    73   4e-12   
gb:BC048155_2099553 Mus musculus WD repeat domain 48, mRNA (cDNA...    73   4e-12   
gb:BC006679_2090303 Mus musculus WD repeat domain 48, mRNA (cDNA...    73   4e-12   
gb:AY552804_2086499 Rattus norvegicus G-protein beta 4 subunit (...    73   4e-12   
gb:HS283E3_1997889 Human DNA sequence from clone RP1-283E3 on ch...    73   4e-12   
gb:BC000326_1966617 Homo sapiens coatomer protein complex, subun...    73   4e-12   
gb:AE017343_1755380 Cryptococcus neoformans var. neoformans JEC2...    73   4e-12   
gb:LCO580822_1684028 Lotus corniculatus var. japonicus gene for ...    73   4e-12   
gb:PFA929352_1393011 Plasmodium falciparum strain 3D7, chromosom...    73   4e-12   
gb:AF391290_1267440 Branchiostoma floridae cosmid MPMGc117C0475,...    73   4e-12   
gb:AC116924_1206461 Dictyostelium discoideum chromosome 2 map 63...    73   4e-12   
gb:CR860632_1184691 Pongo pygmaeus mRNA; cDNA DKFZp459D1624 (fro...    73   4e-12   
gb:AK043970_1166765 Mus musculus 10 days neonate cortex cDNA, RI...    73   4e-12   
gb:AK035864_1164263 Mus musculus 16 days neonate cerebellum cDNA...    73   4e-12   
gb:AK031937_1162655 Mus musculus adult male medulla oblongata cD...    73   4e-12   
gb:AK030041_1161798 Mus musculus adult male testis cDNA, RIKEN f...    73   4e-12   
gb:AK018396_1159554 Mus musculus 16 days embryo lung cDNA, RIKEN...    73   4e-12   
gb:AK012599_1157051 Mus musculus 11 days embryo whole body cDNA,...    73   4e-12   
gb:BA000045_741705 Gloeobacter violaceus PCC 7421 DNA, complete ...    73   4e-12   
pir|T41075|T41075 hypothetical WD-repeat protein SPCC16A11.02 - ...    73   4e-12   
pir|S35312|S35312 coatomer complex beta' chain - bovine>gb:BTBET...    73   4e-12   
pir|S35342|S35342 Golgi-associated particle 102K chain - human         73   4e-12   
pir|F84600|F84600 coatomer alpha subunit [imported] - Arabidopsi...    73   4e-12   
sp|P29387|GBB4_MOUSE|GBB4_MOUSE Guanine nucleotide-binding protein beta sub...    73   4e-12   
sp|O45040|GBB1_HOMAM|GBB1_HOMAM Guanine nucleotide-binding protein G(I)/G(S...    73   4e-12   
sp|Q95RJ9|EBI_DROME|EBI_DROME F-box-like/WD-repeat protein ebi.>gb:AE01413...    73   4e-12   
sp|O55029|COPP_MOUSE|COPP_MOUSE Coatomer beta' subunit (Beta'-coat protein)...    73   4e-12   
sp|P35606|COPP_HUMAN|COPP_HUMAN Coatomer beta' subunit (Beta'-coat protein)...    73   4e-12   
sp|P35605|COPP_BOVIN|COPP_BOVIN Coatomer beta' subunit (Beta'-coat protein)...    73   4e-12   
gb:AY294009_2525272 Danio rerio coatomer protein complex subunit...    73   5e-12   
gb:AL445230_1927451 Human DNA sequence from clone RP11-517F10 on...    73   5e-12   
gb:SPBPJ4664_1720733 S.pombe chromosome II PCR product c4664.          73   5e-12   
gb:PCWO3G5_1699544 Pneumocystis carinii telomeric cosmid, WO3G5.       73   5e-12   
gb:CQ871262_1454665 Sequence 31 from Patent WO2004078112.>gb:AL4...    73   5e-12   
gb:CQ871260_1454664 Sequence 29 from Patent WO2004078112.>gb:BC0...    73   5e-12   
gb:CR548612_1375398 Paramecium tetraurelia macronuclear largest ...    73   5e-12   
gb:CNS06C8G_1372727 chromosome I of strain GB-M1 of Encephalitoz...    73   5e-12   
gb:AF339101_1263995 Heterodera glycines beta-transducin repeat-c...    73   5e-12   
gb:AC024200_1204226 Caenorhabditis elegans cosmid Y71F9AL, compl...    73   5e-12   
gb:CR749477_1181080 Homo sapiens mRNA; cDNA DKFZp781G1023 (from ...    73   5e-12   
gb:AK043479_1166601 Mus musculus 7 days neonate cerebellum cDNA,...    73   5e-12   
gb:BA000045_740800 Gloeobacter violaceus PCC 7421 DNA, complete ...    73   5e-12   
pir|T02146|T02146 coatomer complex alpha chain homolog F8K4.21 -...    73   5e-12   
sp|Q23256|YH92_CAEEL|YH92_CAEEL Hypothetical 54.5 kDa Trp-Asp repeats conta...    73   5e-12   
sp|P53621|COPA_HUMAN|COPA_HUMAN Coatomer alpha subunit (Alpha-coat protein)...    73   5e-12   
sp|Q27954|COPA_BOVIN|COPA_BOVIN Coatomer alpha subunit (Alpha-coat protein)...    73   5e-12   
gb:BC075251_2558357 Xenopus laevis coatomer protein complex, sub...    72   7e-12   
gb:AJ719937_2502124 Gallus gallus mRNA for hypothetical protein,...    72   7e-12   
gb:AF002705_2050069 Rattus norvegicus beta prime COP mRNA, compl...    72   7e-12   
gb:BC002884_1968496 Homo sapiens Notchless gene homolog (Drosoph...    72   7e-12   
gb:AF277458_1782772 Arabidopsis thaliana LEUNIG (LEUNIG) mRNA, c...    72   7e-12   
gb:AX135811_1461885 Sequence 5 from Patent WO0132614.                  72   7e-12   
gb:BOVGP_1435480 Bovine signal-transducing guanine nucleotide-bi...    72   7e-12   
gb:CR857200_1181447 Pongo pygmaeus mRNA; cDNA DKFZp468I2316 (fro...    72   7e-12   
gb:AE014297_1140594 Drosophila melanogaster chromosome 3R, compl...    72   7e-12   
sp|Q91854|TRCB_XENLA|TRCB_XENLA Beta-TrCP (Beta-transducin repeat-containin...    72   7e-12   
sp|Q9FUY2|LUG_ARATH|LUG_ARATH Transcriptional corepressor LEUNIG.                72   7e-12   
sp|Q9NVX2|HUS7_HUMAN|HUS7_HUMAN WD-repeat protein HUSSY-07.>gb:AX405715_146...    72   7e-12   
sp|O35142|COPP_RAT|COPP_RAT Coatomer beta' subunit (Beta'-coat protein) (...    72   7e-12   
gb:AK122511_2069176 Mus musculus mRNA for mKIAA1449 protein.           72   9e-12   
gb:AP003487_1829853 Oryza sativa (japonica cultivar-group) genom...    72   9e-12   
gb:AF197225_1776129 Emericella nidulans TUPA (tupA) gene, comple...    72   9e-12   
gb:AE017345_1756987 Cryptococcus neoformans var. neoformans JEC2...    72   9e-12   
gb:AY654583_1620215 Lolium perenne FY protein (FY) mRNA, partial...    72   9e-12   
gb:AB086901_1524594 Magnaporthe grisea Mgb1 gene for heterotrime...    72   9e-12   
gb:AF032878_1234644 Drosophila melanogaster Slimb (slimb) mRNA, ...    72   9e-12   
gb:AB047301_1195879 Halocynthia roretzi HrG-beta mRNA for G prot...    72   9e-12   
gb:AE014296_1136134 Drosophila melanogaster chromosome 3L, compl...    72   9e-12   
gb:AE016959_1020595 Oryza sativa (japonica cultivar-group) chrom...    72   9e-12   
gb:BA000045_743736 Gloeobacter violaceus PCC 7421 DNA, complete ...    72   9e-12   
sp|P26308|GBB1_DROME|GBB1_DROME Guanine nucleotide-binding protein beta sub...    72   9e-12   
gb:BC084797_2564042 Xenopus laevis hypothetical LOC495335, mRNA ...    72   1e-11   
gb:BC045356_2549198 Danio rerio F-box and WD-40 domain protein 1...    72   1e-11   
gb:AJ719451_2501638 Gallus gallus mRNA for hypothetical protein,...    72   1e-11   
gb:MMU34960_2120934 Mouse G protein beta 2 subunit mRNA, complet...    72   1e-11   
gb:BC051639_2100799 Mus musculus PRP4 pre-mRNA processing factor...    72   1e-11   
gb:AL732594_2072985 Mouse DNA sequence from clone RP24-189G18 on...    72   1e-11   
gb:HSU82756_2026633 Homo sapiens WD splicing factor Hprp4p (HPRP...    72   1e-11   
gb:CR457105_1993312 Homo sapiens full open reading frame cDNA cl...    72   1e-11   
gb:AL449305_1927826 Human DNA sequence from clone RP11-110L1 on ...    72   1e-11   
gb:AF310672_1896230 Homo sapiens PF20 variant 1a (PF20) mRNA, co...    72   1e-11   
gb:AF016369_1876688 Homo sapiens U4/U6 small nuclear ribonucleop...    72   1e-11   
gb:CR382131_1664274 Yarrowia lipolytica chromosome E of strain C...    72   1e-11   
gb:BX908807_1644488 Neurospora crassa DNA linkage group III BAC ...    72   1e-11   
gb:CR382398_1374896 Plasmodium falciparum chromosome 6, complete...    72   1e-11   
gb:CR926107_1185612 Pongo pygmaeus mRNA; cDNA DKFZp459M0410 (fro...    72   1e-11   
gb:AK090114_1176151 Mus musculus skin RCB-1283 B16 melanoma cDNA...    72   1e-11   
gb:AK005464_1153044 Mus musculus adult female placenta cDNA, RIK...    72   1e-11   
gb:AE014297_1140742 Drosophila melanogaster chromosome 3R, compl...    72   1e-11   
gb:AP004312_555846 Synechocystis sp. PCC 6803 plasmid pSYSG DNA,...    72   1e-11   
pir|G96563|G96563 probable coatomer complex subunit, 33791-27676...    72   1e-11   
sp|P56093|TUP1_CANAL|TUP1_CANAL Transcriptional repressor TUP1.>gb:AF005741...    72   1e-11   
sp|O43172|PRP4_HUMAN|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 ...    72   1e-11   
sp|Q9EPV5|APAF_RAT|APAF_RAT Apoptotic protease activating factor 1 (Apaf-...    72   1e-11   
gb:BC077271_2559985 Xenopus laevis MGC80037 protein, mRNA (cDNA ...    71   1e-11   
gb:BC059436_2552413 Danio rerio guanine nucleotide binding prote...    71   1e-11   
gb:BC034261_2097619 Mus musculus F-box and WD-40 domain protein ...    71   1e-11   
gb:BC008552_2090730 Mus musculus F-box and WD-40 domain protein ...    71   1e-11   
gb:AL669844_2072493 Mouse DNA sequence from clone RP23-395O6 on ...    71   1e-11   
gb:AF397193_2064860 Rattus norvegicus G-protein beta-2 subunit m...    71   1e-11   
gb:AB093260_2048045 Mus musculus mRNA for mKIAA0696 protein.           71   1e-11   


>pir|E86245|E86245 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_890124 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC007259_1535696 Arabidopsis thaliana
           chromosome I BAC T28P6 genomic sequence, complete
           sequence.
          Length = 961

 Score =  265 bits (678), Expect = 4e-70
 Identities = 121/158 (76%), Positives = 139/158 (87%)
 Frame = +2

Query: 197 MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP 376
           MAKRGYKLQEFVAHSGNVNCL  GKKT R+ LTGGDD+ VNLWSIGK TS  +L GHTSP
Sbjct: 1   MAKRGYKLQEFVAHSGNVNCLSIGKKTSRLLLTGGDDYKVNLWSIGKTTSPMSLCGHTSP 60

Query: 377 VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM 556
           V+S+AF+S E+LV AG+SSG+IKLWDLE++KM+R  +GHRS C+A+EFHPFGEF ASGS 
Sbjct: 61  VDSVAFNSEEVLVLAGASSGVIKLWDLEESKMVRAFTGHRSNCSAVEFHPFGEFLASGSS 120

Query: 557 DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           DTNL++WD RKKGCI TYKGHTRGISTI F+PDGRWVV
Sbjct: 121 DTNLRVWDTRKKGCIQTYKGHTRGISTIEFSPDGRWVV 158



 Score = 79.3 bits (194), Expect = 5e-14
 Identities = 41/148 (27%), Positives = 65/148 (43%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           ++ F  H  N + + F         +G  D ++ +W   K     T  GHT  + +I F 
Sbjct: 93  VRAFTGHRSNCSAVEF-HPFGEFLASGSSDTNLRVWDTRKKGCIQTYKGHTRGISTIEFS 151

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                V +G    ++K+WDL   K++     H     +L+FHP     A+GS D  +K W
Sbjct: 152 PDGRWVVSGGLDNVVKVWDLTAGKLLHEFKCHEGPIRSLDFHPLEFLLATGSADRTVKFW 211

Query: 578 DIRKKGCIHTYKGHTRGISTIRFTPDGR 661
           D+     I T +    G+  I F PDG+
Sbjct: 212 DLETFELIGTTRPEATGVRAIAFHPDGQ 239



 Score = 62.4 bits (150), Expect = 7e-09
 Identities = 34/120 (28%), Positives = 58/120 (48%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           +Q +  H+  ++ + F     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct: 135 IQTYKGHTRGISTIEFSPDG-RWVVSGGLDNVVKVWDLTAGKLLHEFKCHEGPIRSLDFH 193

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
             E L+A GS+   +K WDLE  ++I T     +   A+ FHP G+    G +D  LK++
Sbjct: 194 PLEFLLATGSADRTVKFWDLETFELIGTTRPEATGVRAIAFHPDGQTLFCG-LDDGLKVY 252



>gb:OSJN00083_1694591 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0064G10, complete sequence.
          Length = 935

 Score =  263 bits (673), Expect = 2e-69
 Identities = 117/156 (75%), Positives = 138/156 (88%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           KR YKLQEFVAHS NVNCL+ G+KT R+ +TGGDDH VNLW+IGKP S  +LSGHTS VE
Sbjct: 6   KRAYKLQEFVAHSSNVNCLKIGRKTSRVLVTGGDDHKVNLWAIGKPNSILSLSGHTSAVE 65

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
           S+ FDS E+ VAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct: 66  SVNFDSTEVFVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCMSVDFHPFGEFFASGSLDT 125

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           NLKIWDIR+KGCIHTYKGHTRG++ IRFTPDGRWVV
Sbjct: 126 NLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVV 161



 Score = 79.3 bits (194), Expect = 5e-14
 Identities = 39/125 (31%), Positives = 59/125 (47%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F +G  D ++ +W I +     T  GHT  V +I F      V +G    ++KLWDL   
Sbjct: 118 FASGSLDTNLKIWDIRRKGCIHTYKGHTRGVNAIRFTPDGRWVVSGGEDNVVKLWDLTAG 177

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
           K++     H      ++FHP     A+GS D  +K WD+     I +    T G+ ++ F
Sbjct: 178 KLLHDFKCHEGQIQCIDFHPHEFLLATGSSDKTVKFWDLETFELIGSTGPETTGVRSMTF 237

Query: 647 TPDGR 661
            PDGR
Sbjct: 238 NPDGR 242



 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 35/130 (26%), Positives = 59/130 (45%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           +  +  H+  VN +RF     R  ++GG+D+ V LW +           H   ++ I F 
Sbjct: 138 IHTYKGHTRGVNAIRFTPDG-RWVVSGGEDNVVKLWDLTAGKLLHDFKCHEGQIQCIDFH 196

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
             E L+A GSS   +K WDLE  ++I +     +   ++ F+P G     G +  +LK++
Sbjct: 197 PHEFLLATGSSDKTVKFWDLETFELIGSTGPETTGVRSMTFNPDGRSLLCG-LHESLKVF 255

Query: 578 DIRKKGCIHT 607
                 C  T
Sbjct: 256 SWEPIRCHDT 265



>pir|A96638|A96638 hypothetical protein F11P17.7 [imported] -
           Arabidopsis thaliana>gb:AE005173_893791 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC002294_1530167 Arabidopsis thaliana
           chromosome I BAC F11P17 genomic sequence, complete
           sequence.
          Length = 1184

 Score =  260 bits (665), Expect = 1e-68
 Identities = 122/168 (72%), Positives = 140/168 (83%), Gaps = 10/168 (5%)
 Frame = +2

Query: 197 MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTST--------- 349
           MAKRGYKLQEF+AHS NVNCL  GKKT R+F+TGGDD+ VNLW+IGKPTS          
Sbjct: 1   MAKRGYKLQEFLAHSANVNCLSIGKKTSRLFITGGDDYKVNLWAIGKPTSLMKNDAIAFY 60

Query: 350 -STLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHP 526
             +L GHTS V+S+AFDSAE+LV AG+SSG+IKLWD+E+ KM+R  +GHRS C+A+EFHP
Sbjct: 61  WQSLCGHTSAVDSVAFDSAEVLVLAGASSGVIKLWDVEEAKMVRAFTGHRSNCSAVEFHP 120

Query: 527 FGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           FGEF ASGS D NLKIWDIRKKGCI TYKGH+RGISTIRFTPDGRWVV
Sbjct: 121 FGEFLASGSSDANLKIWDIRKKGCIQTYKGHSRGISTIRFTPDGRWVV 168



 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 41/148 (27%), Positives = 68/148 (45%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           ++ F  H  N + + F         +G  D ++ +W I K     T  GH+  + +I F 
Sbjct: 103 VRAFTGHRSNCSAVEF-HPFGEFLASGSSDANLKIWDIRKKGCIQTYKGHSRGISTIRFT 161

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                V +G    ++K+WDL   K++     H     +L+FHP     A+GS D  +K W
Sbjct: 162 PDGRWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPIRSLDFHPLEFLLATGSADRTVKFW 221

Query: 578 DIRKKGCIHTYKGHTRGISTIRFTPDGR 661
           D+     I + +    G+ +I+F PDGR
Sbjct: 222 DLETFELIGSTRPEATGVRSIKFHPDGR 249



 Score = 63.2 bits (152), Expect = 4e-09
 Identities = 39/141 (27%), Positives = 67/141 (47%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           +Q +  HS  ++ +RF     R  ++GG D+ V +W +           H  P+ S+ F 
Sbjct: 145 IQTYKGHSRGISTIRFTPDG-RWVVSGGLDNVVKVWDLTAGKLLHEFKFHEGPIRSLDFH 203

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
             E L+A GS+   +K WDLE  ++I +     +   +++FHP G     G +D +LK++
Sbjct: 204 PLEFLLATGSADRTVKFWDLETFELIGSTRPEATGVRSIKFHPDGRTLFCG-LDDSLKVY 262

Query: 578 DIRKKGCIHTYKGHTRGISTI 640
                 C   + G   G ST+
Sbjct: 263 SWEPVVC---HDGVDMGWSTL 280



>gb:BT002053_1635656 Arabidopsis thaliana putative protein
           (At5g23430) mRNA, complete cds.
          Length = 837

 Score =  252 bits (644), Expect = 4e-66
 Identities = 109/156 (69%), Positives = 138/156 (88%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  +L GH+S ++
Sbjct: 4   KRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILSLYGHSSGID 63

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
           S+ FD++E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFGEFFASGS+DT
Sbjct: 64  SVTFDASEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFGEFFASGSLDT 123

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           NLKIWDIRKKGCIHTYKGHTRG++ +RFTPDGRWVV
Sbjct: 124 NLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVV 159



 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 39/128 (30%), Positives = 60/128 (46%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F +G  D ++ +W I K     T  GHT  V  + F      V +G    ++K+WDL   
Sbjct: 116 FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVVSGGEDNIVKVWDLTAG 175

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
           K++     H     +L+FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct: 176 KLLTEFKSHEGQIQSLDFHPHEFLLATGSADRTVKFWDLETFELIGSGGPETAGVRCLSF 235

Query: 647 TPDGRWVV 670
            PDG+ V+
Sbjct: 236 NPDGKTVL 243



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 34/120 (28%), Positives = 59/120 (49%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           +  +  H+  VN LRF     R  ++GG+D+ V +W +      +    H   ++S+ F 
Sbjct: 136 IHTYKGHTRGVNVLRFTPDG-RWVVSGGEDNIVKVWDLTAGKLLTEFKSHEGQIQSLDFH 194

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
             E L+A GS+   +K WDLE  ++I +     +    L F+P G+    G +  +LKI+
Sbjct: 195 PHEFLLATGSADRTVKFWDLETFELIGSGGPETAGVRCLSFNPDGKTVLCG-LQESLKIF 253



>gb:AB018110_1513757 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K19M13.
          Length = 932

 Score =  245 bits (625), Expect = 6e-64
 Identities = 109/166 (65%), Positives = 138/166 (83%), Gaps = 10/166 (6%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTST----------S 352
           KR YKLQEFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +            
Sbjct: 4   KRAYKLQEFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAILVSSRVLVCCQ 63

Query: 353 TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           +L GH+S ++S+ FD++E+LVAAG++SG IKLWDLE+ K++RTL+GHRS C +++FHPFG
Sbjct: 64  SLYGHSSGIDSVTFDASEVLVAAGAASGTIKLWDLEEAKIVRTLTGHRSNCISVDFHPFG 123

Query: 533 EFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           EFFASGS+DTNLKIWDIRKKGCIHTYKGHTRG++ +RFTPDGRWVV
Sbjct: 124 EFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVV 169



 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 39/128 (30%), Positives = 60/128 (46%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F +G  D ++ +W I K     T  GHT  V  + F      V +G    ++K+WDL   
Sbjct: 126 FASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWVVSGGEDNIVKVWDLTAG 185

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
           K++     H     +L+FHP     A+GS D  +K WD+     I +    T G+  + F
Sbjct: 186 KLLTEFKSHEGQIQSLDFHPHEFLLATGSADRTVKFWDLETFELIGSGGPETAGVRCLSF 245

Query: 647 TPDGRWVV 670
            PDG+ V+
Sbjct: 246 NPDGKTVL 253



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 34/120 (28%), Positives = 59/120 (49%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           +  +  H+  VN LRF     R  ++GG+D+ V +W +      +    H   ++S+ F 
Sbjct: 146 IHTYKGHTRGVNVLRFTPDG-RWVVSGGEDNIVKVWDLTAGKLLTEFKSHEGQIQSLDFH 204

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
             E L+A GS+   +K WDLE  ++I +     +    L F+P G+    G +  +LKI+
Sbjct: 205 PHEFLLATGSADRTVKFWDLETFELIGSGGPETAGVRCLSFNPDGKTVLCG-LQESLKIF 263



>gb:ATF8L15_1551226 Arabidopsis thaliana DNA chromosome 5, BAC clone
           F8L15 (ESSA project).
          Length = 823

 Score =  239 bits (610), Expect = 3e-62
 Identities = 107/166 (64%), Positives = 136/166 (81%), Gaps = 10/166 (6%)
 Frame = +2

Query: 203 KRGYKLQ----------EFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTS 352
           KR YKL+          EFVAHS  VNCL+ G+K+ R+ +TGG+DH VNLW+IGKP +  
Sbjct: 87  KRAYKLRILFSLISSFREFVAHSAAVNCLKIGRKSSRVLVTGGEDHKVNLWAIGKPNAIL 146

Query: 353 TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           +L GH+S ++S+ FD++E LVAAG++SG IKLWDLE+ K++RTL+GHRS C ++ FHPFG
Sbjct: 147 SLYGHSSGIDSVTFDASEGLVAAGAASGTIKLWDLEEAKVVRTLTGHRSNCVSVNFHPFG 206

Query: 533 EFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           EFFASGS+DTNLKIWDIRKKGCIHTYKGHTRG++ +RFTPDGRW+V
Sbjct: 207 EFFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWIV 252



 Score = 78.6 bits (192), Expect = 9e-14
 Identities = 42/142 (29%), Positives = 66/142 (46%)
 Frame = +2

Query: 245 NVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAG 424
           +VN   FG+     F +G  D ++ +W I K     T  GHT  V  + F      + +G
Sbjct: 199 SVNFHPFGE----FFASGSLDTNLKIWDIRKKGCIHTYKGHTRGVNVLRFTPDGRWIVSG 254

Query: 425 SSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIH 604
               ++K+WDL   K++     H     +L+FHP     A+GS D  +K WD+     I 
Sbjct: 255 GEDNVVKVWDLTAGKLLHEFKSHEGKIQSLDFHPHEFLLATGSADKTVKFWDLETFELIG 314

Query: 605 TYKGHTRGISTIRFTPDGRWVV 670
           +    T G+  + F PDG+ V+
Sbjct: 315 SGGTETTGVRCLTFNPDGKSVL 336



 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 31/115 (26%), Positives = 54/115 (46%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           +  +  H+  VN LRF     R  ++GG+D+ V +W +           H   ++S+ F 
Sbjct: 229 IHTYKGHTRGVNVLRFTPDG-RWIVSGGEDNVVKVWDLTAGKLLHEFKSHEGKIQSLDFH 287

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
             E L+A GS+   +K WDLE  ++I +     +    L F+P G+    G  ++
Sbjct: 288 PHEFLLATGSADKTVKFWDLETFELIGSGGTETTGVRCLTFNPDGKSVLCGLQES 342



>gb:AP003224_1825590 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0010B10.
          Length = 838

 Score =  239 bits (609), Expect = 4e-62
 Identities = 109/156 (69%), Positives = 129/156 (82%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           KRGY+LQEFVAH   V  L  GKK+ R+F+TGG D  VNLW+IGK T   +LSGHT  VE
Sbjct: 5   KRGYRLQEFVAHDAEVRSLSIGKKSSRVFITGGSDRKVNLWAIGKQTPLLSLSGHTGSVE 64

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
           ++ FD+AE+LV AGSS+G IKLWDLE+ K++R+L+GHRS CT++EFHPFGEFFASGS DT
Sbjct: 65  AVEFDTAEVLVLAGSSNGSIKLWDLEEAKVVRSLTGHRSSCTSVEFHPFGEFFASGSSDT 124

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           +LKIWDI+KKGCIHTYKGH   I TIRFTPDGRWVV
Sbjct: 125 DLKIWDIKKKGCIHTYKGHRGAIRTIRFTPDGRWVV 160



 Score = 72.0 bits (175), Expect = 9e-12
 Identities = 35/125 (28%), Positives = 54/125 (43%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F +G  D  + +W I K     T  GH   + +I F      V  G    ++K+WDL   
Sbjct: 117 FASGSSDTDLKIWDIKKKGCIHTYKGHRGAIRTIRFTPDGRWVVTGGEDNIVKVWDLTAG 176

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
           K++     H      ++FHP     A+GS D  +K WD+     I +      G+ +  F
Sbjct: 177 KLLHDFKFHSGQIRCIDFHPQEFLLATGSADRTVKFWDLETFELIGSAGPEATGVRSTVF 236

Query: 647 TPDGR 661
            PDG+
Sbjct: 237 HPDGK 241



 Score = 59.3 bits (142), Expect = 6e-08
 Identities = 34/127 (26%), Positives = 58/127 (45%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           +  +  H G +  +RF     R  +TGG+D+ V +W +           H+  +  I F 
Sbjct: 137 IHTYKGHRGAIRTIRFTPDG-RWVVTGGEDNIVKVWDLTAGKLLHDFKFHSGQIRCIDFH 195

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
             E L+A GS+   +K WDLE  ++I +     +   +  FHP G+    G +D +LK++
Sbjct: 196 PQEFLLATGSADRTVKFWDLETFELIGSAGPEATGVRSTVFHPDGKTLFCG-LDQSLKVF 254

Query: 578 DIRKKGC 598
                 C
Sbjct: 255 SWEPVRC 261



>gb:AF052433_1236753 Strongylocentrotus purpuratus katanin p80
           subunit mRNA, complete cds.
          Length = 690

 Score =  208 bits (530), Expect = 6e-53
 Identities = 91/156 (58%), Positives = 124/156 (79%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           KR +KLQE VAHS NVNCL  G  + R+ +TGG+D  VNLW++GK     +LSGHTSPV+
Sbjct: 4   KRAWKLQELVAHSSNVNCLALGPMSGRVMVTGGEDKKVNLWAVGKQNCIISLSGHTSPVD 63

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
           S+ F+S+E LV AGS SG +K++DLE  K++RTL+GHR+    ++FHPFGEF ASGS DT
Sbjct: 64  SVKFNSSEELVVAGSQSGTMKIYDLEPAKIVRTLTGHRNSIRCMDFHPFGEFVASGSTDT 123

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           N+K+WD+R+KGCI+TYKGH+  ++ I+F+PDG+W+V
Sbjct: 124 NVKLWDVRRKGCIYTYKGHSDQVNMIKFSPDGKWLV 159



 Score = 73.9 bits (180), Expect = 2e-12
 Identities = 40/150 (26%), Positives = 63/150 (42%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           ++    H  ++ C+ F         +G  D +V LW + +     T  GH+  V  I F 
Sbjct: 94  VRTLTGHRNSIRCMDF-HPFGEFVASGSTDTNVKLWDVRRKGCIYTYKGHSDQVNMIKFS 152

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                +   S    IKLWDL   K+ +    H    T +EFHP     ASGS D  ++ W
Sbjct: 153 PDGKWLVTASEDTTIKLWDLTMGKLFQEFKNHTGGVTGIEFHPNEFLLASGSSDRTVQFW 212

Query: 578 DIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           D+     + +       + +I F PDG ++
Sbjct: 213 DLETFQLVSSTSPGASAVRSISFHPDGSYL 242



 Score = 62.8 bits (151), Expect = 5e-09
 Identities = 32/111 (28%), Positives = 52/111 (46%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           +  HS  VN ++F     +  +T  +D ++ LW +           HT  V  I F   E
Sbjct: 139 YKGHSDQVNMIKFSPDG-KWLVTASEDTTIKLWDLTMGKLFQEFKNHTGGVTGIEFHPNE 197

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
            L+A+GSS   ++ WDLE  +++ + S   S   ++ FHP G +    S D
Sbjct: 198 FLLASGSSDRTVQFWDLETFQLVSSTSPGASAVRSISFHPDGSYLFCSSQD 248



>gb:AE016959_1023236 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC068950_1540556
           Oryza sativa chromosome 10 BAC OSJNBa0041P03 genomic
           sequence, complete sequence.>gb:AE017108_1753055 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           62 of 77 of the complete sequence.
          Length = 866

 Score =  207 bits (528), Expect = 1e-52
 Identities = 91/150 (60%), Positives = 120/150 (80%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           +EFVAH+ +VNC++FG+KT R+ +TGG+D               +LSG TSPVES++FDS
Sbjct: 28  EEFVAHASDVNCVKFGRKTSRILITGGEDQK-------------SLSGLTSPVESVSFDS 74

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
           +E ++ AG+SSG IK+WD+++ K++RT +GHRS C +L+FHPFGEFFASGS DTN+KIWD
Sbjct: 75  SEAMIGAGASSGTIKIWDVDEAKVVRTFTGHRSSCASLDFHPFGEFFASGSSDTNMKIWD 134

Query: 581 IRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           +RKKGCIHTYKGHTR I  +RFTPDGRW+V
Sbjct: 135 MRKKGCIHTYKGHTRRIDVLRFTPDGRWIV 164



 Score = 70.1 bits (170), Expect = 3e-11
 Identities = 33/125 (26%), Positives = 56/125 (44%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F +G  D ++ +W + K     T  GHT  ++ + F      + +G S   +K+WDL   
Sbjct: 121 FASGSSDTNMKIWDMRKKGCIHTYKGHTRRIDVLRFTPDGRWIVSGGSDNSVKIWDLTAG 180

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
           K++     H      L+FHP     A+GS D  +K WD+     I +       + ++ F
Sbjct: 181 KLLHDFRNHEGPINCLDFHPHEFLLATGSADKTVKFWDLETFELIGSSGPEASVVRSMTF 240

Query: 647 TPDGR 661
             DG+
Sbjct: 241 NKDGK 245



 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 34/126 (26%), Positives = 60/126 (47%)
 Frame = +2

Query: 197 MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP 376
           M K+G  +  +  H+  ++ LRF     R  ++GG D+SV +W +           H  P
Sbjct: 135 MRKKGC-IHTYKGHTRRIDVLRFTPDG-RWIVSGGSDNSVKIWDLTAGKLLHDFRNHEGP 192

Query: 377 VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM 556
           +  + F   E L+A GS+   +K WDLE  ++I +     S   ++ F+  G+    G +
Sbjct: 193 INCLDFHPHEFLLATGSADKTVKFWDLETFELIGSSGPEASVVRSMTFNKDGKSLFCG-L 251

Query: 557 DTNLKI 574
             +LK+
Sbjct: 252 HESLKV 257



>gb:BT007777_2150709 Synthetic construct Homo sapiens katanin p80
           (WD40-containing) subunit B 1 mRNA, partial cds.
          Length = 656

 Score =  195 bits (496), Expect = 5e-49
 Identities = 85/157 (54%), Positives = 118/157 (75%)
 Frame = +2

Query: 197 MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP 376
           + K  +KLQE VAH+ NV+ L  GK + R+  TGGDD  VNLWSI KP    +L+GHTSP
Sbjct: 6   VTKTAWKLQEIVAHASNVSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIMSLTGHTSP 65

Query: 377 VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM 556
           VES+  ++ E L+ AGS SG I++WDLE  K++RTL GH++   +L+FHP+GEF ASGS 
Sbjct: 66  VESVRLNTPEELIVAGSQSGSIRVWDLEAAKILRTLMGHKANICSLDFHPYGEFVASGSQ 125

Query: 557 DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           DTN+K+WDIR+KGC+  Y+GH++ +  +RF+PDG+W+
Sbjct: 126 DTNIKLWDIRRKGCVFRYRGHSQAVRCLRFSPDGKWL 162



 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 41/147 (27%), Positives = 64/147 (43%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           L+  + H  N+  L F         +G  D ++ LW I +        GH+  V  + F 
Sbjct: 98  LRTLMGHKANICSLDFHPYG-EFVASGSQDTNIKLWDIRRKGCVFRYRGHSQAVRCLRFS 156

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                +A+ +    +KLWDL   KM+    GH      +EFHP     ASGS D  ++ W
Sbjct: 157 PDGKWLASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVVEFHPNEYLLASGSSDRTIRFW 216

Query: 578 DIRKKGCIHTYKGHTRGISTIRFTPDG 658
           D+ K   +   +G    + ++ F PDG
Sbjct: 217 DLEKFQVVSCIEGEPGPVRSVLFNPDG 243



 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 40/121 (33%), Positives = 60/121 (49%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           HS  V CLRF     +   +  DDH+V LW +      S   GHT PV  + F   E L+
Sbjct: 146 HSQAVRCLRFSPDG-KWLASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVVEFHPNEYLL 204

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
           A+GSS   I+ WDLE  +++  + G      ++ F+P G    SG  D +L+++    + 
Sbjct: 205 ASGSSDRTIRFWDLEKFQVVSCIEGEPGPVRSVLFNPDGCCLYSGCQD-SLRVYGWEPER 263

Query: 596 C 598
           C
Sbjct: 264 C 264



>gb:BC001353_1967515 Homo sapiens katanin p80 (WD repeat containing)
           subunit B 1, mRNA (cDNA clone MGC:8689 IMAGE:2964632),
           complete cds.>gb:BT007022_1990460 Homo sapiens katanin
           p80 (WD40-containing) subunit B 1 mRNA, complete
           cds.>gb:CR456762_1992969 Homo sapiens full open reading
           frame cDNA clone RZPDo834D024D for gene KATNB1, katanin
           p80 (WD repeat containing) subunit B 1; complete cds,
           incl. stopcodon.
          Length = 655

 Score =  195 bits (496), Expect = 5e-49
 Identities = 85/157 (54%), Positives = 118/157 (75%)
 Frame = +2

Query: 197 MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP 376
           + K  +KLQE VAH+ NV+ L  GK + R+  TGGDD  VNLWSI KP    +L+GHTSP
Sbjct: 6   VTKTAWKLQEIVAHASNVSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIMSLTGHTSP 65

Query: 377 VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM 556
           VES+  ++ E L+ AGS SG I++WDLE  K++RTL GH++   +L+FHP+GEF ASGS 
Sbjct: 66  VESVRLNTPEELIVAGSQSGSIRVWDLEAAKILRTLMGHKANICSLDFHPYGEFVASGSQ 125

Query: 557 DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           DTN+K+WDIR+KGC+  Y+GH++ +  +RF+PDG+W+
Sbjct: 126 DTNIKLWDIRRKGCVFRYRGHSQAVRCLRFSPDGKWL 162



 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 41/147 (27%), Positives = 64/147 (43%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           L+  + H  N+  L F         +G  D ++ LW I +        GH+  V  + F 
Sbjct: 98  LRTLMGHKANICSLDFHPYG-EFVASGSQDTNIKLWDIRRKGCVFRYRGHSQAVRCLRFS 156

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                +A+ +    +KLWDL   KM+    GH      +EFHP     ASGS D  ++ W
Sbjct: 157 PDGKWLASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVVEFHPNEYLLASGSSDRTIRFW 216

Query: 578 DIRKKGCIHTYKGHTRGISTIRFTPDG 658
           D+ K   +   +G    + ++ F PDG
Sbjct: 217 DLEKFQVVSCIEGEPGPVRSVLFNPDG 243



 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 40/121 (33%), Positives = 60/121 (49%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           HS  V CLRF     +   +  DDH+V LW +      S   GHT PV  + F   E L+
Sbjct: 146 HSQAVRCLRFSPDG-KWLASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVVEFHPNEYLL 204

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
           A+GSS   I+ WDLE  +++  + G      ++ F+P G    SG  D +L+++    + 
Sbjct: 205 ASGSSDRTIRFWDLEKFQVVSCIEGEPGPVRSVLFNPDGCCLYSGCQD-SLRVYGWEPER 263

Query: 596 C 598
           C
Sbjct: 264 C 264



>gb:AK034103_1163633 Mus musculus adult male diencephalon cDNA,
           RIKEN full-length enriched library, clone:9330156L08
           product:katanin p80 (WD40-containing) subunit B 1, full
           insert sequence.>gb:AK049345_1168745 Mus musculus ES
           cells cDNA, RIKEN full-length enriched library,
           clone:C330026F14 product:katanin p80 (WD40-containing)
           subunit B 1, full insert sequence.>gb:AK087973_1175118
           Mus musculus 2 days neonate thymus thymic cells cDNA,
           RIKEN full-length enriched library, clone:E430001K24
           product:katanin p80 (WD40-containing) subunit B 1, full
           insert sequence.>gb:BC045200_2099098 Mus musculus
           katanin p80 (WD40-containing) subunit B 1, mRNA (cDNA
           clone MGC:49345 IMAGE:5322489), complete
           cds.>gb:BC087177_2565034 Xenopus laevis hypothetical
           LOC495853, mRNA (cDNA clone MGC:97963 IMAGE:7197896),
           complete cds.
          Length = 658

 Score =  195 bits (496), Expect = 5e-49
 Identities = 85/157 (54%), Positives = 118/157 (75%)
 Frame = +2

Query: 197 MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP 376
           + K  +KLQE VAH+ NV+ L  GK + R+  TGGDD  VNLWSI KP    +L+GHTSP
Sbjct: 6   VTKTAWKLQEIVAHASNVSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIMSLTGHTSP 65

Query: 377 VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM 556
           VES+  ++ E L+ AGS SG I++WDLE  K++RTL GH++   +L+FHP+GEF ASGS 
Sbjct: 66  VESVRLNTPEELIVAGSQSGSIRVWDLEAAKILRTLMGHKANICSLDFHPYGEFVASGSQ 125

Query: 557 DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           DTN+K+WDIR+KGC+  Y+GH++ +  +RF+PDG+W+
Sbjct: 126 DTNIKLWDIRRKGCVFRYRGHSQAVRCLRFSPDGKWL 162



 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 41/147 (27%), Positives = 64/147 (43%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           L+  + H  N+  L F         +G  D ++ LW I +        GH+  V  + F 
Sbjct: 98  LRTLMGHKANICSLDFHPYG-EFVASGSQDTNIKLWDIRRKGCVFRYRGHSQAVRCLRFS 156

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                +A+ +    +KLWDL   KM+    GH      +EFHP     ASGS D  ++ W
Sbjct: 157 PDGKWLASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVVEFHPNEYLLASGSSDRTIRFW 216

Query: 578 DIRKKGCIHTYKGHTRGISTIRFTPDG 658
           D+ K   +   +G    + ++ F PDG
Sbjct: 217 DLEKFQVVSCIEGEPGPVRSVLFNPDG 243



 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 40/121 (33%), Positives = 60/121 (49%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           HS  V CLRF     +   +  DDH+V LW +      S   GHT PV  + F   E L+
Sbjct: 146 HSQAVRCLRFSPDG-KWLASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVVEFHPNEYLL 204

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
           A+GSS   I+ WDLE  +++  + G      ++ F+P G    SG  D +L+++    + 
Sbjct: 205 ASGSSDRTIRFWDLEKFQVVSCIEGEPGPVRSVLFNPDGCCLYSGCQD-SLRVYGWEPER 263

Query: 596 C 598
           C
Sbjct: 264 C 264



>gb:AK031630_1162530 Mus musculus 13 days embryo male testis cDNA,
           RIKEN full-length enriched library, clone:6030463O17
           product:katanin p80 (WD40-containing) subunit B 1, full
           insert sequence.
          Length = 658

 Score =  195 bits (496), Expect = 5e-49
 Identities = 85/157 (54%), Positives = 118/157 (75%)
 Frame = +2

Query: 197 MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP 376
           + K  +KLQE VAH+ NV+ L  GK + R+  TGGDD  VNLWSI KP    +L+GHTSP
Sbjct: 6   VTKTAWKLQEIVAHASNVSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIMSLTGHTSP 65

Query: 377 VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM 556
           VES+  ++ E L+ AGS SG I++WDLE  K++RTL GH++   +L+FHP+GEF ASGS 
Sbjct: 66  VESVRLNTPEELIVAGSQSGSIRVWDLEAAKILRTLMGHKANICSLDFHPYGEFVASGSQ 125

Query: 557 DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           DTN+K+WDIR+KGC+  Y+GH++ +  +RF+PDG+W+
Sbjct: 126 DTNIKLWDIRRKGCVFRYRGHSQAVRCLRFSPDGKWL 162



 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 41/147 (27%), Positives = 64/147 (43%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           L+  + H  N+  L F         +G  D ++ LW I +        GH+  V  + F 
Sbjct: 98  LRTLMGHKANICSLDFHPYG-EFVASGSQDTNIKLWDIRRKGCVFRYRGHSQAVRCLRFS 156

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                +A+ +    +KLWDL   KM+    GH      +EFHP     ASGS D  ++ W
Sbjct: 157 PDGKWLASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVVEFHPNEYLLASGSSDRTIRFW 216

Query: 578 DIRKKGCIHTYKGHTRGISTIRFTPDG 658
           D+ K   +   +G    + ++ F PDG
Sbjct: 217 DLEKFQVVSCIEGEPGPVRSVLFNPDG 243



 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 40/121 (33%), Positives = 60/121 (49%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           HS  V CLRF     +   +  DDH+V LW +      S   GHT PV  + F   E L+
Sbjct: 146 HSQAVRCLRFSPDG-KWLASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVVEFHPNEYLL 204

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
           A+GSS   I+ WDLE  +++  + G      ++ F+P G    SG  D +L+++    + 
Sbjct: 205 ASGSSDRTIRFWDLEKFQVVSCIEGEPGPVRSVLFNPDGCCLYSGCQD-SLRVYGWEPER 263

Query: 596 C 598
           C
Sbjct: 264 C 264



>gb:AK010364_1155709 Mus musculus ES cells cDNA, RIKEN full-length
           enriched library, clone:2410003J24 product:katanin p80
           (WD40-containing) subunit B 1, full insert sequence.
          Length = 657

 Score =  195 bits (496), Expect = 5e-49
 Identities = 85/157 (54%), Positives = 118/157 (75%)
 Frame = +2

Query: 197 MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP 376
           + K  +KLQE VAH+ NV+ L  GK + R+  TGGDD  VNLWSI KP    +L+GHTSP
Sbjct: 6   VTKTAWKLQEIVAHASNVSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIMSLTGHTSP 65

Query: 377 VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM 556
           VES+  ++ E L+ AGS SG I++WDLE  K++RTL GH++   +L+FHP+GEF ASGS 
Sbjct: 66  VESVRLNTPEELIVAGSQSGSIRVWDLEAAKILRTLMGHKANICSLDFHPYGEFVASGSQ 125

Query: 557 DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           DTN+K+WDIR+KGC+  Y+GH++ +  +RF+PDG+W+
Sbjct: 126 DTNIKLWDIRRKGCVFRYRGHSQAVRCLRFSPDGKWL 162



 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 41/147 (27%), Positives = 64/147 (43%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           L+  + H  N+  L F         +G  D ++ LW I +        GH+  V  + F 
Sbjct: 98  LRTLMGHKANICSLDFHPYG-EFVASGSQDTNIKLWDIRRKGCVFRYRGHSQAVRCLRFS 156

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                +A+ +    +KLWDL   KM+    GH      +EFHP     ASGS D  ++ W
Sbjct: 157 PDGKWLASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVVEFHPNEYLLASGSSDRTIRFW 216

Query: 578 DIRKKGCIHTYKGHTRGISTIRFTPDG 658
           D+ K   +   +G    + ++ F PDG
Sbjct: 217 DLEKFQVVSCIEGEPGPVRSVLFNPDG 243



 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 40/121 (33%), Positives = 60/121 (49%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           HS  V CLRF     +   +  DDH+V LW +      S   GHT PV  + F   E L+
Sbjct: 146 HSQAVRCLRFSPDG-KWLASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVVEFHPNEYLL 204

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
           A+GSS   I+ WDLE  +++  + G      ++ F+P G    SG  D +L+++    + 
Sbjct: 205 ASGSSDRTIRFWDLEKFQVVSCIEGEPGPVRSVLFNPDGCCLYSGCQD-SLRVYGWEPER 263

Query: 596 C 598
           C
Sbjct: 264 C 264



>gb:BC067983_2554967 Xenopus tropicalis hypothetical protein
           MGC69344, mRNA (cDNA clone MGC:69344 IMAGE:5309113),
           complete cds.
          Length = 655

 Score =  194 bits (494), Expect = 9e-49
 Identities = 82/155 (52%), Positives = 119/155 (76%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           K  +KLQE VAH  +V+ +  GK + R+  TGGDD  VNLWS+ KP    +L+GHT+PVE
Sbjct: 8   KTTWKLQEIVAHGSSVSSVVLGKSSGRLVATGGDDCRVNLWSVNKPNCIMSLTGHTTPVE 67

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
           S+ F++AE L+ AGS SG +++WDLE  K++RTL GH++   +L+FHP+G+F ASGS+DT
Sbjct: 68  SVRFNNAEELIVAGSQSGSLRVWDLEAAKILRTLMGHKANVCSLDFHPYGDFVASGSLDT 127

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           N+K+WD+R+KGC+  YKGHT+ +  +RF+PDG+W+
Sbjct: 128 NIKLWDVRRKGCVFRYKGHTQAVRCLRFSPDGKWL 162



 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 46/147 (31%), Positives = 66/147 (44%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           L+  + H  NV  L F         +G  D ++ LW + +        GHT  V  + F 
Sbjct: 98  LRTLMGHKANVCSLDFHPYG-DFVASGSLDTNIKLWDVRRKGCVFRYKGHTQAVRCLRFS 156

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                +A+ S    +KLWDL   KM+  LS H+     +EFHP     ASGS D  ++ W
Sbjct: 157 PDGKWLASASDDHSVKLWDLTAGKMMAELSEHKGPVNIIEFHPNEYLLASGSADRTVRFW 216

Query: 578 DIRKKGCIHTYKGHTRGISTIRFTPDG 658
           D+ K   I   +G T  +  I F+ DG
Sbjct: 217 DLEKFQLIGCTEGETIPVRAILFSSDG 243



 Score = 63.2 bits (152), Expect = 4e-09
 Identities = 39/127 (30%), Positives = 56/127 (44%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           +  H+  V CLRF     +   +  DDHSV LW +      + LS H  PV  I F   E
Sbjct: 143 YKGHTQAVRCLRFSPDG-KWLASASDDHSVKLWDLTAGKMMAELSEHKGPVNIIEFHPNE 201

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            L+A+GS+   ++ WDLE  ++I    G      A+ F   G     G  D  L+++   
Sbjct: 202 YLLASGSADRTVRFWDLEKFQLIGCTEGETIPVRAILFSSDGGCIFCGGRDA-LRVYGWE 260

Query: 587 KKGCIHT 607
              C  T
Sbjct: 261 PDQCFDT 267



>gb:BC043772_2548233 Xenopus laevis katanin p80 (WD40-containing)
           subunit B 1, mRNA (cDNA clone MGC:52971 IMAGE:4930613),
           complete cds.
          Length = 655

 Score =  194 bits (493), Expect = 1e-48
 Identities = 81/155 (52%), Positives = 119/155 (76%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           K  +KLQE VAH  +V+ +  GK + R+  TGG+D  VNLWS+ KP    +L+GHT+PVE
Sbjct: 8   KTTWKLQEIVAHGSSVSSVALGKSSGRLVATGGEDCRVNLWSVNKPNCIMSLTGHTTPVE 67

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
           S+ F+++E L+ AGS SG +++WDLE  K++RTL GH++   +L+FHP+GEF ASGS+DT
Sbjct: 68  SVRFNNSEELIVAGSQSGSLRIWDLEAAKILRTLMGHKANVCSLDFHPYGEFVASGSLDT 127

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           N+K+WD+R+KGC+  YKGHT+ +  +RF+PDG+W+
Sbjct: 128 NIKLWDVRRKGCVFRYKGHTQAVRCLRFSPDGKWL 162



 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 47/147 (31%), Positives = 66/147 (44%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           L+  + H  NV  L F         +G  D ++ LW + +        GHT  V  + F 
Sbjct: 98  LRTLMGHKANVCSLDFHPYG-EFVASGSLDTNIKLWDVRRKGCVFRYKGHTQAVRCLRFS 156

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                +A+ S    IKLWDL   KM+  LS H+     +EFHP     ASGS D  ++ W
Sbjct: 157 PDGKWLASTSDDHSIKLWDLTAGKMMAELSEHKGPVNIIEFHPNEYLLASGSADRTVRFW 216

Query: 578 DIRKKGCIHTYKGHTRGISTIRFTPDG 658
           D+ K   I   +G T  +  I F+ DG
Sbjct: 217 DLEKFQLIGCTEGETIPVRAILFSNDG 243



 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 35/111 (31%), Positives = 50/111 (45%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           +  H+  V CLRF     +   +  DDHS+ LW +      + LS H  PV  I F   E
Sbjct: 143 YKGHTQAVRCLRFSPDG-KWLASTSDDHSIKLWDLTAGKMMAELSEHKGPVNIIEFHPNE 201

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
            L+A+GS+   ++ WDLE  ++I    G      A+ F   G     G  D
Sbjct: 202 YLLASGSADRTVRFWDLEKFQLIGCTEGETIPVRAILFSNDGGCIFCGGKD 252



 Score = 37.4 bits (85), Expect = 0.24
 Identities = 14/47 (29%), Positives = 23/47 (48%)
 Frame = +2

Query: 530 GEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           G   A+G  D  + +W + K  CI +  GHT  + ++RF      +V
Sbjct: 33  GRLVATGGEDCRVNLWSVNKPNCIMSLTGHTTPVESVRFNNSEELIV 79



>gb:BC077273_2559987 Xenopus laevis cDNA clone IMAGE:4031030,
           partial cds.
          Length = 424

 Score =  191 bits (486), Expect = 8e-48
 Identities = 80/155 (51%), Positives = 120/155 (77%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           K  +KLQE VAH  +V+ +  G+ + R+  TGGDD  V+LWS+ KP    +L+GHT+PVE
Sbjct: 8   KTTWKLQEIVAHGCSVSSVVLGRSSGRLVATGGDDCRVHLWSVNKPNCIMSLTGHTTPVE 67

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
           S+ F+++E L+ AGS SG +++WDLE  K++RTL GH++  ++L+FHP+GEF ASGS+DT
Sbjct: 68  SVRFNNSEELIVAGSQSGSLRIWDLEAAKILRTLMGHKANVSSLDFHPYGEFVASGSLDT 127

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           N+K+WD+R+KGC+  YKGHT+ +  +RF+PDG+W+
Sbjct: 128 NIKLWDVRRKGCVFRYKGHTQAVRCLRFSPDGKWL 162



 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 45/147 (30%), Positives = 67/147 (45%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           L+  + H  NV+ L F         +G  D ++ LW + +        GHT  V  + F 
Sbjct: 98  LRTLMGHKANVSSLDFHPYG-EFVASGSLDTNIKLWDVRRKGCVFRYKGHTQAVRCLRFS 156

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                +A+ S    +KLWDL   KM+  LS H+     +EFHP     ASGS D  ++ W
Sbjct: 157 PDGKWLASASDDHSVKLWDLTAGKMMAELSEHKGPVNIIEFHPNEYLLASGSADRTVRFW 216

Query: 578 DIRKKGCIHTYKGHTRGISTIRFTPDG 658
           D+ K   +   +G T  +  I F+ DG
Sbjct: 217 DLEKFQLVGCTEGETIPVRAILFSNDG 243



 Score = 62.8 bits (151), Expect = 5e-09
 Identities = 38/127 (29%), Positives = 57/127 (44%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           +  H+  V CLRF     +   +  DDHSV LW +      + LS H  PV  I F   E
Sbjct: 143 YKGHTQAVRCLRFSPDG-KWLASASDDHSVKLWDLTAGKMMAELSEHKGPVNIIEFHPNE 201

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            L+A+GS+   ++ WDLE  +++    G      A+ F   G     G  D +L+++   
Sbjct: 202 YLLASGSADRTVRFWDLEKFQLVGCTEGETIPVRAILFSNDGGCIFCGGKD-SLRVYGWE 260

Query: 587 KKGCIHT 607
              C  T
Sbjct: 261 PDQCFDT 267



 Score = 36.6 bits (83), Expect = 0.41
 Identities = 14/47 (29%), Positives = 23/47 (48%)
 Frame = +2

Query: 530 GEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           G   A+G  D  + +W + K  CI +  GHT  + ++RF      +V
Sbjct: 33  GRLVATGGDDCRVHLWSVNKPNCIMSLTGHTTPVESVRFNNSEELIV 79



>gb:AF052432_1879229 Homo sapiens katanin p80 subunit mRNA, complete
           cds.
          Length = 655

 Score =  191 bits (485), Expect = 1e-47
 Identities = 84/157 (53%), Positives = 117/157 (74%)
 Frame = +2

Query: 197 MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP 376
           + K  +KLQE VAH+ NV+ L  GK + R+  TGGDD  VNLWSI KP    +L+GHTSP
Sbjct: 6   VTKTAWKLQEIVAHASNVSSLVLGKASGRLLATGGDDCRVNLWSINKPNCIMSLTGHTSP 65

Query: 377 VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM 556
           VES+  ++ E L+ AGS SG I++WDLE  K++RTL G ++   +L+FHP+GEF ASGS 
Sbjct: 66  VESVRLNTPEELIVAGSQSGSIRVWDLEAAKILRTLMGLKANICSLDFHPYGEFVASGSQ 125

Query: 557 DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           DTN+K+WDIR+KGC+  Y+GH++ +  +RF+PDG+W+
Sbjct: 126 DTNIKLWDIRRKGCVFRYRGHSQAVRCLRFSPDGKWL 162



 Score = 74.7 bits (182), Expect = 1e-12
 Identities = 36/122 (29%), Positives = 56/122 (45%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +G  D ++ LW I +        GH+  V  + F      +A+ +    +KLWDL   KM
Sbjct: 122 SGSQDTNIKLWDIRRKGCVFRYRGHSQAVRCLRFSPDGKWLASAADDHTVKLWDLTAGKM 181

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           +    GH      +EFHP     ASGS D  ++ WD+ K   +   +G    + ++ F P
Sbjct: 182 MSEFPGHTGPVNVVEFHPNEYLLASGSSDGTIRFWDLEKFQVVSRIEGEPGPVRSVLFNP 241

Query: 653 DG 658
           DG
Sbjct: 242 DG 243



 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 41/121 (33%), Positives = 61/121 (50%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           HS  V CLRF     +   +  DDH+V LW +      S   GHT PV  + F   E L+
Sbjct: 146 HSQAVRCLRFSPDG-KWLASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVVEFHPNEYLL 204

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
           A+GSS G I+ WDLE  +++  + G      ++ F+P G    SG  D +L+++    + 
Sbjct: 205 ASGSSDGTIRFWDLEKFQVVSRIEGEPGPVRSVLFNPDGCCLYSGCQD-SLRVYGWEPER 263

Query: 596 C 598
           C
Sbjct: 264 C 264



>gb:BC047819_2549905 Danio rerio zgc:56071, mRNA (cDNA clone
           MGC:56071 IMAGE:5409848), complete cds.
          Length = 694

 Score =  183 bits (465), Expect = 2e-45
 Identities = 79/152 (51%), Positives = 114/152 (75%)
 Frame = +2

Query: 212 YKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIA 391
           +KLQE VAHS NV+ L  GK + R+  TGG+D  VN+W++ KP    +L+GHTS V  I 
Sbjct: 11  WKLQEIVAHSSNVSSLVLGKSSGRLLATGGEDCRVNIWAVSKPNCIMSLTGHTSAVGCIQ 70

Query: 392 FDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLK 571
           F+S+E  V AGS SG ++LWDLE  K++RTL GH++  ++L+FHP GE+ ASGS+D+N+K
Sbjct: 71  FNSSEERVVAGSLSGSLRLWDLEAAKILRTLMGHKASISSLDFHPMGEYLASGSVDSNIK 130

Query: 572 IWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           +WD+R+KGC+  YKGHT+ +  + F+PDG+W+
Sbjct: 131 LWDVRRKGCVFRYKGHTQAVRCLAFSPDGKWL 162



 Score = 85.9 bits (211), Expect = 6e-16
 Identities = 45/147 (30%), Positives = 70/147 (47%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           L+  + H  +++ L F         +G  D ++ LW + +        GHT  V  +AF 
Sbjct: 98  LRTLMGHKASISSLDFHPMG-EYLASGSVDSNIKLWDVRRKGCVFRYKGHTQAVRCLAFS 156

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                +A+ S    +KLWDL   KMI   + H S    ++FHP     ASGS D  +K+W
Sbjct: 157 PDGKWLASASDDSTVKLWDLIAGKMITEFTSHTSAVNVVQFHPNEYLLASGSADRTVKLW 216

Query: 578 DIRKKGCIHTYKGHTRGISTIRFTPDG 658
           D+ K   I + +G T  + ++ F PDG
Sbjct: 217 DLEKFNMIGSSEGETGVVRSVLFNPDG 243



 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 36/112 (32%), Positives = 54/112 (48%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           +  H+  V CL F     +   +  DD +V LW +      +  + HTS V  + F   E
Sbjct: 143 YKGHTQAVRCLAFSPDG-KWLASASDDSTVKLWDLIAGKMITEFTSHTSAVNVVQFHPNE 201

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
            L+A+GS+   +KLWDLE   MI +  G      ++ F+P G    SGS +T
Sbjct: 202 YLLASGSADRTVKLWDLEKFNMIGSSEGETGVVRSVLFNPDGSCLYSGSENT 253



 Score = 36.6 bits (83), Expect = 0.41
 Identities = 16/47 (34%), Positives = 22/47 (46%)
 Frame = +2

Query: 530 GEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           G   A+G  D  + IW + K  CI +  GHT  +  I+F      VV
Sbjct: 33  GRLLATGGEDCRVNIWAVSKPNCIMSLTGHTSAVGCIQFNSSEERVV 79



>gb:AJ720686_2502873 Gallus gallus mRNA for hypothetical protein,
           clone 23h13.
          Length = 657

 Score =  182 bits (463), Expect = 4e-45
 Identities = 81/157 (51%), Positives = 114/157 (72%)
 Frame = +2

Query: 197 MAKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP 376
           + K  +KLQE VAHS NV+ L  GK T R+  TGGDD  VN+WS+ K      L+GHT+P
Sbjct: 6   VTKTAWKLQEIVAHSSNVSSLVLGKSTGRLLATGGDDCQVNVWSV-KAQLRHELTGHTTP 64

Query: 377 VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM 556
           +ES+   + E L+ AGS SG I++WDLE  K++RTL GH++   +L+FHP+G F ASGS+
Sbjct: 65  IESLQISAKEELIVAGSQSGSIRVWDLEAAKILRTLLGHKANICSLDFHPYGSFVASGSL 124

Query: 557 DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           DT++K+WD+R+KGCI  YK HT+ +  +RF+PDG+W+
Sbjct: 125 DTDIKLWDVRRKGCIFKYKSHTQAVRCLRFSPDGKWL 161



 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 39/147 (26%), Positives = 61/147 (41%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           L+  + H  N+  L F         +G  D  + LW + +         HT  V  + F 
Sbjct: 97  LRTLLGHKANICSLDFHPYGS-FVASGSLDTDIKLWDVRRKGCIFKYKSHTQAVRCLRFS 155

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                +A+ +    +KLWDL   K++   +GH      +EFHP     ASGS D  ++ W
Sbjct: 156 PDGKWLASAADDHTVKLWDLTAGKVMFEFTGHSGPVNVVEFHPSEYLLASGSSDRTIRFW 215

Query: 578 DIRKKGCIHTYKGHTRGISTIRFTPDG 658
           D+ K   +   +     +  I F PDG
Sbjct: 216 DLEKFHVVSCIEEEATPVRCILFNPDG 242



 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 35/125 (28%), Positives = 61/125 (48%)
 Frame = +2

Query: 224 EFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSA 403
           ++ +H+  V CLRF     +   +  DDH+V LW +         +GH+ PV  + F  +
Sbjct: 141 KYKSHTQAVRCLRFSPDG-KWLASAADDHTVKLWDLTAGKVMFEFTGHSGPVNVVEFHPS 199

Query: 404 EILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
           E L+A+GSS   I+ WDLE   ++  +    +    + F+P G     G  D +L+++  
Sbjct: 200 EYLLASGSSDRTIRFWDLEKFHVVSCIEEEATPVRCILFNPDGCCLYGGFQD-SLRVYGW 258

Query: 584 RKKGC 598
             + C
Sbjct: 259 EPERC 263



>gb:AY597210_1617101 Chlamydomonas reinhardtii katanin p80 subunit
           PF15p mRNA, complete cds.
          Length = 798

 Score =  174 bits (440), Expect = 2e-42
 Identities = 75/156 (48%), Positives = 116/156 (74%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           + R  KL EF AH+G+V C+R G+KT  + +TGGDD  VN+W++GK T++ +L+GH S V
Sbjct: 3   SSRYAKLVEFAAHAGDVRCVRIGRKTAGVLVTGGDDKKVNVWALGKTTASFSLTGHQSSV 62

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
           ES++FD+ E++VAAG S+G IK+++L+  K+ ++LSGH+S    L +HP+     SGSMD
Sbjct: 63  ESVSFDNDEMVVAAGGSNGSIKVFELQTGKVTKSLSGHKSNVMCLAWHPYDSTIISGSMD 122

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           TN+K+W++R K  + T+KGH  G++ +R++PDG WV
Sbjct: 123 TNVKLWNLRDKEAVMTFKGHNAGVTHVRYSPDGNWV 158



>gb:AY089556_1297212 Drosophila melanogaster LD44201 full insert
           cDNA.
          Length = 819

 Score =  120 bits (302), Expect = 2e-26
 Identities = 54/152 (35%), Positives = 91/152 (59%), Gaps = 1/152 (0%)
 Frame = +2

Query: 215 KLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAF 394
           K+ +  AH   V  L  G+ T R+ +TGG+D +VNLW+IG+     +L+GH   ++ + F
Sbjct: 10  KIYDIKAHDSRVTSLDLGE-TGRVLVTGGEDRNVNLWAIGQNECFMSLTGHNRSIDCVRF 68

Query: 395 DSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI 574
              +  V +    G+I+ WDL   K+  TL+GH      L+F+P GE+  SGS DT +++
Sbjct: 69  AYKDNFVYSADDIGIIRRWDLNSQKIYSTLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRL 128

Query: 575 WDIR-KKGCIHTYKGHTRGISTIRFTPDGRWV 667
           WD++ +  CI   +GH   +++++F+PDG W+
Sbjct: 129 WDVQNENNCIKVCRGHMSHVNSVKFSPDGLWI 160



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 4/127 (3%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTST-STLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           ++G +D +V LW +    +      GH S V S+ F    + +A+    G I +WD+  +
Sbjct: 118 VSGSNDTTVRLWDVQNENNCIKVCRGHMSHVNSVKFSPDGLWIASAGLEGSILIWDIRKS 177

Query: 467 KMIRTLSGHR--SYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCI-HTYKGHTRGIST 637
           K I         +  T ++FHPF    A+G +D  + I+D+  +  +  T   + + I  
Sbjct: 178 KQIMEFIADPPVTAITCVQFHPFEFLLAAGRVDGTVSIYDLEHQQLVSQTTHFYGQAIRC 237

Query: 638 IRFTPDG 658
           I F+ +G
Sbjct: 238 ITFSDNG 244



 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 24/105 (22%), Positives = 42/105 (40%)
 Frame = +2

Query: 356 LSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGE 535
           +  H S V S+       ++  G     + LW +   +   +L+GH      + F     
Sbjct: 14  IKAHDSRVTSLDLGETGRVLVTGGEDRNVNLWAIGQNECFMSLTGHNRSIDCVRFAYKDN 73

Query: 536 FFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           F  S      ++ WD+  +    T  GH + + T+ F P G +VV
Sbjct: 74  FVYSADDIGIIRRWDLNSQKIYSTLNGHMKSVRTLDFNPSGEYVV 118



>gb:AE014298_1125928 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE014298_1125929 Drosophila melanogaster
           chromosome X, complete sequence.>gb:AE003501_1212937
           Drosophila melanogaster chromosome X, section 53 of 74
           of the complete sequence.>gb:AE003501_1212938 Drosophila
           melanogaster chromosome X, section 53 of 74 of the
           complete sequence.
          Length = 819

 Score =  120 bits (302), Expect = 2e-26
 Identities = 54/152 (35%), Positives = 91/152 (59%), Gaps = 1/152 (0%)
 Frame = +2

Query: 215 KLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAF 394
           K+ +  AH   V  L  G+ T R+ +TGG+D +VNLW+IG+     +L+GH   ++ + F
Sbjct: 10  KIYDIKAHDSRVTSLDLGE-TGRVLVTGGEDRNVNLWAIGQNECFMSLTGHNRSIDCVRF 68

Query: 395 DSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI 574
              +  V +    G+I+ WDL   K+  TL+GH      L+F+P GE+  SGS DT +++
Sbjct: 69  AYKDNFVYSADDIGIIRRWDLNSQKIYSTLNGHMKSVRTLDFNPSGEYVVSGSNDTTVRL 128

Query: 575 WDIR-KKGCIHTYKGHTRGISTIRFTPDGRWV 667
           WD++ +  CI   +GH   +++++F+PDG W+
Sbjct: 129 WDVQNENNCIKVCRGHMSHVNSVKFSPDGLWI 160



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 4/127 (3%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTST-STLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           ++G +D +V LW +    +      GH S V S+ F    + +A+    G I +WD+  +
Sbjct: 118 VSGSNDTTVRLWDVQNENNCIKVCRGHMSHVNSVKFSPDGLWIASAGLEGSILIWDIRKS 177

Query: 467 KMIRTLSGHR--SYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCI-HTYKGHTRGIST 637
           K I         +  T ++FHPF    A+G +D  + I+D+  +  +  T   + + I  
Sbjct: 178 KQIMEFIADPPVTAITCVQFHPFEFLLAAGRVDGTVSIYDLEHQQLVSQTTHFYGQAIRC 237

Query: 638 IRFTPDG 658
           I F+ +G
Sbjct: 238 ITFSDNG 244



 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 24/105 (22%), Positives = 42/105 (40%)
 Frame = +2

Query: 356 LSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGE 535
           +  H S V S+       ++  G     + LW +   +   +L+GH      + F     
Sbjct: 14  IKAHDSRVTSLDLGETGRVLVTGGEDRNVNLWAIGQNECFMSLTGHNRSIDCVRFAYKDN 73

Query: 536 FFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           F  S      ++ WD+  +    T  GH + + T+ F P G +VV
Sbjct: 74  FVYSADDIGIIRRWDLNSQKIYSTLNGHMKSVRTLDFNPSGEYVV 118



>gb:AF223065_1252599 Drosophila melanogaster putative microtubule
           severing protein katanin p80 subunit mRNA, complete cds.
          Length = 823

 Score =  120 bits (300), Expect = 3e-26
 Identities = 54/152 (35%), Positives = 91/152 (59%), Gaps = 1/152 (0%)
 Frame = +2

Query: 215 KLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAF 394
           K+ +  AH   V  L  G+ T R+ +TGG+D +VNLW+IG+     +L+GH   ++ + F
Sbjct: 10  KIYDIKAHDSRVTSLDLGE-TGRVLVTGGEDRNVNLWAIGQNECFMSLTGHNRSIDCVRF 68

Query: 395 DSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI 574
              +  V +    G+I+ WDL   K+  TL+GH      L+F+P GE+  SGS DT +++
Sbjct: 69  AYKDNFVYSADDIGIIRRWDLNSQKIYSTLNGHMKSGRTLDFNPSGEYVVSGSNDTTVRL 128

Query: 575 WDIR-KKGCIHTYKGHTRGISTIRFTPDGRWV 667
           WD++ +  CI   +GH   +++++F+PDG W+
Sbjct: 129 WDVQNENNCIKVCRGHMSHVNSVKFSPDGLWI 160



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 33/127 (25%), Positives = 60/127 (47%), Gaps = 4/127 (3%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTST-STLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           ++G +D +V LW +    +      GH S V S+ F    + +A+    G I +WD+  +
Sbjct: 118 VSGSNDTTVRLWDVQNENNCIKVCRGHMSHVNSVKFSPDGLWIASAGLEGSILIWDIRKS 177

Query: 467 KMIRTLSGHR--SYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCI-HTYKGHTRGIST 637
           K I         +  T ++FHPF    A+G +D  + I+D+  +  +  T   + + I  
Sbjct: 178 KQIMEFIADPPVTAITCVQFHPFEFLLAAGRVDGTVSIYDLEHQQLVSQTTHFYGQAIRC 237

Query: 638 IRFTPDG 658
           I F+ +G
Sbjct: 238 ITFSDNG 244



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 24/105 (22%), Positives = 41/105 (39%)
 Frame = +2

Query: 356 LSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGE 535
           +  H S V S+       ++  G     + LW +   +   +L+GH      + F     
Sbjct: 14  IKAHDSRVTSLDLGETGRVLVTGGEDRNVNLWAIGQNECFMSLTGHNRSIDCVRFAYKDN 73

Query: 536 FFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           F  S      ++ WD+  +    T  GH +   T+ F P G +VV
Sbjct: 74  FVYSADDIGIIRRWDLNSQKIYSTLNGHMKSGRTLDFNPSGEYVV 118



>sp|Q8YRI1|YY46_ANASP Hypothetical WD-repeat protein
            alr3466.>pir|AC2239|AC2239 WD-40 repeat protein
            [imported] - Nostoc sp. (strain PCC
            7120)>gb:BA000019_684455 Nostoc sp. PCC 7120 DNA,
            complete genome.
          Length = 1526

 Score =  112 bits (279), Expect = 8e-24
 Identities = 50/141 (35%), Positives = 81/141 (57%)
 Frame = +2

Query: 236  HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
            H+  VN + F      +  +G  D +V LW I       T  GHTS V S+ F+    ++
Sbjct: 1199 HTSWVNSVVFNPDGSTL-ASGSSDQTVRLWEINSSKCLCTFQGHTSWVNSVVFNPDGSML 1257

Query: 416  AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
            A+GSS   ++LWD+  +K + T  GH ++  ++ F+P G   ASGS D  +++W+I    
Sbjct: 1258 ASGSSDKTVRLWDISSSKCLHTFQGHTNWVNSVAFNPDGSMLASGSGDQTVRLWEISSSK 1317

Query: 596  CIHTYKGHTRGISTIRFTPDG 658
            C+HT++GHT  +S++ F+PDG
Sbjct: 1318 CLHTFQGHTSWVSSVTFSPDG 1338



 Score =  110 bits (275), Expect = 2e-23
 Identities = 53/149 (35%), Positives = 82/149 (55%)
 Frame = +2

Query: 212  YKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIA 391
            Y LQ    H+  VN + F      +  +G  D +V LW I        L GHTS V S+ 
Sbjct: 1152 YTLQ---GHTNWVNAVAFSPDGATL-ASGSGDQTVRLWDISSSKCLYILQGHTSWVNSVV 1207

Query: 392  FDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLK 571
            F+     +A+GSS   ++LW++  +K + T  GH S+  ++ F+P G   ASGS D  ++
Sbjct: 1208 FNPDGSTLASGSSDQTVRLWEINSSKCLCTFQGHTSWVNSVVFNPDGSMLASGSSDKTVR 1267

Query: 572  IWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
            +WDI    C+HT++GHT  ++++ F PDG
Sbjct: 1268 LWDISSSKCLHTFQGHTNWVNSVAFNPDG 1296



 Score =  107 bits (267), Expect = 2e-22
 Identities = 52/148 (35%), Positives = 79/148 (53%), Gaps = 2/148 (1%)
 Frame = +2

Query: 221  QEFVAHSGNVNCLR--FGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAF 394
            Q F    G+ +C+R         M  +G DD +V LW I       TL GHTS V S+ F
Sbjct: 1023 QCFYIFQGHTSCVRSVVFSSDGAMLASGSDDQTVRLWDISSGNCLYTLQGHTSCVRSVVF 1082

Query: 395  DSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI 574
                 ++A+G    +++LWD+     + TL G+ S+   L F P G   A+GS D  +++
Sbjct: 1083 SPDGAMLASGGDDQIVRLWDISSGNCLYTLQGYTSWVRFLVFSPNGVTLANGSSDQIVRL 1142

Query: 575  WDIRKKGCIHTYKGHTRGISTIRFTPDG 658
            WDI  K C++T +GHT  ++ + F+PDG
Sbjct: 1143 WDISSKKCLYTLQGHTNWVNAVAFSPDG 1170



 Score =  105 bits (262), Expect = 7e-22
 Identities = 49/144 (34%), Positives = 79/144 (54%)
 Frame = +2

Query: 227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
            F  H+  VN + F      M  +G  D +V LW I       T  GHT+ V S+AF+   
Sbjct: 1238 FQGHTSWVNSVVFNPDGS-MLASGSSDKTVRLWDISSSKCLHTFQGHTNWVNSVAFNPDG 1296

Query: 407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
             ++A+GS    ++LW++  +K + T  GH S+ +++ F P G   ASGS D  +++W I 
Sbjct: 1297 SMLASGSGDQTVRLWEISSSKCLHTFQGHTSWVSSVTFSPDGTMLASGSDDQTVRLWSIS 1356

Query: 587  KKGCIHTYKGHTRGISTIRFTPDG 658
               C++T+ GHT  + ++ F+PDG
Sbjct: 1357 SGECLYTFLGHTNWVGSVIFSPDG 1380



 Score =  105 bits (262), Expect = 7e-22
 Identities = 48/125 (38%), Positives = 71/125 (56%)
 Frame = +2

Query: 284  MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
            M  +GGDD  V LW I       TL G+TS V  + F    + +A GSS  +++LWD+  
Sbjct: 1088 MLASGGDDQIVRLWDISSGNCLYTLQGYTSWVRFLVFSPNGVTLANGSSDQIVRLWDISS 1147

Query: 464  TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
             K + TL GH ++  A+ F P G   ASGS D  +++WDI    C++  +GHT  ++++ 
Sbjct: 1148 KKCLYTLQGHTNWVNAVAFSPDGATLASGSGDQTVRLWDISSSKCLYILQGHTSWVNSVV 1207

Query: 644  FTPDG 658
            F PDG
Sbjct: 1208 FNPDG 1212



 Score =  100 bits (250), Expect = 2e-20
 Identities = 44/121 (36%), Positives = 69/121 (57%)
 Frame = +2

Query: 296  GGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMI 475
            G  D  V LW I       TL GHT+ V ++AF      +A+GS    ++LWD+  +K +
Sbjct: 1134 GSSDQIVRLWDISSKKCLYTLQGHTNWVNAVAFSPDGATLASGSGDQTVRLWDISSSKCL 1193

Query: 476  RTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
              L GH S+  ++ F+P G   ASGS D  +++W+I    C+ T++GHT  ++++ F PD
Sbjct: 1194 YILQGHTSWVNSVVFNPDGSTLASGSSDQTVRLWEINSSKCLCTFQGHTSWVNSVVFNPD 1253

Query: 656  G 658
            G
Sbjct: 1254 G 1254



 Score =  100 bits (249), Expect = 2e-20
 Identities = 48/153 (31%), Positives = 80/153 (52%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G +L     H+  VN + F +   +M  +G DD +V LW I       T  GHTS V
Sbjct: 893  AATGKELLTCKGHNSWVNSVGFSQDG-KMLASGSDDQTVRLWDISSGQCLKTFKGHTSRV 951

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+ F    +++A+GSS   ++LWD+   + +    GH  +  ++ F+  G   A+GS D
Sbjct: 952  RSVVFSPNSLMLASGSSDQTVRLWDISSGECLYIFQGHTGWVYSVAFNLDGSMLATGSGD 1011

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
              +++WDI    C + ++GHT  + ++ F+ DG
Sbjct: 1012 QTVRLWDISSSQCFYIFQGHTSCVRSVVFSSDG 1044



 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 48/147 (32%), Positives = 76/147 (51%)
 Frame = +2

Query: 218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
            L  F  H+  V+ + F      M  +G DD +V LWSI       T  GHT+ V S+ F 
Sbjct: 1319 LHTFQGHTSWVSSVTFSPDGT-MLASGSDDQTVRLWSISSGECLYTFLGHTNWVGSVIFS 1377

Query: 398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                ++A+GS    ++LW +   K + TL GH ++  ++ F P G   ASGS D  +++W
Sbjct: 1378 PDGAILASGSGDQTVRLWSISSGKCLYTLQGHNNWVGSIVFSPDGTLLASGSDDQTVRLW 1437

Query: 578  DIRKKGCIHTYKGHTRGISTIRFTPDG 658
            +I    C++T  GH   + ++ F+ DG
Sbjct: 1438 NISSGECLYTLHGHINSVRSVAFSSDG 1464



 Score = 97.1 bits (240), Expect = 3e-19
 Identities = 48/147 (32%), Positives = 74/147 (50%)
 Frame = +2

Query: 218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
            L  F  H+  VN + F      M  +G  D +V LW I       T  GHTS V S+ F 
Sbjct: 1277 LHTFQGHTNWVNSVAFNPDGS-MLASGSGDQTVRLWEISSSKCLHTFQGHTSWVSSVTFS 1335

Query: 398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                ++A+GS    ++LW +   + + T  GH ++  ++ F P G   ASGS D  +++W
Sbjct: 1336 PDGTMLASGSDDQTVRLWSISSGECLYTFLGHTNWVGSVIFSPDGAILASGSGDQTVRLW 1395

Query: 578  DIRKKGCIHTYKGHTRGISTIRFTPDG 658
             I    C++T +GH   + +I F+PDG
Sbjct: 1396 SISSGKCLYTLQGHNNWVGSIVFSPDG 1422



 Score = 95.9 bits (237), Expect = 6e-19
 Identities = 51/150 (34%), Positives = 75/150 (50%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  L  F  H+G V  + F      M  TG  D +V LW I          GHTS V S+
Sbjct: 980  GECLYIFQGHTGWVYSVAFNLDGS-MLATGSGDQTVRLWDISSSQCFYIFQGHTSCVRSV 1038

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
             F S   ++A+GS    ++LWD+     + TL GH S   ++ F P G   ASG  D  +
Sbjct: 1039 VFSSDGAMLASGSDDQTVRLWDISSGNCLYTLQGHTSCVRSVVFSPDGAMLASGGDDQIV 1098

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
            ++WDI    C++T +G+T  +  + F+P+G
Sbjct: 1099 RLWDISSGNCLYTLQGYTSWVRFLVFSPNG 1128



 Score = 95.9 bits (237), Expect = 6e-19
 Identities = 48/150 (32%), Positives = 75/150 (50%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  L+ F  H+  V  + F   +  M  +G  D +V LW I          GHT  V S+
Sbjct: 938  GQCLKTFKGHTSRVRSVVFSPNSL-MLASGSSDQTVRLWDISSGECLYIFQGHTGWVYSV 996

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            AF+    ++A GS    ++LWD+  ++      GH S   ++ F   G   ASGS D  +
Sbjct: 997  AFNLDGSMLATGSGDQTVRLWDISSSQCFYIFQGHTSCVRSVVFSSDGAMLASGSDDQTV 1056

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
            ++WDI    C++T +GHT  + ++ F+PDG
Sbjct: 1057 RLWDISSGNCLYTLQGHTSCVRSVVFSPDG 1086



 Score = 85.9 bits (211), Expect = 6e-16
 Identities = 39/126 (30%), Positives = 63/126 (50%)
 Frame = +2

Query: 281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
            ++F TG     V  W         T  GH S V S+ F     ++A+GS    ++LWD+ 
Sbjct: 877  KLFATGDSGGIVRFWEAATGKELLTCKGHNSWVNSVGFSQDGKMLASGSDDQTVRLWDIS 936

Query: 461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
              + ++T  GH S   ++ F P     ASGS D  +++WDI    C++ ++GHT  + ++
Sbjct: 937  SGQCLKTFKGHTSRVRSVVFSPNSLMLASGSSDQTVRLWDISSGECLYIFQGHTGWVYSV 996

Query: 641  RFTPDG 658
             F  DG
Sbjct: 997  AFNLDG 1002



 Score = 79.7 bits (195), Expect = 4e-14
 Identities = 45/135 (33%), Positives = 67/135 (49%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  L  F+ H+  V  + F      +  +G  D +V LWSI       TL GH + V SI
Sbjct: 1358 GECLYTFLGHTNWVGSVIFSPDGA-ILASGSGDQTVRLWSISSGKCLYTLQGHNNWVGSI 1416

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
             F     L+A+GS    ++LW++   + + TL GH +   ++ F   G   ASGS D  +
Sbjct: 1417 VFSPDGTLLASGSDDQTVRLWNISSGECLYTLHGHINSVRSVAFSSDGLILASGSDDETI 1476

Query: 569  KIWDIRKKGCIHTYK 613
            K+WD++   CI T K
Sbjct: 1477 KLWDVKTGECIKTLK 1491



 Score = 72.8 bits (177), Expect = 5e-12
 Identities = 32/93 (34%), Positives = 53/93 (56%)
 Frame = +2

Query: 377  VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM 556
            V ++AF     L A G S G+++ W+    K + T  GH S+  ++ F   G+  ASGS 
Sbjct: 867  VLTVAFSPDGKLFATGDSGGIVRFWEAATGKELLTCKGHNSWVNSVGFSQDGKMLASGSD 926

Query: 557  DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
            D  +++WDI    C+ T+KGHT  + ++ F+P+
Sbjct: 927  DQTVRLWDISSGQCLKTFKGHTSRVRSVVFSPN 959



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 28/73 (38%), Positives = 43/73 (58%)
 Frame = +2

Query: 284  MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
            +  +G DD +V LW+I       TL GH + V S+AF S  +++A+GS    IKLWD++ 
Sbjct: 1424 LLASGSDDQTVRLWNISSGECLYTLHGHINSVRSVAFSSDGLILASGSDDETIKLWDVKT 1483

Query: 464  TKMIRTLSGHRSY 502
             + I+TL   + Y
Sbjct: 1484 GECIKTLKSEKIY 1496



 Score = 33.5 bits (75), Expect = 3.4
 Identities = 14/48 (29%), Positives = 26/48 (54%)
 Frame = +2

Query: 518  FHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
            F P G+ FA+G     ++ W+      + T KGH   ++++ F+ DG+
Sbjct: 872  FSPDGKLFATGDSGGIVRFWEAATGKELLTCKGHNSWVNSVGFSQDGK 919



>gb:AF323585_1786295 Podospora anserina beta transducin-like protein
            HET-D2Y (het-d) gene, het-d2Y allele, complete cds.
          Length = 1376

 Score =  108 bits (270), Expect = 8e-23
 Identities = 51/156 (32%), Positives = 79/156 (50%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H G VN + F   + +   +G DDH++ +W     + T TL GH  PV
Sbjct: 986  AATGSCTQTLEGHGGPVNSVAFSPDS-KWVASGSDDHTIKIWEAATGSCTQTLEGHGGPV 1044

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+ F      VA+GS    IK+W+       +TL GH  +  ++ F P  ++  SGS D
Sbjct: 1045 NSVTFSPDSKWVASGSDDHTIKIWEAATGSCTQTLEGHGGWVYSVAFSPDSKWVVSGSAD 1104

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            + +KIW+     C  T +GH   ++++ F+PD +WV
Sbjct: 1105 STIKIWEAATGSCTQTLEGHGGSVNSVAFSPDSKWV 1140



 Score =  100 bits (250), Expect = 2e-20
 Identities = 51/156 (32%), Positives = 76/156 (48%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H G VN + F   + +   +G DDH++ +W     + T TL GH   V
Sbjct: 1028 AATGSCTQTLEGHGGPVNSVTFSPDS-KWVASGSDDHTIKIWEAATGSCTQTLEGHGGWV 1086

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+AF      V +GS+   IK+W+       +TL GH     ++ F P  ++ ASGS D
Sbjct: 1087 YSVAFSPDSKWVVSGSADSTIKIWEAATGSCTQTLEGHGGSVNSVAFSPDSKWVASGSTD 1146

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
              +KIW+     C  T +GH     ++ F+PD +WV
Sbjct: 1147 RTIKIWEAATGSCTQTLEGHGGWAWSVAFSPDSKWV 1182



 Score =  100 bits (249), Expect = 2e-20
 Identities = 50/156 (32%), Positives = 77/156 (49%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H G+VN + F   + +   +G  D ++ +W     + T TL GH    
Sbjct: 1112 AATGSCTQTLEGHGGSVNSVAFSPDS-KWVASGSTDRTIKIWEAATGSCTQTLEGHGGWA 1170

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+AF      VA+GS+   IK+W+       +TL GH     ++ F P  ++ ASGS D
Sbjct: 1171 WSVAFSPDSKWVASGSADSTIKIWEAATGSCTQTLEGHGGPVNSVAFSPDSKWVASGSDD 1230

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
              +KIW+     C  T +GH R + ++ F+PD +WV
Sbjct: 1231 HTIKIWEAATGSCTQTLEGHGRSVKSVAFSPDSKWV 1266



 Score =  100 bits (249), Expect = 2e-20
 Identities = 49/149 (32%), Positives = 78/149 (52%)
 Frame = +2

Query: 221  QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
            Q    HSG+VN + F   + +   +G DD ++ +W     + T TL GH   V S+AF  
Sbjct: 825  QTLEGHSGSVNSVTFSPDS-KWVASGLDDSTIKIWEAATGSCTQTLEGHGGWVLSVAFSP 883

Query: 401  AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
                VA+GS+   IK+W+       +TL GH  +  ++ F P  ++  SGS D+ +KIW+
Sbjct: 884  DSKWVASGSADSTIKIWEAATGSCTQTLEGHGGWVYSVAFSPDSKWVVSGSADSTIKIWE 943

Query: 581  IRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
                 C  T +GH   + ++ F+PD +WV
Sbjct: 944  AATGSCTQTLEGHGGWVWSVAFSPDSKWV 972



 Score = 99.0 bits (245), Expect = 7e-20
 Identities = 49/156 (31%), Positives = 79/156 (50%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H G V  + F   + +  ++G  D ++ +W     + T TL GH   V
Sbjct: 1070 AATGSCTQTLEGHGGWVYSVAFSPDS-KWVVSGSADSTIKIWEAATGSCTQTLEGHGGSV 1128

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+AF      VA+GS+   IK+W+       +TL GH  +  ++ F P  ++ ASGS D
Sbjct: 1129 NSVAFSPDSKWVASGSTDRTIKIWEAATGSCTQTLEGHGGWAWSVAFSPDSKWVASGSAD 1188

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            + +KIW+     C  T +GH   ++++ F+PD +WV
Sbjct: 1189 STIKIWEAATGSCTQTLEGHGGPVNSVAFSPDSKWV 1224



 Score = 97.1 bits (240), Expect = 3e-19
 Identities = 51/157 (32%), Positives = 76/157 (48%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H G V  + F   + +   +G  D ++ +W     + T TL GH  PV
Sbjct: 944  AATGSCTQTLEGHGGWVWSVAFSPDS-KWVASGSADSTIKIWEAATGSCTQTLEGHGGPV 1002

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+AF      VA+GS    IK+W+       +TL GH     ++ F P  ++ ASGS D
Sbjct: 1003 NSVAFSPDSKWVASGSDDHTIKIWEAATGSCTQTLEGHGGPVNSVTFSPDSKWVASGSDD 1062

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
              +KIW+     C  T +GH   + ++ F+PD +WVV
Sbjct: 1063 HTIKIWEAATGSCTQTLEGHGGWVYSVAFSPDSKWVV 1099



 Score = 94.7 bits (234), Expect = 1e-18
 Identities = 48/156 (30%), Positives = 77/156 (49%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H G V  + F   + +   +G  D ++ +W     + T TL GH   V
Sbjct: 860  AATGSCTQTLEGHGGWVLSVAFSPDS-KWVASGSADSTIKIWEAATGSCTQTLEGHGGWV 918

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+AF      V +GS+   IK+W+       +TL GH  +  ++ F P  ++ ASGS D
Sbjct: 919  YSVAFSPDSKWVVSGSADSTIKIWEAATGSCTQTLEGHGGWVWSVAFSPDSKWVASGSAD 978

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            + +KIW+     C  T +GH   ++++ F+PD +WV
Sbjct: 979  STIKIWEAATGSCTQTLEGHGGPVNSVAFSPDSKWV 1014



 Score = 94.0 bits (232), Expect = 2e-18
 Identities = 49/156 (31%), Positives = 77/156 (49%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H G V  + F   + +  ++G  D ++ +W     + T TL GH   V
Sbjct: 902  AATGSCTQTLEGHGGWVYSVAFSPDS-KWVVSGSADSTIKIWEAATGSCTQTLEGHGGWV 960

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+AF      VA+GS+   IK+W+       +TL GH     ++ F P  ++ ASGS D
Sbjct: 961  WSVAFSPDSKWVASGSADSTIKIWEAATGSCTQTLEGHGGPVNSVAFSPDSKWVASGSDD 1020

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
              +KIW+     C  T +GH   ++++ F+PD +WV
Sbjct: 1021 HTIKIWEAATGSCTQTLEGHGGPVNSVTFSPDSKWV 1056



 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 45/156 (28%), Positives = 71/156 (45%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H G    + F   + +   +G  D ++ +W     + T TL GH  PV
Sbjct: 1154 AATGSCTQTLEGHGGWAWSVAFSPDS-KWVASGSADSTIKIWEAATGSCTQTLEGHGGPV 1212

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+AF      VA+GS    IK+W+       +TL GH     ++ F P  ++ ASGS D
Sbjct: 1213 NSVAFSPDSKWVASGSDDHTIKIWEAATGSCTQTLEGHGRSVKSVAFSPDSKWVASGSTD 1272

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
              +KIW+     C  T +GH   + ++  + D + +
Sbjct: 1273 RTIKIWEAATGSCTQTLEGHGGSVKSVASSLDSKLI 1308



 Score = 82.8 bits (203), Expect = 5e-15
 Identities = 37/106 (34%), Positives = 57/106 (53%)
 Frame = +2

Query: 353  TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
            TL GH+  V S+ F      VA+G     IK+W+       +TL GH  +  ++ F P  
Sbjct: 826  TLEGHSGSVNSVTFSPDSKWVASGLDDSTIKIWEAATGSCTQTLEGHGGWVLSVAFSPDS 885

Query: 533  EFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            ++ ASGS D+ +KIW+     C  T +GH   + ++ F+PD +WVV
Sbjct: 886  KWVASGSADSTIKIWEAATGSCTQTLEGHGGWVYSVAFSPDSKWVV 931



 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 40/122 (32%), Positives = 58/122 (47%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H G VN + F   + +   +G DDH++ +W     + T TL GH   V
Sbjct: 1196 AATGSCTQTLEGHGGPVNSVAFSPDS-KWVASGSDDHTIKIWEAATGSCTQTLEGHGRSV 1254

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
            +S+AF      VA+GS+   IK+W+       +TL GH     ++      +  ASGS D
Sbjct: 1255 KSVAFSPDSKWVASGSTDRTIKIWEAATGSCTQTLEGHGGSVKSVASSLDSKLIASGSND 1314

Query: 560  TN 565
            TN
Sbjct: 1315 TN 1316



>gb:BA000045_742963 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1081

 Score =  105 bits (263), Expect = 5e-22
 Identities = 54/152 (35%), Positives = 81/152 (53%)
 Frame = +2

Query: 203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
            + G  L+    H+G V  L F     R   +G  D +V LW +    S  T  G++  + 
Sbjct: 704  RSGRCLRVLPGHTGQVWSLAFHPNG-RTLASGSMDQTVRLWEVDSGRSLKTFQGNSGWIW 762

Query: 383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
            S+AF     L+A+GS   L++LWD    + ++TL+GH  +  +L FHP GE  ASGS D 
Sbjct: 763  SVAFHPGGHLLASGSMDRLVRLWDTRTGQCLKTLAGHGCWVWSLAFHPGGEILASGSFDQ 822

Query: 563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
             +K+W++    CI +  GHT  I  + F+PDG
Sbjct: 823  TVKLWEVDTGRCIQSLAGHTNWIRAVAFSPDG 854



 Score = 90.5 bits (223), Expect = 2e-17
 Identities = 46/150 (30%), Positives = 74/150 (49%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  L     H+  V  + F      +  +GG D +V LW +        L GHT  V S+
Sbjct: 664  GACLMVLEGHTSRVRTVAFSPGG-HLLASGGHDQTVRLWEVRSGRCLRVLPGHTGQVWSL 722

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            AF      +A+GS    ++LW+++  + ++T  G+  +  ++ FHP G   ASGSMD  +
Sbjct: 723  AFHPNGRTLASGSMDQTVRLWEVDSGRSLKTFQGNSGWIWSVAFHPGGHLLASGSMDRLV 782

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
            ++WD R   C+ T  GH   + ++ F P G
Sbjct: 783  RLWDTRTGQCLKTLAGHGCWVWSLAFHPGG 812



 Score = 89.0 bits (219), Expect = 7e-17
 Identities = 44/141 (31%), Positives = 72/141 (51%)
 Frame = +2

Query: 236  HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
            H+  V  + F     R   + G D +V LW +        L GHTS V ++AF     L+
Sbjct: 631  HTAQVRSVAFSPDG-RTLASAGVDGTVRLWDVPLGACLMVLEGHTSRVRTVAFSPGGHLL 689

Query: 416  AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
            A+G     ++LW++   + +R L GH     +L FHP G   ASGSMD  +++W++    
Sbjct: 690  ASGGHDQTVRLWEVRSGRCLRVLPGHTGQVWSLAFHPNGRTLASGSMDQTVRLWEVDSGR 749

Query: 596  CIHTYKGHTRGISTIRFTPDG 658
             + T++G++  I ++ F P G
Sbjct: 750  SLKTFQGNSGWIWSVAFHPGG 770



 Score = 88.6 bits (218), Expect = 9e-17
 Identities = 39/123 (31%), Positives = 62/123 (50%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           T G  H++ LW +       +L GHT+ V S+AF      +A+    G ++LWD+     
Sbjct: 607 TAGHGHAIKLWQVSSGACALSLEGHTAQVRSVAFSPDGRTLASAGVDGTVRLWDVPLGAC 666

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           +  L GH S    + F P G   ASG  D  +++W++R   C+    GHT  + ++ F P
Sbjct: 667 LMVLEGHTSRVRTVAFSPGGHLLASGGHDQTVRLWEVRSGRCLRVLPGHTGQVWSLAFHP 726

Query: 653 DGR 661
           +GR
Sbjct: 727 NGR 729



 Score = 86.7 bits (213), Expect = 3e-16
 Identities = 45/150 (30%), Positives = 73/150 (48%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  +Q    H+  +  + F     ++  + G D ++ LW+      T+ L+GHT  V  +
Sbjct: 832  GRCIQSLAGHTNWIRAVAFSPDGAQI-ASAGVDQTIRLWAWPAGNCTAVLTGHTGWVRCV 890

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            AF      +A+GS    IK+WD    + + TL GHR    A+ F P G   AS + D  +
Sbjct: 891  AFGPDGRQLASGSLDRTIKIWDAATGECVATLGGHRGQICAVAFSPDGSLLASAAEDHLV 950

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
            K+W++    C+ T  GH   + ++ F PDG
Sbjct: 951  KLWNLATGECVATLAGHCGPVWSVAFAPDG 980



 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 39/122 (31%), Positives = 59/122 (48%)
 Frame = +2

Query: 293  TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
            +G  D +V LW +       +L+GHT+ + ++AF      +A+      I+LW       
Sbjct: 817  SGSFDQTVKLWEVDTGRCIQSLAGHTNWIRAVAFSPDGAQIASAGVDQTIRLWAWPAGNC 876

Query: 473  IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
               L+GH  +   + F P G   ASGS+D  +KIWD     C+ T  GH   I  + F+P
Sbjct: 877  TAVLTGHTGWVRCVAFGPDGRQLASGSLDRTIKIWDAATGECVATLGGHRGQICAVAFSP 936

Query: 653  DG 658
            DG
Sbjct: 937  DG 938



 Score = 78.6 bits (192), Expect = 9e-14
 Identities = 38/126 (30%), Positives = 66/126 (52%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           +  +G +D SV LW+ G     +TL+GHT  V ++AF      +A+GS  G ++LWD+  
Sbjct: 520 LLASGSEDLSVKLWAAGSGQCLATLTGHTGWVYAVAFAPDGRTLASGSVDGTVRLWDVGT 579

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
              ++ L        ++ F P G+  A+      +K+W +    C  + +GHT  + ++ 
Sbjct: 580 GLCLKILCEPGGQFWSVAFAPDGQTLATAGHGHAIKLWQVSSGACALSLEGHTAQVRSVA 639

Query: 644 FTPDGR 661
           F+PDGR
Sbjct: 640 FSPDGR 645



 Score = 76.3 bits (186), Expect = 5e-13
 Identities = 40/141 (28%), Positives = 68/141 (48%)
 Frame = +2

Query: 236  HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
            H+G V C+ FG    R   +G  D ++ +W        +TL GH   + ++AF     L+
Sbjct: 883  HTGWVRCVAFGPDG-RQLASGSLDRTIKIWDAATGECVATLGGHRGQICAVAFSPDGSLL 941

Query: 416  AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
            A+ +   L+KLW+L   + + TL+GH     ++ F P G   AS   D  ++ WD     
Sbjct: 942  ASAAEDHLVKLWNLATGECVATLAGHCGPVWSVAFAPDGLHLASCGHDQVVRFWDAGSGA 1001

Query: 596  CIHTYKGHTRGISTIRFTPDG 658
               T +GH+  + ++ + P G
Sbjct: 1002 LTATLRGHSDQVWSVAYDPRG 1022



 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 34/122 (27%), Positives = 59/122 (48%)
 Frame = +2

Query: 236  HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
            H G +  + F      +  +  +DH V LW++      +TL+GH  PV S+AF    + +
Sbjct: 925  HRGQICAVAFSPDGS-LLASAAEDHLVKLWNLATGECVATLAGHCGPVWSVAFAPDGLHL 983

Query: 416  AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
            A+     +++ WD     +  TL GH     ++ + P GE  ASGS D  +++W+     
Sbjct: 984  ASCGHDQVVRFWDAGSGALTATLRGHSDQVWSVAYDPRGETLASGSQDKTIRLWNPATGE 1043

Query: 596  CI 601
            C+
Sbjct: 1044 CL 1045



 Score = 66.6 bits (161), Expect = 4e-10
 Identities = 33/92 (35%), Positives = 47/92 (51%)
 Frame = +2

Query: 386 IAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTN 565
           +AF+    ++A G  SG I+L    D +     +GH     A+ FHP G   ASGS D +
Sbjct: 470 VAFNPEGTVLAIGDDSGEIRLLRAADGQQQARCTGHTDALCAMAFHPEGNLLASGSEDLS 529

Query: 566 LKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
           +K+W      C+ T  GHT  +  + F PDGR
Sbjct: 530 VKLWAAGSGQCLATLTGHTGWVYAVAFAPDGR 561



 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 35/122 (28%), Positives = 58/122 (47%)
 Frame = +2

Query: 296 GGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMI 475
           G D   + L         +  +GHT  + ++AF     L+A+GS    +KLW     + +
Sbjct: 482 GDDSGEIRLLRAADGQQQARCTGHTDALCAMAFHPEGNLLASGSEDLSVKLWAAGSGQCL 541

Query: 476 RTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
            TL+GH  +  A+ F P G   ASGS+D  +++WD+    C+           ++ F PD
Sbjct: 542 ATLTGHTGWVYAVAFAPDGRTLASGSVDGTVRLWDVGTGLCLKILCEPGGQFWSVAFAPD 601

Query: 656 GR 661
           G+
Sbjct: 602 GQ 603



 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 23/68 (33%), Positives = 34/68 (50%)
 Frame = +2

Query: 299  GDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIR 478
            G D  V  W  G    T+TL GH+  V S+A+D     +A+GS    I+LW+    + ++
Sbjct: 987  GHDQVVRFWDAGSGALTATLRGHSDQVWSVAYDPRGETLASGSQDKTIRLWNPATGECLK 1046

Query: 479  TLSGHRSY 502
             L   R Y
Sbjct: 1047 ILQAERLY 1054



>gb:AF323583_1786293 Podospora anserina beta transducin-like protein
            HET-E2C*4 (het-e) gene, het-e2C*4 allele, complete cds.
          Length = 1356

 Score =  103 bits (258), Expect = 2e-21
 Identities = 56/156 (35%), Positives = 79/156 (50%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H  +V  + F     R+  +G DDH++ +W     T T TL GH   V
Sbjct: 1080 AASGTCTQTLEGHGDSVWSVAFSPDGQRV-ASGSDDHTIKIWDAASGTCTQTLEGHGDSV 1138

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+AF      VA+GS  G IK+WD       +TL GH  +  ++ F P G+  ASGS+D
Sbjct: 1139 WSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTLEGHGGWVHSVAFSPDGQRVASGSID 1198

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
              +KIWD     C  T +GH   + ++ F+PDG+ V
Sbjct: 1199 GTIKIWDAASGTCTQTLEGHGGWVHSVAFSPDGQRV 1234



 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 53/149 (35%), Positives = 75/149 (50%)
 Frame = +2

Query: 221  QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
            Q    H G V  + F     R+  +G +DH++ +W     T T TL GH   V S+AF  
Sbjct: 1045 QTLEGHGGWVQSVAFSPDGQRV-ASGSNDHTIKIWDAASGTCTQTLEGHGDSVWSVAFSP 1103

Query: 401  AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
                VA+GS    IK+WD       +TL GH     ++ F P G+  ASGS+D  +KIWD
Sbjct: 1104 DGQRVASGSDDHTIKIWDAASGTCTQTLEGHGDSVWSVAFSPDGQRVASGSIDGTIKIWD 1163

Query: 581  IRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
                 C  T +GH   + ++ F+PDG+ V
Sbjct: 1164 AASGTCTQTLEGHGGWVHSVAFSPDGQRV 1192



 Score = 99.4 bits (246), Expect = 5e-20
 Identities = 55/153 (35%), Positives = 76/153 (49%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G   Q    H G+V  + F     R+  +G DD ++ +W     T T TL GH S V S+
Sbjct: 873  GTGTQTLEGHGGSVWSVAFSPDGQRV-ASGSDDKTIKIWDAASGTCTQTLEGHGSSVLSV 931

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            AF      VA+GS    IK+WD       +TL GH     ++ F P G+  ASGS D  +
Sbjct: 932  AFSPDGQRVASGSGDKTIKIWDTASGTGTQTLEGHGGSVWSVAFSPDGQRVASGSGDKTI 991

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            KIWD     C  T +GH   + ++ F+PDG+ V
Sbjct: 992  KIWDTASGTCTQTLEGHGNSVWSVAFSPDGQRV 1024



 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 53/153 (34%), Positives = 76/153 (49%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G   Q    H G+V  + F     R+  +G  D ++ +W     T T TL GH + V S+
Sbjct: 957  GTGTQTLEGHGGSVWSVAFSPDGQRV-ASGSGDKTIKIWDTASGTCTQTLEGHGNSVWSV 1015

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            AF      VA+GS    IK+WD       +TL GH  +  ++ F P G+  ASGS D  +
Sbjct: 1016 AFSPDGQRVASGSDDKTIKIWDTASGTCTQTLEGHGGWVQSVAFSPDGQRVASGSNDHTI 1075

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            KIWD     C  T +GH   + ++ F+PDG+ V
Sbjct: 1076 KIWDAASGTCTQTLEGHGDSVWSVAFSPDGQRV 1108



 Score = 95.9 bits (237), Expect = 6e-19
 Identities = 52/149 (34%), Positives = 75/149 (50%)
 Frame = +2

Query: 221  QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
            Q    H  +V  + F     R+  +G DD ++ +W     T T TL GH   V+S+AF  
Sbjct: 1003 QTLEGHGNSVWSVAFSPDGQRV-ASGSDDKTIKIWDTASGTCTQTLEGHGGWVQSVAFSP 1061

Query: 401  AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
                VA+GS+   IK+WD       +TL GH     ++ F P G+  ASGS D  +KIWD
Sbjct: 1062 DGQRVASGSNDHTIKIWDAASGTCTQTLEGHGDSVWSVAFSPDGQRVASGSDDHTIKIWD 1121

Query: 581  IRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
                 C  T +GH   + ++ F+PDG+ V
Sbjct: 1122 AASGTCTQTLEGHGDSVWSVAFSPDGQRV 1150



 Score = 94.7 bits (234), Expect = 1e-18
 Identities = 53/156 (33%), Positives = 75/156 (48%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H  +V  + F     R+  +G  D ++ +W     T T TL GH   V
Sbjct: 912  AASGTCTQTLEGHGSSVLSVAFSPDGQRV-ASGSGDKTIKIWDTASGTGTQTLEGHGGSV 970

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+AF      VA+GS    IK+WD       +TL GH +   ++ F P G+  ASGS D
Sbjct: 971  WSVAFSPDGQRVASGSGDKTIKIWDTASGTCTQTLEGHGNSVWSVAFSPDGQRVASGSDD 1030

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
              +KIWD     C  T +GH   + ++ F+PDG+ V
Sbjct: 1031 KTIKIWDTASGTCTQTLEGHGGWVQSVAFSPDGQRV 1066



 Score = 93.2 bits (230), Expect = 4e-18
 Identities = 52/149 (34%), Positives = 73/149 (48%)
 Frame = +2

Query: 221  QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
            Q    H  +V  + F     R+  +G DD ++ +W     T T TL GH   V S+AF  
Sbjct: 835  QTLEGHGSSVLSVAFSPDGQRV-ASGSDDKTIKIWDTASGTGTQTLEGHGGSVWSVAFSP 893

Query: 401  AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
                VA+GS    IK+WD       +TL GH S   ++ F P G+  ASGS D  +KIWD
Sbjct: 894  DGQRVASGSDDKTIKIWDAASGTCTQTLEGHGSSVLSVAFSPDGQRVASGSGDKTIKIWD 953

Query: 581  IRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
                    T +GH   + ++ F+PDG+ V
Sbjct: 954  TASGTGTQTLEGHGGSVWSVAFSPDGQRV 982



 Score = 82.0 bits (201), Expect = 8e-15
 Identities = 43/107 (40%), Positives = 57/107 (53%)
 Frame = +2

Query: 347  TSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHP 526
            T TL GH S V S+AF      VA+GS    IK+WD       +TL GH     ++ F P
Sbjct: 834  TQTLEGHGSSVLSVAFSPDGQRVASGSDDKTIKIWDTASGTGTQTLEGHGGSVWSVAFSP 893

Query: 527  FGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
             G+  ASGS D  +KIWD     C  T +GH   + ++ F+PDG+ V
Sbjct: 894  DGQRVASGSDDKTIKIWDAASGTCTQTLEGHGSSVLSVAFSPDGQRV 940



 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 47/136 (34%), Positives = 63/136 (46%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H  +V  + F     R+  +G  D ++ +W     T T TL GH   V
Sbjct: 1122 AASGTCTQTLEGHGDSVWSVAFSPDGQRV-ASGSIDGTIKIWDAASGTCTQTLEGHGGWV 1180

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+AF      VA+GS  G IK+WD       +TL GH  +  ++ F P G+  ASGS D
Sbjct: 1181 HSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTLEGHGGWVHSVAFSPDGQRVASGSSD 1240

Query: 560  TNLKIWDIRKKGCIHT 607
              +KIWD     C  T
Sbjct: 1241 NTIKIWDTASGTCTQT 1256



 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 34/108 (31%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H G V+ + F     R+  +G  D ++ +W     T T TL GH   V
Sbjct: 1164 AASGTCTQTLEGHGGWVHSVAFSPDGQRV-ASGSIDGTIKIWDAASGTCTQTLEGHGGWV 1222

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLS-GHRSYCTALEF 520
             S+AF      VA+GSS   IK+WD       +TL+ G  + C + ++
Sbjct: 1223 HSVAFSPDGQRVASGSSDNTIKIWDTASGTCTQTLNVGSTATCLSFDY 1270



 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 27/76 (35%), Positives = 40/76 (52%)
 Frame = +2

Query: 440  IKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGH 619
            I + + E     +TL GH S   ++ F P G+  ASGS D  +KIWD        T +GH
Sbjct: 823  ISVVEAEWNACTQTLEGHGSSVLSVAFSPDGQRVASGSDDKTIKIWDTASGTGTQTLEGH 882

Query: 620  TRGISTIRFTPDGRWV 667
               + ++ F+PDG+ V
Sbjct: 883  GGSVWSVAFSPDGQRV 898



>sp|Q00808|HET1_PODAN Vegetatible incompatibility protein
            HET-E-1.>pir|T18521|T18521 beta transducin-like protein -
            Podospora anserina>gb:FLABTLP_1679076 Podospora anserina
            beta transducin-like protein (het-e) gene, het-e-e1
            allele, complete cds.
          Length = 1356

 Score =  103 bits (258), Expect = 2e-21
 Identities = 55/149 (36%), Positives = 77/149 (51%)
 Frame = +2

Query: 221  QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
            Q    H G V  + F     R+  +G DDH++ +W     T T TL GH   V S+AF  
Sbjct: 1045 QTLEGHGGWVQSVVFSPDGQRV-ASGSDDHTIKIWDAVSGTCTQTLEGHGDSVWSVAFSP 1103

Query: 401  AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
                VA+GS  G IK+WD       +TL GH  +  ++ F P G+  ASGS+D  +KIWD
Sbjct: 1104 DGQRVASGSIDGTIKIWDAASGTCTQTLEGHGGWVHSVAFSPDGQRVASGSIDGTIKIWD 1163

Query: 581  IRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
                 C  T +GH   + ++ F+PDG+ V
Sbjct: 1164 AASGTCTQTLEGHGGWVQSVAFSPDGQRV 1192



 Score =  103 bits (258), Expect = 2e-21
 Identities = 57/156 (36%), Positives = 77/156 (49%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H G V  + F     R+  +G DDH++ +W     T T TL GH S V
Sbjct: 912  AASGTCTQTLEGHGGRVQSVAFSPDGQRV-ASGSDDHTIKIWDAASGTCTQTLEGHGSSV 970

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+AF      VA+GS    IK+WD       +TL GH     ++ F P G+  ASGS D
Sbjct: 971  LSVAFSPDGQRVASGSGDKTIKIWDTASGTCTQTLEGHGGSVWSVAFSPDGQRVASGSDD 1030

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
              +KIWD     C  T +GH   + ++ F+PDG+ V
Sbjct: 1031 KTIKIWDTASGTCTQTLEGHGGWVQSVVFSPDGQRV 1066



 Score =  101 bits (251), Expect = 1e-20
 Identities = 55/153 (35%), Positives = 77/153 (50%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G   Q    H G+V  + F     R+  +G DD ++ +W     T T TL GH   V+S+
Sbjct: 873  GTGTQTLEGHGGSVWSVAFSPDRERV-ASGSDDKTIKIWDAASGTCTQTLEGHGGRVQSV 931

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            AF      VA+GS    IK+WD       +TL GH S   ++ F P G+  ASGS D  +
Sbjct: 932  AFSPDGQRVASGSDDHTIKIWDAASGTCTQTLEGHGSSVLSVAFSPDGQRVASGSGDKTI 991

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            KIWD     C  T +GH   + ++ F+PDG+ V
Sbjct: 992  KIWDTASGTCTQTLEGHGGSVWSVAFSPDGQRV 1024



 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 52/149 (34%), Positives = 75/149 (50%)
 Frame = +2

Query: 221  QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
            Q    H G+V  + F     R+  +G DD ++ +W     T T TL GH   V+S+ F  
Sbjct: 1003 QTLEGHGGSVWSVAFSPDGQRV-ASGSDDKTIKIWDTASGTCTQTLEGHGGWVQSVVFSP 1061

Query: 401  AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
                VA+GS    IK+WD       +TL GH     ++ F P G+  ASGS+D  +KIWD
Sbjct: 1062 DGQRVASGSDDHTIKIWDAVSGTCTQTLEGHGDSVWSVAFSPDGQRVASGSIDGTIKIWD 1121

Query: 581  IRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
                 C  T +GH   + ++ F+PDG+ V
Sbjct: 1122 AASGTCTQTLEGHGGWVHSVAFSPDGQRV 1150



 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 52/149 (34%), Positives = 73/149 (48%)
 Frame = +2

Query: 221  QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
            Q    H  +V  + F     R+  +G DD ++ +W     T T TL GH   V S+AF  
Sbjct: 835  QTLEGHGSSVLSVAFSADGQRV-ASGSDDKTIKIWDTASGTGTQTLEGHGGSVWSVAFSP 893

Query: 401  AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
                VA+GS    IK+WD       +TL GH     ++ F P G+  ASGS D  +KIWD
Sbjct: 894  DRERVASGSDDKTIKIWDAASGTCTQTLEGHGGRVQSVAFSPDGQRVASGSDDHTIKIWD 953

Query: 581  IRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
                 C  T +GH   + ++ F+PDG+ V
Sbjct: 954  AASGTCTQTLEGHGSSVLSVAFSPDGQRV 982



 Score = 96.7 bits (239), Expect = 3e-19
 Identities = 54/156 (34%), Positives = 76/156 (48%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H  +V  + F     R+  +G  D ++ +W     T T TL GH   V
Sbjct: 1080 AVSGTCTQTLEGHGDSVWSVAFSPDGQRV-ASGSIDGTIKIWDAASGTCTQTLEGHGGWV 1138

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+AF      VA+GS  G IK+WD       +TL GH  +  ++ F P G+  ASGS D
Sbjct: 1139 HSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTLEGHGGWVQSVAFSPDGQRVASGSSD 1198

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
              +KIWD     C  T +GH   + ++ F+PDG+ V
Sbjct: 1199 KTIKIWDTASGTCTQTLEGHGGWVQSVAFSPDGQRV 1234



 Score = 94.0 bits (232), Expect = 2e-18
 Identities = 53/156 (33%), Positives = 75/156 (48%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H  +V  + F     R+  +G  D ++ +W     T T TL GH   V
Sbjct: 954  AASGTCTQTLEGHGSSVLSVAFSPDGQRV-ASGSGDKTIKIWDTASGTCTQTLEGHGGSV 1012

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+AF      VA+GS    IK+WD       +TL GH  +  ++ F P G+  ASGS D
Sbjct: 1013 WSVAFSPDGQRVASGSDDKTIKIWDTASGTCTQTLEGHGGWVQSVVFSPDGQRVASGSDD 1072

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
              +KIWD     C  T +GH   + ++ F+PDG+ V
Sbjct: 1073 HTIKIWDAVSGTCTQTLEGHGDSVWSVAFSPDGQRV 1108



 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 48/136 (35%), Positives = 65/136 (47%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H G V+ + F     R+  +G  D ++ +W     T T TL GH   V
Sbjct: 1122 AASGTCTQTLEGHGGWVHSVAFSPDGQRV-ASGSIDGTIKIWDAASGTCTQTLEGHGGWV 1180

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
            +S+AF      VA+GSS   IK+WD       +TL GH  +  ++ F P G+  ASGS D
Sbjct: 1181 QSVAFSPDGQRVASGSSDKTIKIWDTASGTCTQTLEGHGGWVQSVAFSPDGQRVASGSSD 1240

Query: 560  TNLKIWDIRKKGCIHT 607
              +KIWD     C  T
Sbjct: 1241 NTIKIWDTASGTCTQT 1256



 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 43/107 (40%), Positives = 57/107 (53%)
 Frame = +2

Query: 347  TSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHP 526
            T TL GH S V S+AF +    VA+GS    IK+WD       +TL GH     ++ F P
Sbjct: 834  TQTLEGHGSSVLSVAFSADGQRVASGSDDKTIKIWDTASGTGTQTLEGHGGSVWSVAFSP 893

Query: 527  FGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
              E  ASGS D  +KIWD     C  T +GH   + ++ F+PDG+ V
Sbjct: 894  DRERVASGSDDKTIKIWDAASGTCTQTLEGHGGRVQSVAFSPDGQRV 940



 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 34/108 (31%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H G V  + F     R+  +G  D ++ +W     T T TL GH   V
Sbjct: 1164 AASGTCTQTLEGHGGWVQSVAFSPDGQRV-ASGSSDKTIKIWDTASGTCTQTLEGHGGWV 1222

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLS-GHRSYCTALEF 520
            +S+AF      VA+GSS   IK+WD       +TL+ G  + C + ++
Sbjct: 1223 QSVAFSPDGQRVASGSSDNTIKIWDTASGTCTQTLNVGSTATCLSFDY 1270



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 24/72 (33%), Positives = 36/72 (50%)
 Frame = +2

Query: 440  IKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGH 619
            I + + E     +TL GH S   ++ F   G+  ASGS D  +KIWD        T +GH
Sbjct: 823  ISVVEAEWNACTQTLEGHGSSVLSVAFSADGQRVASGSDDKTIKIWDTASGTGTQTLEGH 882

Query: 620  TRGISTIRFTPD 655
               + ++ F+PD
Sbjct: 883  GGSVWSVAFSPD 894



>gb:AF323584_1786294 Podospora anserina beta transducin-like protein
            HET-E2C*40 (het-e) gene, het-e2C*40 allele, complete cds.
          Length = 1356

 Score =  103 bits (257), Expect = 3e-21
 Identities = 56/156 (35%), Positives = 78/156 (50%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H   V  + F     R+  +G DDH++ +W     T T TL GH   V
Sbjct: 1080 AASGTCTQTLEGHGDWVQSVAFSPDGQRV-ASGSDDHTIKIWDAASGTCTQTLEGHGDSV 1138

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+AF      VA+GS  G IK+WD       +TL GH  +  ++ F P G+  ASGS+D
Sbjct: 1139 WSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTLEGHGGWVHSVAFSPDGQRVASGSID 1198

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
              +KIWD     C  T +GH   + ++ F+PDG+ V
Sbjct: 1199 GTIKIWDAASGTCTQTLEGHGGWVHSVAFSPDGQRV 1234



 Score =  100 bits (248), Expect = 3e-20
 Identities = 56/156 (35%), Positives = 77/156 (49%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H G+V  + F     R+  +G DD ++ +W     T T TL GH S V
Sbjct: 870  AASGTGTQTLEGHGGSVWSVAFSPDGQRV-ASGSDDKTIKIWDAASGTCTQTLEGHGSSV 928

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+AF      VA+GS    IK+WD       +TL GH     ++ F P G+  ASGS D
Sbjct: 929  LSVAFSPDGQRVASGSGDKTIKIWDTASGTGTQTLEGHGGSVWSVAFSPDGQRVASGSGD 988

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
              +KIWD     C  T +GH   + ++ F+PDG+ V
Sbjct: 989  KTIKIWDTASGTCTQTLEGHGNSVWSVAFSPDGQRV 1024



 Score = 98.6 bits (244), Expect = 9e-20
 Identities = 53/153 (34%), Positives = 77/153 (50%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G   Q    H G+V  + F     R+  +G  D ++ +W     T T TL GH + V S+
Sbjct: 957  GTGTQTLEGHGGSVWSVAFSPDGQRV-ASGSGDKTIKIWDTASGTCTQTLEGHGNSVWSV 1015

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            AF      VA+GS    IK+WD       +TL GH  +  ++ F P G+  ASGS+D  +
Sbjct: 1016 AFSPDGQRVASGSDDKTIKIWDTASGTCTQTLEGHGGWVWSVAFSPDGQRVASGSIDGTI 1075

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            KIWD     C  T +GH   + ++ F+PDG+ V
Sbjct: 1076 KIWDAASGTCTQTLEGHGDWVQSVAFSPDGQRV 1108



 Score = 97.8 bits (242), Expect = 1e-19
 Identities = 53/149 (35%), Positives = 75/149 (50%)
 Frame = +2

Query: 221  QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
            Q    H  +V  + F     R+  +G DD ++ +W     T T TL GH   V S+AF  
Sbjct: 1003 QTLEGHGNSVWSVAFSPDGQRV-ASGSDDKTIKIWDTASGTCTQTLEGHGGWVWSVAFSP 1061

Query: 401  AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
                VA+GS  G IK+WD       +TL GH  +  ++ F P G+  ASGS D  +KIWD
Sbjct: 1062 DGQRVASGSIDGTIKIWDAASGTCTQTLEGHGDWVQSVAFSPDGQRVASGSDDHTIKIWD 1121

Query: 581  IRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
                 C  T +GH   + ++ F+PDG+ V
Sbjct: 1122 AASGTCTQTLEGHGDSVWSVAFSPDGQRV 1150



 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 52/149 (34%), Positives = 74/149 (49%)
 Frame = +2

Query: 221  QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
            Q    H G V  + F     R+  +G  D ++ +W     T T TL GH   V+S+AF  
Sbjct: 1045 QTLEGHGGWVWSVAFSPDGQRV-ASGSIDGTIKIWDAASGTCTQTLEGHGDWVQSVAFSP 1103

Query: 401  AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
                VA+GS    IK+WD       +TL GH     ++ F P G+  ASGS+D  +KIWD
Sbjct: 1104 DGQRVASGSDDHTIKIWDAASGTCTQTLEGHGDSVWSVAFSPDGQRVASGSIDGTIKIWD 1163

Query: 581  IRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
                 C  T +GH   + ++ F+PDG+ V
Sbjct: 1164 AASGTCTQTLEGHGGWVHSVAFSPDGQRV 1192



 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 53/156 (33%), Positives = 75/156 (48%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H  +V  + F     R+  +G  D ++ +W     T T TL GH   V
Sbjct: 912  AASGTCTQTLEGHGSSVLSVAFSPDGQRV-ASGSGDKTIKIWDTASGTGTQTLEGHGGSV 970

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+AF      VA+GS    IK+WD       +TL GH +   ++ F P G+  ASGS D
Sbjct: 971  WSVAFSPDGQRVASGSGDKTIKIWDTASGTCTQTLEGHGNSVWSVAFSPDGQRVASGSDD 1030

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
              +KIWD     C  T +GH   + ++ F+PDG+ V
Sbjct: 1031 KTIKIWDTASGTCTQTLEGHGGWVWSVAFSPDGQRV 1066



 Score = 93.2 bits (230), Expect = 4e-18
 Identities = 52/149 (34%), Positives = 73/149 (48%)
 Frame = +2

Query: 221  QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
            Q    H  +V  + F     R+  +G DD ++ +W     T T TL GH   V S+AF  
Sbjct: 835  QTLEGHGSSVLSVAFSPDGQRV-ASGSDDKTIKIWDAASGTGTQTLEGHGGSVWSVAFSP 893

Query: 401  AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
                VA+GS    IK+WD       +TL GH S   ++ F P G+  ASGS D  +KIWD
Sbjct: 894  DGQRVASGSDDKTIKIWDAASGTCTQTLEGHGSSVLSVAFSPDGQRVASGSGDKTIKIWD 953

Query: 581  IRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
                    T +GH   + ++ F+PDG+ V
Sbjct: 954  TASGTGTQTLEGHGGSVWSVAFSPDGQRV 982



 Score = 82.0 bits (201), Expect = 8e-15
 Identities = 43/107 (40%), Positives = 57/107 (53%)
 Frame = +2

Query: 347  TSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHP 526
            T TL GH S V S+AF      VA+GS    IK+WD       +TL GH     ++ F P
Sbjct: 834  TQTLEGHGSSVLSVAFSPDGQRVASGSDDKTIKIWDAASGTGTQTLEGHGGSVWSVAFSP 893

Query: 527  FGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
             G+  ASGS D  +KIWD     C  T +GH   + ++ F+PDG+ V
Sbjct: 894  DGQRVASGSDDKTIKIWDAASGTCTQTLEGHGSSVLSVAFSPDGQRV 940



 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 47/136 (34%), Positives = 63/136 (46%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H  +V  + F     R+  +G  D ++ +W     T T TL GH   V
Sbjct: 1122 AASGTCTQTLEGHGDSVWSVAFSPDGQRV-ASGSIDGTIKIWDAASGTCTQTLEGHGGWV 1180

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+AF      VA+GS  G IK+WD       +TL GH  +  ++ F P G+  ASGS D
Sbjct: 1181 HSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTLEGHGGWVHSVAFSPDGQRVASGSSD 1240

Query: 560  TNLKIWDIRKKGCIHT 607
              +KIWD     C  T
Sbjct: 1241 NTIKIWDTASGTCTQT 1256



 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 34/108 (31%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H G V+ + F     R+  +G  D ++ +W     T T TL GH   V
Sbjct: 1164 AASGTCTQTLEGHGGWVHSVAFSPDGQRV-ASGSIDGTIKIWDAASGTCTQTLEGHGGWV 1222

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLS-GHRSYCTALEF 520
             S+AF      VA+GSS   IK+WD       +TL+ G  + C + ++
Sbjct: 1223 HSVAFSPDGQRVASGSSDNTIKIWDTASGTCTQTLNVGSTATCLSFDY 1270



 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 27/76 (35%), Positives = 40/76 (52%)
 Frame = +2

Query: 440  IKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGH 619
            I + + E     +TL GH S   ++ F P G+  ASGS D  +KIWD        T +GH
Sbjct: 823  ISVVEAEWNACTQTLEGHGSSVLSVAFSPDGQRVASGSDDKTIKIWDAASGTGTQTLEGH 882

Query: 620  TRGISTIRFTPDGRWV 667
               + ++ F+PDG+ V
Sbjct: 883  GGSVWSVAFSPDGQRV 898



>gb:AF323582_1786292 Podospora anserina beta transducin-like protein
            HET-E2C (het-e) gene, het-e2C allele, complete cds.
          Length = 1356

 Score =  103 bits (257), Expect = 3e-21
 Identities = 56/156 (35%), Positives = 78/156 (50%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H   V  + F     R+  +G DDH++ +W     T T TL GH   V
Sbjct: 1080 AASGTCTQTLEGHGDWVQSVAFSPDGQRV-ASGSDDHTIKIWDAASGTCTQTLEGHGDSV 1138

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+AF      VA+GS  G IK+WD       +TL GH  +  ++ F P G+  ASGS+D
Sbjct: 1139 WSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTLEGHGGWVHSVAFSPDGQRVASGSID 1198

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
              +KIWD     C  T +GH   + ++ F+PDG+ V
Sbjct: 1199 GTIKIWDAASGTCTQTLEGHGGWVHSVAFSPDGQRV 1234



 Score = 99.4 bits (246), Expect = 5e-20
 Identities = 55/153 (35%), Positives = 76/153 (49%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G   Q    H G+V  + F     R+  +G DD ++ +W     T T TL GH S V S+
Sbjct: 873  GTGTQTLEGHGGSVWSVAFSPDGQRV-ASGSDDKTIKIWDAASGTCTQTLEGHGSSVLSV 931

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            AF      VA+GS    IK+WD       +TL GH     ++ F P G+  ASGS D  +
Sbjct: 932  AFSPDGQRVASGSGDKTIKIWDTASGTGTQTLEGHGGSVWSVAFSPDGQRVASGSGDKTI 991

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            KIWD     C  T +GH   + ++ F+PDG+ V
Sbjct: 992  KIWDTASGTCTQTLEGHGNSVWSVAFSPDGQRV 1024



 Score = 98.6 bits (244), Expect = 9e-20
 Identities = 53/153 (34%), Positives = 77/153 (50%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G   Q    H G+V  + F     R+  +G  D ++ +W     T T TL GH + V S+
Sbjct: 957  GTGTQTLEGHGGSVWSVAFSPDGQRV-ASGSGDKTIKIWDTASGTCTQTLEGHGNSVWSV 1015

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            AF      VA+GS    IK+WD       +TL GH  +  ++ F P G+  ASGS+D  +
Sbjct: 1016 AFSPDGQRVASGSDDKTIKIWDTASGTCTQTLEGHGGWVWSVAFSPDGQRVASGSIDGTI 1075

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            KIWD     C  T +GH   + ++ F+PDG+ V
Sbjct: 1076 KIWDAASGTCTQTLEGHGDWVQSVAFSPDGQRV 1108



 Score = 97.8 bits (242), Expect = 1e-19
 Identities = 53/149 (35%), Positives = 75/149 (50%)
 Frame = +2

Query: 221  QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
            Q    H  +V  + F     R+  +G DD ++ +W     T T TL GH   V S+AF  
Sbjct: 1003 QTLEGHGNSVWSVAFSPDGQRV-ASGSDDKTIKIWDTASGTCTQTLEGHGGWVWSVAFSP 1061

Query: 401  AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
                VA+GS  G IK+WD       +TL GH  +  ++ F P G+  ASGS D  +KIWD
Sbjct: 1062 DGQRVASGSIDGTIKIWDAASGTCTQTLEGHGDWVQSVAFSPDGQRVASGSDDHTIKIWD 1121

Query: 581  IRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
                 C  T +GH   + ++ F+PDG+ V
Sbjct: 1122 AASGTCTQTLEGHGDSVWSVAFSPDGQRV 1150



 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 52/149 (34%), Positives = 74/149 (49%)
 Frame = +2

Query: 221  QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
            Q    H G V  + F     R+  +G  D ++ +W     T T TL GH   V+S+AF  
Sbjct: 1045 QTLEGHGGWVWSVAFSPDGQRV-ASGSIDGTIKIWDAASGTCTQTLEGHGDWVQSVAFSP 1103

Query: 401  AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
                VA+GS    IK+WD       +TL GH     ++ F P G+  ASGS+D  +KIWD
Sbjct: 1104 DGQRVASGSDDHTIKIWDAASGTCTQTLEGHGDSVWSVAFSPDGQRVASGSIDGTIKIWD 1163

Query: 581  IRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
                 C  T +GH   + ++ F+PDG+ V
Sbjct: 1164 AASGTCTQTLEGHGGWVHSVAFSPDGQRV 1192



 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 53/156 (33%), Positives = 75/156 (48%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H  +V  + F     R+  +G  D ++ +W     T T TL GH   V
Sbjct: 912  AASGTCTQTLEGHGSSVLSVAFSPDGQRV-ASGSGDKTIKIWDTASGTGTQTLEGHGGSV 970

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+AF      VA+GS    IK+WD       +TL GH +   ++ F P G+  ASGS D
Sbjct: 971  WSVAFSPDGQRVASGSGDKTIKIWDTASGTCTQTLEGHGNSVWSVAFSPDGQRVASGSDD 1030

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
              +KIWD     C  T +GH   + ++ F+PDG+ V
Sbjct: 1031 KTIKIWDTASGTCTQTLEGHGGWVWSVAFSPDGQRV 1066



 Score = 93.2 bits (230), Expect = 4e-18
 Identities = 52/149 (34%), Positives = 73/149 (48%)
 Frame = +2

Query: 221  QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
            Q    H  +V  + F     R+  +G DD ++ +W     T T TL GH   V S+AF  
Sbjct: 835  QTLEGHGSSVLSVAFSPDGQRV-ASGSDDKTIKIWDTASGTGTQTLEGHGGSVWSVAFSP 893

Query: 401  AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
                VA+GS    IK+WD       +TL GH S   ++ F P G+  ASGS D  +KIWD
Sbjct: 894  DGQRVASGSDDKTIKIWDAASGTCTQTLEGHGSSVLSVAFSPDGQRVASGSGDKTIKIWD 953

Query: 581  IRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
                    T +GH   + ++ F+PDG+ V
Sbjct: 954  TASGTGTQTLEGHGGSVWSVAFSPDGQRV 982



 Score = 82.0 bits (201), Expect = 8e-15
 Identities = 43/107 (40%), Positives = 57/107 (53%)
 Frame = +2

Query: 347  TSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHP 526
            T TL GH S V S+AF      VA+GS    IK+WD       +TL GH     ++ F P
Sbjct: 834  TQTLEGHGSSVLSVAFSPDGQRVASGSDDKTIKIWDTASGTGTQTLEGHGGSVWSVAFSP 893

Query: 527  FGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
             G+  ASGS D  +KIWD     C  T +GH   + ++ F+PDG+ V
Sbjct: 894  DGQRVASGSDDKTIKIWDAASGTCTQTLEGHGSSVLSVAFSPDGQRV 940



 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 47/136 (34%), Positives = 63/136 (46%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H  +V  + F     R+  +G  D ++ +W     T T TL GH   V
Sbjct: 1122 AASGTCTQTLEGHGDSVWSVAFSPDGQRV-ASGSIDGTIKIWDAASGTCTQTLEGHGGWV 1180

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+AF      VA+GS  G IK+WD       +TL GH  +  ++ F P G+  ASGS D
Sbjct: 1181 HSVAFSPDGQRVASGSIDGTIKIWDAASGTCTQTLEGHGGWVHSVAFSPDGQRVASGSSD 1240

Query: 560  TNLKIWDIRKKGCIHT 607
              +KIWD     C  T
Sbjct: 1241 NTIKIWDTASGTCTQT 1256



 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 34/108 (31%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   Q    H G V+ + F     R+  +G  D ++ +W     T T TL GH   V
Sbjct: 1164 AASGTCTQTLEGHGGWVHSVAFSPDGQRV-ASGSIDGTIKIWDAASGTCTQTLEGHGGWV 1222

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLS-GHRSYCTALEF 520
             S+AF      VA+GSS   IK+WD       +TL+ G  + C + ++
Sbjct: 1223 HSVAFSPDGQRVASGSSDNTIKIWDTASGTCTQTLNVGSTATCLSFDY 1270



 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 27/76 (35%), Positives = 40/76 (52%)
 Frame = +2

Query: 440  IKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGH 619
            I + + E     +TL GH S   ++ F P G+  ASGS D  +KIWD        T +GH
Sbjct: 823  ISVVEAEWNACTQTLEGHGSSVLSVAFSPDGQRVASGSDDKTIKIWDTASGTGTQTLEGH 882

Query: 620  TRGISTIRFTPDGRWV 667
               + ++ F+PDG+ V
Sbjct: 883  GGSVWSVAFSPDGQRV 898



>pir|AI2493|AI2493 WD-repeat protein [imported] - Nostoc sp. (strain
            PCC 7120) plasmid pCC7120alpha>gb:BA000020_686489 Nostoc
            sp. PCC 7120 plasmid pCC7120alpha DNA, complete genome.
          Length = 1189

 Score =  100 bits (248), Expect = 3e-20
 Identities = 53/154 (34%), Positives = 81/154 (52%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  LQ F+ H   V  + F     ++  T G+D+++ LW +       TL GH   V++I
Sbjct: 678  GECLQTFLGHDACVWSVVF-HPVGQILATAGEDNTIKLWELQSGCCLKTLQGHQHWVKTI 736

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            AF+S   ++A+GS    +KLWD+   K + TL GH    T++ F+P      SGS D ++
Sbjct: 737  AFNSGGRILASGSFDQNVKLWDIHTGKCVMTLQGHTGVVTSVAFNPKDNLLLSGSYDQSV 796

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            K+WD +   C+ T K HT  I ++ F P G   V
Sbjct: 797  KVWDRKTGRCLDTLKKHTNRIWSVAFHPQGHLFV 830



 Score = 94.0 bits (232), Expect = 2e-18
 Identities = 42/121 (34%), Positives = 68/121 (56%)
 Frame = +2

Query: 299 GDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIR 478
           G DH++ LW+       +TL GHTS V S+AF     L+A+ S    +K+WDL+  + ++
Sbjct: 623 GQDHTIKLWNTTTGECFNTLHGHTSIVTSVAFSPEGKLLASSSYDHSVKVWDLDTGECLQ 682

Query: 479 TLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           T  GH +   ++ FHP G+  A+   D  +K+W+++   C+ T +GH   + TI F   G
Sbjct: 683 TFLGHDACVWSVVFHPVGQILATAGEDNTIKLWELQSGCCLKTLQGHQHWVKTIAFNSGG 742

Query: 659 R 661
           R
Sbjct: 743 R 743



 Score = 90.5 bits (223), Expect = 2e-17
 Identities = 43/139 (30%), Positives = 71/139 (51%)
 Frame = +2

Query: 236  HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
            H+  V  + F  +  ++  +   DHSV +W +       T  GH + V S+ F     ++
Sbjct: 645  HTSIVTSVAFSPEG-KLLASSSYDHSVKVWDLDTGECLQTFLGHDACVWSVVFHPVGQIL 703

Query: 416  AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
            A       IKLW+L+    ++TL GH+ +   + F+  G   ASGS D N+K+WDI    
Sbjct: 704  ATAGEDNTIKLWELQSGCCLKTLQGHQHWVKTIAFNSGGRILASGSFDQNVKLWDIHTGK 763

Query: 596  CIHTYKGHTRGISTIRFTP 652
            C+ T +GHT  ++++ F P
Sbjct: 764  CVMTLQGHTGVVTSVAFNP 782



 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 43/120 (35%), Positives = 64/120 (53%)
 Frame = +2

Query: 281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
            R+  +G  D +V LW I       TL GHT  V S+AF+  + L+ +GS    +K+WD +
Sbjct: 743  RILASGSFDQNVKLWDIHTGKCVMTLQGHTGVVTSVAFNPKDNLLLSGSYDQSVKVWDRK 802

Query: 461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
              + + TL  H +   ++ FHP G  F SG  D   KIW++    CI T++GH+    TI
Sbjct: 803  TGRCLDTLKKHTNRIWSVAFHPQGHLFVSGGDDHAAKIWELGTGQCIKTFQGHSNATYTI 862



 Score = 82.0 bits (201), Expect = 8e-15
 Identities = 43/135 (31%), Positives = 70/135 (51%), Gaps = 9/135 (6%)
 Frame = +2

Query: 284  MFLTGGDDHSVNLWSIG--KPTSTST-------LSGHTSPVESIAFDSAEILVAAGSSSG 436
            +  +G +D ++ LW +    P  ++        L GH++ V S+ F S   L+A+GS+  
Sbjct: 870  LLASGHEDQTIKLWDLNLHSPHKSNVNTHPFRILQGHSNRVFSVVFSSTGQLLASGSADR 929

Query: 437  LIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKG 616
             IKLW     + + TL GH S+  A+ F    +  ASGS D  +KIWD+    C+ T +G
Sbjct: 930  TIKLWSPHTGQCLHTLHGHGSWVWAIAFSLDDKLLASGSYDHTVKIWDVSSGQCLQTLQG 989

Query: 617  HTRGISTIRFTPDGR 661
            H   +  + F+ DG+
Sbjct: 990  HPGSVLAVAFSCDGK 1004



 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 41/145 (28%), Positives = 69/145 (47%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           F A  G +  + F +  C++  T      +N+W +           H S +  +AF S  
Sbjct: 558 FAATFGGITSVAFSRDGCQL-ATSDTSGVINIWDVNNGKQLFNCQEHNSWIWDVAFSSVA 616

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            ++A+      IKLW+    +   TL GH S  T++ F P G+  AS S D ++K+WD+ 
Sbjct: 617 PVLASCGQDHTIKLWNTTTGECFNTLHGHTSIVTSVAFSPEGKLLASSSYDHSVKVWDLD 676

Query: 587 KKGCIHTYKGHTRGISTIRFTPDGR 661
              C+ T+ GH   + ++ F P G+
Sbjct: 677 TGECLQTFLGHDACVWSVVFHPVGQ 701



 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 37/130 (28%), Positives = 65/130 (50%)
 Frame = +2

Query: 281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
            ++  +G  DH+V +W +       TL GH   V ++AF      + +     L+K WD+E
Sbjct: 962  KLLASGSYDHTVKIWDVSSGQCLQTLQGHPGSVLAVAFSCDGKTLFSSGYEKLVKQWDVE 1021

Query: 461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
                ++T     +   A+      ++ A+G  D+ +++WDI K  C+ T+ GHT  +  I
Sbjct: 1022 TGYCLQTWEADSNRVWAVAVSRDNQYLATGGDDSVVRLWDIGKGVCVRTFSGHTSQVICI 1081

Query: 641  RFTPDGRWVV 670
             FT DGR ++
Sbjct: 1082 LFTKDGRRMI 1091



 Score = 73.6 bits (179), Expect = 3e-12
 Identities = 45/135 (33%), Positives = 62/135 (45%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            GY LQ + A S  V  +   +   +   TGGDD  V LW IGK     T SGHTS V  I
Sbjct: 1023 GYCLQTWEADSNRVWAVAVSRDN-QYLATGGDDSVVRLWDIGKGVCVRTFSGHTSQVICI 1081

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
             F      + + SS   IK+W++   + + TL  H  +  +L   P  +   S S D  +
Sbjct: 1082 LFTKDGRRMISSSSDRTIKIWNVSTGECLATLQAHDHWVWSLYLTPDEKTLLSSSWDETI 1141

Query: 569  KIWDIRKKGCIHTYK 613
            K W+I    C  T +
Sbjct: 1142 KCWNISTGECWQTLR 1156



 Score = 67.0 bits (162), Expect = 3e-10
 Identities = 39/149 (26%), Positives = 64/149 (42%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  LQ    H G+V  + F      +F + G +  V  W +       T    ++ V ++
Sbjct: 981  GQCLQTLQGHPGSVLAVAFSCDGKTLF-SSGYEKLVKQWDVETGYCLQTWEADSNRVWAV 1039

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            A       +A G    +++LWD+     +RT SGH S    + F   G    S S D  +
Sbjct: 1040 AVSRDNQYLATGGDDSVVRLWDIGKGVCVRTFSGHTSQVICILFTKDGRRMISSSSDRTI 1099

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
            KIW++    C+ T + H   + ++  TPD
Sbjct: 1100 KIWNVSTGECLATLQAHDHWVWSLYLTPD 1128



 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 40/151 (26%), Positives = 69/151 (45%), Gaps = 9/151 (5%)
 Frame = +2

Query: 236  HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
            H+G V  + F  K   + L+G  D SV +W         TL  HT+ + S+AF     L 
Sbjct: 771  HTGVVTSVAFNPKD-NLLLSGSYDQSVKVWDRKTGRCLDTLKKHTNRIWSVAFHPQGHLF 829

Query: 416  AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR--- 586
             +G      K+W+L   + I+T  GH +    +  +      ASG  D  +K+WD+    
Sbjct: 830  VSGGDDHAAKIWELGTGQCIKTFQGHSNATYTIAHNWEHSLLASGHEDQTIKLWDLNLHS 889

Query: 587  -KKGCIHTY-----KGHTRGISTIRFTPDGR 661
              K  ++T+     +GH+  + ++ F+  G+
Sbjct: 890  PHKSNVNTHPFRILQGHSNRVFSVVFSSTGQ 920



>pir|AB2202|AB2202 hypothetical protein all3169 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_684158 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 559

 Score = 99.0 bits (245), Expect = 7e-20
 Identities = 52/149 (34%), Positives = 79/149 (53%), Gaps = 4/149 (2%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           F  HS  V  + F  +   +  T  DD ++ LW +   +   TL+GHT+PV+S++F    
Sbjct: 307 FSGHSQAVTSVSFSPQG-EILATASDDKTIKLWHLPTSSEVFTLNGHTNPVKSVSFSPNG 365

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            ++A+GS    +KLWD+   K I  L  H+   +A+ F P GE  AS S D  +++W I 
Sbjct: 366 QILASGSWDKQVKLWDVTTGKEIYALKAHQLQVSAVAFSPQGEILASASFDRTIRLWQIT 425

Query: 587 KK----GCIHTYKGHTRGISTIRFTPDGR 661
           +       I T  GHTR +  I F+PDG+
Sbjct: 426 QNHPRYTLIKTLSGHTRAVLAIAFSPDGK 454



 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 41/122 (33%), Positives = 64/122 (52%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +GGDD  + LW +      +  SGH+  V S++F     ++A  S    IKLW L  +  
Sbjct: 286 SGGDDKIIRLWELNTQKLLACFSGHSQAVTSVSFSPQGEILATASDDKTIKLWHLPTSSE 345

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           + TL+GH +   ++ F P G+  ASGS D  +K+WD+     I+  K H   +S + F+P
Sbjct: 346 VFTLNGHTNPVKSVSFSPNGQILASGSWDKQVKLWDVTTGKEIYALKAHQLQVSAVAFSP 405

Query: 653 DG 658
            G
Sbjct: 406 QG 407



 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 32/103 (31%), Positives = 59/103 (57%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           TL+G+++   +I+ D  ++  A+G    +I+LW+L   K++   SGH    T++ F P G
Sbjct: 266 TLTGYSTNSLAISPDGNKL--ASGGDDKIIRLWELNTQKLLACFSGHSQAVTSVSFSPQG 323

Query: 533 EFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
           E  A+ S D  +K+W +     + T  GHT  + ++ F+P+G+
Sbjct: 324 EILATASDDKTIKLWHLPTSSEVFTLNGHTNPVKSVSFSPNGQ 366



 Score = 69.3 bits (168), Expect = 6e-11
 Identities = 44/152 (28%), Positives = 67/152 (44%), Gaps = 4/152 (2%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKP----TSTSTLSGHTSP 376
           G ++    AH   V+ + F  +   +  +   D ++ LW I +     T   TLSGHT  
Sbjct: 385 GKEIYALKAHQLQVSAVAFSPQG-EILASASFDRTIRLWQITQNHPRYTLIKTLSGHTRA 443

Query: 377 VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM 556
           V +IAF     ++A GS    IKLWD+   ++I TL GH     A+ F    +   S S 
Sbjct: 444 VLAIAFSPDGKILATGSDDNTIKLWDINTGQLIATLLGHSWSVVAVTFTADNKTLISASW 503

Query: 557 DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           D  +K+W +     I T   H   +  +   P
Sbjct: 504 DKTIKLWKVSTTEEIVTLASHLDSVCAVAVNP 535



 Score = 63.5 bits (153), Expect = 3e-09
 Identities = 31/101 (30%), Positives = 52/101 (51%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
           ++  TG DD+++ LW I      +TL GH+  V ++ F +    + + S    IKLW + 
Sbjct: 454 KILATGSDDNTIKLWDINTGQLIATLLGHSWSVVAVTFTADNKTLISASWDKTIKLWKVS 513

Query: 461 DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
            T+ I TL+ H     A+  +P  +  AS S D  +K+W +
Sbjct: 514 TTEEIVTLASHLDSVCAVAVNPVTQVIASSSRDKTIKLWQL 554



>gb:BA000045_741250 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1183

 Score = 98.6 bits (244), Expect = 9e-20
 Identities = 60/187 (32%), Positives = 90/187 (48%), Gaps = 2/187 (1%)
 Frame = +2

Query: 107  FSLDFCSAAAERPTPXXXXXXXXXXXXXXRMAKRGYKLQEFVA--HSGNVNCLRFGKKTC 280
            F+  FC   A   +P              R+     + Q FV   HSG V  L F   + 
Sbjct: 562  FADHFCGVLALAFSPDGRWLAMADTRGEVRLCLVQSREQRFVCAGHSGWVEGLAFSPDS- 620

Query: 281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
             +  + G D ++ LW +      +TL+GH   V S+AF     L+A+GS  G IKLWD +
Sbjct: 621  EILASAGLDGTIRLWQVVSGQLQATLTGHNKGVRSVAFAPDGHLIASGSLDGTIKLWDAQ 680

Query: 461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
              +   TL+GHR+   ++ + P G++ ASGS D  +K W      C+ T +GHT  + ++
Sbjct: 681  SGQCRLTLTGHRNVVASVVWSPDGQYLASGSNDGTVKFWRPVGGRCLRTLRGHTDEVWSV 740

Query: 641  RFTPDGR 661
             F PD R
Sbjct: 741  AFGPDSR 747



 Score = 86.7 bits (213), Expect = 3e-16
 Identities = 49/151 (32%), Positives = 69/151 (45%), Gaps = 1/151 (0%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGD-DHSVNLWSIGKPTSTSTLSGHTSPVES 385
            G  +  F  HSG V  +  G       L  GD DH V +WS      T  LSGHT P+ S
Sbjct: 849  GQCVYSFKGHSGGVAAVAVGGHGT---LASGDADHRVRIWSTEDGRCTRVLSGHTHPIWS 905

Query: 386  IAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTN 565
            +AF      +A+ S+   ++LWD    +    L GH S+  ++ F P G   ASG  D  
Sbjct: 906  VAFAPGGATLASASADHAVRLWDGASGRCTHILQGHTSWVWSVAFSPDGRRLASGGADRT 965

Query: 566  LKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
            +++WD     C+ T       +  + F PDG
Sbjct: 966  VRLWDTATGQCLRTSTEADHRVLAVAFMPDG 996



 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 44/142 (30%), Positives = 69/142 (48%)
 Frame = +2

Query: 236  HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
            HSG +  + F      +  TG  D +V LW +       +  GH+  V ++A      L 
Sbjct: 816  HSGIIRSVAFAPDG-GLLATGSIDQTVKLWDLQSGQCVYSFKGHSGGVAAVAVGGHGTL- 873

Query: 416  AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
            A+G +   +++W  ED +  R LSGH     ++ F P G   AS S D  +++WD     
Sbjct: 874  ASGDADHRVRIWSTEDGRCTRVLSGHTHPIWSVAFAPGGATLASASADHAVRLWDGASGR 933

Query: 596  CIHTYKGHTRGISTIRFTPDGR 661
            C H  +GHT  + ++ F+PDGR
Sbjct: 934  CTHILQGHTSWVWSVAFSPDGR 955



 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 41/144 (28%), Positives = 75/144 (52%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  L+    H+  V  + FG  + R  L+G  D ++ +W     T    LSGH   V ++
Sbjct: 724  GRCLRTLRGHTDEVWSVAFGPDS-RTLLSGSSDGTLRMWDTHGGTCKQALSGHQDKVRTV 782

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            A+      +A+GS    +++W+  D +    L GH     ++ F P G   A+GS+D  +
Sbjct: 783  AWSLDGQRLASGSWDATVRVWNA-DGRCQSILRGHSGIIRSVAFAPDGGLLATGSIDQTV 841

Query: 569  KIWDIRKKGCIHTYKGHTRGISTI 640
            K+WD++   C++++KGH+ G++ +
Sbjct: 842  KLWDLQSGQCVYSFKGHSGGVAAV 865



 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 33/103 (32%), Positives = 59/103 (57%)
 Frame = +2

Query: 359 SGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEF 538
           +GH+  VE +AF     ++A+    G I+LW +   ++  TL+GH     ++ F P G  
Sbjct: 605 AGHSGWVEGLAFSPDSEILASAGLDGTIRLWQVVSGQLQATLTGHNKGVRSVAFAPDGHL 664

Query: 539 FASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            ASGS+D  +K+WD +   C  T  GH   ++++ ++PDG+++
Sbjct: 665 IASGSLDGTIKLWDAQSGQCRLTLTGHRNVVASVVWSPDGQYL 707



 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 42/129 (32%), Positives = 69/129 (53%), Gaps = 2/129 (1%)
 Frame = +2

Query: 281  RMFLTGGDDHSVNLW--SIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
            R   +GG D +V LW  + G+   TST + H   V ++AF   + L  AGS    ++LWD
Sbjct: 955  RRLASGGADRTVRLWDTATGQCLRTSTEADHR--VLAVAF-MPDGLTLAGSVDQTVRLWD 1011

Query: 455  LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
                + +RTL+GH S+  +L     G   A+GS D +++IW++    C+   + H   + 
Sbjct: 1012 AATGRCLRTLAGHTSWIWSLAASADGRLMATGSADRSVRIWEVATGRCLKHLEEHGGWVW 1071

Query: 635  TIRFTPDGR 661
            ++ F+PD R
Sbjct: 1072 SVAFSPDER 1080



 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 38/122 (31%), Positives = 61/122 (50%)
 Frame = +2

Query: 293  TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
            +G +D +V  W         TL GHT  V S+AF      + +GSS G +++WD      
Sbjct: 709  SGSNDGTVKFWRPVGGRCLRTLRGHTDEVWSVAFGPDSRTLLSGSSDGTLRMWDTHGGTC 768

Query: 473  IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
             + LSGH+     + +   G+  ASGS D  +++W+   + C    +GH+  I ++ F P
Sbjct: 769  KQALSGHQDKVRTVAWSLDGQRLASGSWDATVRVWNADGR-CQSILRGHSGIIRSVAFAP 827

Query: 653  DG 658
            DG
Sbjct: 828  DG 829



 Score = 59.3 bits (142), Expect = 6e-08
 Identities = 29/96 (30%), Positives = 50/96 (52%)
 Frame = +2

Query: 290  LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
            L G  D +V LW         TL+GHTS + S+A  +   L+A GS+   +++W++   +
Sbjct: 999  LAGSVDQTVRLWDAATGRCLRTLAGHTSWIWSLAASADGRLMATGSADRSVRIWEVATGR 1058

Query: 470  MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
             ++ L  H  +  ++ F P     A GSMD  +++W
Sbjct: 1059 CLKHLEEHGGWVWSVAFSPDERRLAVGSMDGTIRLW 1094



 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 29/111 (26%), Positives = 51/111 (45%)
 Frame = +2

Query: 281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
            R+  TG  D SV +W +        L  H   V S+AF   E  +A GS  G I+LW   
Sbjct: 1038 RLMATGSADRSVRIWEVATGRCLKHLEEHGGWVWSVAFSPDERRLAVGSMDGTIRLWSFP 1097

Query: 461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYK 613
            + +++R+++   S   ++ F   G+   +G  D  ++ W +    C+   +
Sbjct: 1098 EGELLRSMA-CESAVRSIAFESHGQVLIAGCEDGTIRFWSVACGECLRVLR 1147



 Score = 52.8 bits (125), Expect = 5e-06
 Identities = 26/106 (24%), Positives = 48/106 (45%)
 Frame = +2

Query: 350 STLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPF 529
           S  + H   V ++AF      +A   + G ++L  ++  +     +GH  +   L F P 
Sbjct: 560 SAFADHFCGVLALAFSPDGRWLAMADTRGEVRLCLVQSREQRFVCAGHSGWVEGLAFSPD 619

Query: 530 GEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            E  AS  +D  +++W +       T  GH +G+ ++ F PDG  +
Sbjct: 620 SEILASAGLDGTIRLWQVVSGQLQATLTGHNKGVRSVAFAPDGHLI 665



>gb:BA000045_744431 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1188

 Score = 97.8 bits (242), Expect = 1e-19
 Identities = 50/154 (32%), Positives = 78/154 (50%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G  L+ F  HSG V  + F     +   +G  D +V +W         TL G+   +
Sbjct: 808  AATGECLRTFTGHSGQVWSVSFAPDG-QTLASGSLDQTVRIWDAATGQCLRTLQGNAGWI 866

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+AF      +A+GS    +++WD+   + +RTL+GH S+  ++ F P G   ASGS D
Sbjct: 867  WSVAFAPDGQTLASGSLDRTVRIWDVPSGRCVRTLTGHGSWVWSVAFSPDGRTLASGSFD 926

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
              +K+WD     C+ T  GH   + ++ F+PDGR
Sbjct: 927  QTIKLWDAATGQCLRTLSGHNNWVRSVAFSPDGR 960



 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 47/125 (37%), Positives = 71/125 (56%)
 Frame = +2

Query: 293  TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
            +G  D +V +W +       TL+GH S V S+AF      +A+GS    IKLWD    + 
Sbjct: 880  SGSLDRTVRIWDVPSGRCVRTLTGHGSWVWSVAFSPDGRTLASGSFDQTIKLWDAATGQC 939

Query: 473  IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
            +RTLSGH ++  ++ F P G   ASGS D  +K+W++    C+ T  GH+  + ++ F+P
Sbjct: 940  LRTLSGHNNWVRSVAFSPDGRTLASGSHDQTVKLWEVSSGQCLRTLTGHSSWVWSVAFSP 999

Query: 653  DGRWV 667
            DGR V
Sbjct: 1000 DGRTV 1004



 Score = 94.0 bits (232), Expect = 2e-18
 Identities = 44/127 (34%), Positives = 70/127 (55%)
 Frame = +2

Query: 281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
            R   +G  D ++ LW         TLSGH + V S+AF      +A+GS    +KLW++ 
Sbjct: 918  RTLASGSFDQTIKLWDAATGQCLRTLSGHNNWVRSVAFSPDGRTLASGSHDQTVKLWEVS 977

Query: 461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
              + +RTL+GH S+  ++ F P G   ASGS D  +++W+     C+HT K  +  + ++
Sbjct: 978  SGQCLRTLTGHSSWVWSVAFSPDGRTVASGSFDQTVRVWNAATGECLHTLKVDSSQVWSV 1037

Query: 641  RFTPDGR 661
             F+PDGR
Sbjct: 1038 AFSPDGR 1044



 Score = 94.0 bits (232), Expect = 2e-18
 Identities = 43/119 (36%), Positives = 67/119 (56%)
 Frame = +2

Query: 305  DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
            D +V LW +       TL+GHT  V S+AF     ++A+GS    +KLW++     + TL
Sbjct: 716  DRTVKLWDVRTGERLGTLTGHTDQVLSVAFSPDGGVLASGSHDQTLKLWEVTTGTCLTTL 775

Query: 485  SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
            +GH     A+ F P GE+ AS S+D  +K+WD     C+ T+ GH+  + ++ F PDG+
Sbjct: 776  TGHTGRIRAISFSPDGEWLASSSLDCTVKLWDAATGECLRTFTGHSGQVWSVSFAPDGQ 834



 Score = 91.3 bits (225), Expect = 1e-17
 Identities = 49/153 (32%), Positives = 71/153 (46%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  L+    H G V  + F      +  +   + +V LW       T T    T  + S+
Sbjct: 642  GQCLRTLTGHGGWVYSVAFSPDGTLIASSSPSNETVRLWDAAGGQCTRTFKSRTGRMWSV 701

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            AF      +AA S    +KLWD+   + + TL+GH     ++ F P G   ASGS D  L
Sbjct: 702  AFSPDGHTLAAASLDRTVKLWDVRTGERLGTLTGHTDQVLSVAFSPDGGVLASGSHDQTL 761

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            K+W++    C+ T  GHT  I  I F+PDG W+
Sbjct: 762  KLWEVTTGTCLTTLTGHTGRIRAISFSPDGEWL 794



 Score = 90.9 bits (224), Expect = 2e-17
 Identities = 46/153 (30%), Positives = 78/153 (50%)
 Frame = +2

Query: 203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
            + G +L     H+  V  + F      +  +G  D ++ LW +   T  +TL+GHT  + 
Sbjct: 725  RTGERLGTLTGHTDQVLSVAFSPDG-GVLASGSHDQTLKLWEVTTGTCLTTLTGHTGRIR 783

Query: 383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
            +I+F      +A+ S    +KLWD    + +RT +GH     ++ F P G+  ASGS+D 
Sbjct: 784  AISFSPDGEWLASSSLDCTVKLWDAATGECLRTFTGHSGQVWSVSFAPDGQTLASGSLDQ 843

Query: 563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
             ++IWD     C+ T +G+   I ++ F PDG+
Sbjct: 844  TVRIWDAATGQCLRTLQGNAGWIWSVAFAPDGQ 876



 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 44/151 (29%), Positives = 74/151 (49%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  L     H+G +  + F         +   D +V LW         T +GH+  V S+
Sbjct: 769  GTCLTTLTGHTGRIRAISFSPDG-EWLASSSLDCTVKLWDAATGECLRTFTGHSGQVWSV 827

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            +F      +A+GS    +++WD    + +RTL G+  +  ++ F P G+  ASGS+D  +
Sbjct: 828  SFAPDGQTLASGSLDQTVRIWDAATGQCLRTLQGNAGWIWSVAFAPDGQTLASGSLDRTV 887

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
            +IWD+    C+ T  GH   + ++ F+PDGR
Sbjct: 888  RIWDVPSGRCVRTLTGHGSWVWSVAFSPDGR 918



 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 48/154 (31%), Positives = 74/154 (48%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  L+    HS  V  + F     R   +G  D +V +W+        TL   +S V S+
Sbjct: 979  GQCLRTLTGHSSWVWSVAFSPDG-RTVASGSFDQTVRVWNAATGECLHTLKVDSSQVWSV 1037

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            AF     ++A GS +  + LWD    + +RTL+GH S   ++ F P      S S D  +
Sbjct: 1038 AFSPDGRILAGGSGNYAVWLWDTATGECLRTLTGHTSQVWSVAFSPDSRTVVSSSHDQTV 1097

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            ++WD     C+ T  GHT  + ++ F+PDGR V+
Sbjct: 1098 RLWDAATGECLRTLTGHTSQVWSVAFSPDGRTVI 1131



 Score = 82.0 bits (201), Expect = 8e-15
 Identities = 48/157 (30%), Positives = 74/157 (47%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G  L+    H+  V  + F     R   +G  D +V LW +       TL+GH+S V
Sbjct: 934  AATGQCLRTLSGHNNWVRSVAFSPDG-RTLASGSHDQTVKLWEVSSGQCLRTLTGHSSWV 992

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+AF      VA+GS    +++W+    + + TL    S   ++ F P G   A GS +
Sbjct: 993  WSVAFSPDGRTVASGSFDQTVRVWNAATGECLHTLKVDSSQVWSVAFSPDGRILAGGSGN 1052

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
              + +WD     C+ T  GHT  + ++ F+PD R VV
Sbjct: 1053 YAVWLWDTATGECLRTLTGHTSQVWSVAFSPDSRTVV 1089



 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 39/122 (31%), Positives = 62/122 (50%), Gaps = 1/122 (0%)
 Frame = +2

Query: 296 GGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMI 475
           G D   V LW +       +  GHT  + ++AF     ++A+GS    IKLWD    + +
Sbjct: 586 GDDSGEVRLWRVRDGQQQLSFRGHTDWISALAFSPDGSVLASGSEDQTIKLWDTATGQCL 645

Query: 476 RTLSGHRSYCTALEFHPFGEFFASGS-MDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           RTL+GH  +  ++ F P G   AS S  +  +++WD     C  T+K  T  + ++ F+P
Sbjct: 646 RTLTGHGGWVYSVAFSPDGTLIASSSPSNETVRLWDAAGGQCTRTFKSRTGRMWSVAFSP 705

Query: 653 DG 658
           DG
Sbjct: 706 DG 707



 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 35/100 (35%), Positives = 52/100 (52%)
 Frame = +2

Query: 281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
            R+   G  +++V LW         TL+GHTS V S+AF      V + S    ++LWD  
Sbjct: 1044 RILAGGSGNYAVWLWDTATGECLRTLTGHTSQVWSVAFSPDSRTVVSSSHDQTVRLWDAA 1103

Query: 461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
              + +RTL+GH S   ++ F P G    SGS D  +++WD
Sbjct: 1104 TGECLRTLTGHTSQVWSVAFSPDGRTVISGSQDETIRLWD 1143



 Score = 70.5 bits (171), Expect = 3e-11
 Identities = 32/91 (35%), Positives = 49/91 (53%)
 Frame = +2

Query: 386 IAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTN 565
           +A+     L+A G  SG ++LW + D +   +  GH  + +AL F P G   ASGS D  
Sbjct: 574 VAYSPKGELLAIGDDSGEVRLWRVRDGQQQLSFRGHTDWISALAFSPDGSVLASGSEDQT 633

Query: 566 LKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           +K+WD     C+ T  GH   + ++ F+PDG
Sbjct: 634 IKLWDTATGQCLRTLTGHGGWVYSVAFSPDG 664



 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 31/98 (31%), Positives = 43/98 (43%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  L+    H+  V  + F   + R  ++   D +V LW         TL+GHTS V S+
Sbjct: 1063 GECLRTLTGHTSQVWSVAFSPDS-RTVVSSSHDQTVRLWDAATGECLRTLTGHTSQVWSV 1121

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSY 502
            AF      V +GS    I+LWD    K +  L   R Y
Sbjct: 1122 AFSPDGRTVISGSQDETIRLWDSHTGKPLELLRADRLY 1159



>gb:BA000045_742040 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1197

 Score = 97.1 bits (240), Expect = 3e-19
 Identities = 49/151 (32%), Positives = 77/151 (50%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G+ L+    H   +  + F +   +   +G  DHSV LW         +L  HTS V ++
Sbjct: 851  GHCLRVLQGHGSGIWSVAF-RGDGKTLASGSIDHSVRLWDFSTRQPMRSLQAHTSWVRTV 909

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            AF     L+A+      IKLWD +  + ++TL GH  +  +L F P G   AS S+D +L
Sbjct: 910  AFSPDGTLLASSGQDRTIKLWDPDSGRCLKTLRGHTGWVNSLAFSPNGALLASSSVDHSL 969

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
            +IW++    C+   +GHT  + ++ F PDGR
Sbjct: 970  RIWNVETGQCLGMLQGHTSWVRSVAFHPDGR 1000



 Score = 95.9 bits (237), Expect = 6e-19
 Identities = 50/151 (33%), Positives = 78/151 (51%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  L+    H+G VN L F      +  +   DHS+ +W++        L GHTS V S+
Sbjct: 935  GRCLKTLRGHTGWVNSLAFSPNGA-LLASSSVDHSLRIWNVETGQCLGMLQGHTSWVRSV 993

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            AF     ++A+ S     +LWD+E  + + TL GH S+  ++ FHP G   ASGS D  +
Sbjct: 994  AFHPDGRVLASASQDKTARLWDIETGRCLWTLQGHTSWVRSVAFHPDGHTLASGSDDGTV 1053

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
            K+WD++      +  GH  G+ ++ F  DG+
Sbjct: 1054 KLWDVQTGRLADSLSGHGSGVWSVVFAADGK 1084



 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 46/151 (30%), Positives = 78/151 (51%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  LQ    H+G V  + F     +  ++G DD ++ LW + +      L GHT  V S+
Sbjct: 725  GEPLQAMQGHTGWVRSIAFAPDG-QTLISGSDDQTLRLWDVQRGLLLKCLQGHTGWVRSV 783

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
             F +    +A+GS    ++LWD +     R + GH ++ +++ F P G    SGS+D ++
Sbjct: 784  DFSADGRTLASGSDDQTVRLWDADSGLCFRVMHGHSNWISSVVFSPDGRLLTSGSVDHSV 843

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
            +IW+I    C+   +GH  GI ++ F  DG+
Sbjct: 844  RIWEISSGHCLRVLQGHGSGIWSVAFRGDGK 874



 Score = 93.2 bits (230), Expect = 4e-18
 Identities = 46/147 (31%), Positives = 74/147 (50%)
 Frame = +2

Query: 218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
            ++   AH+  V  + F      +  + G D ++ LW         TL GHT  V S+AF 
Sbjct: 896  MRSLQAHTSWVRTVAFSPDGT-LLASSGQDRTIKLWDPDSGRCLKTLRGHTGWVNSLAFS 954

Query: 398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                L+A+ S    +++W++E  + +  L GH S+  ++ FHP G   AS S D   ++W
Sbjct: 955  PNGALLASSSVDHSLRIWNVETGQCLGMLQGHTSWVRSVAFHPDGRVLASASQDKTARLW 1014

Query: 578  DIRKKGCIHTYKGHTRGISTIRFTPDG 658
            DI    C+ T +GHT  + ++ F PDG
Sbjct: 1015 DIETGRCLWTLQGHTSWVRSVAFHPDG 1041



 Score = 91.3 bits (225), Expect = 1e-17
 Identities = 40/129 (31%), Positives = 71/129 (55%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
           ++  T   + ++ LW        +   GHTS V SIAF     ++A+GS+   ++LWD  
Sbjct: 580 QLLATSEINGTIRLWQAADAQQLAYCRGHTSWVWSIAFSPDGRVLASGSADRTVRLWDYR 639

Query: 461 DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
             + ++   GH  +  ++ FHP G   ASGS D  +++W++    C+ T +GH+  I  +
Sbjct: 640 TGQCLKVFQGHEGWVRSVAFHPGGGILASGSEDAAVRLWEVDSGRCLLTLRGHSGWIHAV 699

Query: 641 RFTPDGRWV 667
           RF+P+G+W+
Sbjct: 700 RFSPNGQWL 708



 Score = 90.9 bits (224), Expect = 2e-17
 Identities = 42/126 (33%), Positives = 66/126 (52%)
 Frame = +2

Query: 281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
            R+  +G  DHSV +W I        L GH S + S+AF      +A+GS    ++LWD  
Sbjct: 832  RLLTSGSVDHSVRIWEISSGHCLRVLQGHGSGIWSVAFRGDGKTLASGSIDHSVRLWDFS 891

Query: 461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
              + +R+L  H S+   + F P G   AS   D  +K+WD     C+ T +GHT  ++++
Sbjct: 892  TRQPMRSLQAHTSWVRTVAFSPDGTLLASSGQDRTIKLWDPDSGRCLKTLRGHTGWVNSL 951

Query: 641  RFTPDG 658
             F+P+G
Sbjct: 952  AFSPNG 957



 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 43/152 (28%), Positives = 77/152 (50%)
 Frame = +2

Query: 203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
            +RG  L+    H+G V  + F     R   +G DD +V LW          + GH++ + 
Sbjct: 765  QRGLLLKCLQGHTGWVRSVDFSADG-RTLASGSDDQTVRLWDADSGLCFRVMHGHSNWIS 823

Query: 383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
            S+ F     L+ +GS    +++W++     +R L GH S   ++ F   G+  ASGS+D 
Sbjct: 824  SVVFSPDGRLLTSGSVDHSVRIWEISSGHCLRVLQGHGSGIWSVAFRGDGKTLASGSIDH 883

Query: 563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
            ++++WD   +  + + + HT  + T+ F+PDG
Sbjct: 884  SVRLWDFSTRQPMRSLQAHTSWVRTVAFSPDG 915



 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 43/142 (30%), Positives = 70/142 (49%)
 Frame = +2

Query: 236  HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
            HSG ++ +RF     +   +   D  + LW          + GHT  V SIAF      +
Sbjct: 692  HSGWIHAVRFSPNG-QWLASSSQDGKIQLWHPESGEPLQAMQGHTGWVRSIAFAPDGQTL 750

Query: 416  AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
             +GS    ++LWD++   +++ L GH  +  +++F   G   ASGS D  +++WD     
Sbjct: 751  ISGSDDQTLRLWDVQRGLLLKCLQGHTGWVRSVDFSADGRTLASGSDDQTVRLWDADSGL 810

Query: 596  CIHTYKGHTRGISTIRFTPDGR 661
            C     GH+  IS++ F+PDGR
Sbjct: 811  CFRVMHGHSNWISSVVFSPDGR 832



 Score = 83.6 bits (205), Expect = 3e-15
 Identities = 38/130 (29%), Positives = 66/130 (50%)
 Frame = +2

Query: 281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
            R+  +G  D +V LW            GH   V S+AF     ++A+GS    ++LW+++
Sbjct: 622  RVLASGSADRTVRLWDYRTGQCLKVFQGHEGWVRSVAFHPGGGILASGSEDAAVRLWEVD 681

Query: 461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
              + + TL GH  +  A+ F P G++ AS S D  +++W       +   +GHT  + +I
Sbjct: 682  SGRCLLTLRGHSGWIHAVRFSPNGQWLASSSQDGKIQLWHPESGEPLQAMQGHTGWVRSI 741

Query: 641  RFTPDGRWVV 670
             F PDG+ ++
Sbjct: 742  AFAPDGQTLI 751



 Score = 83.2 bits (204), Expect = 4e-15
 Identities = 43/153 (28%), Positives = 77/153 (50%)
 Frame = +2

Query: 203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
            + G  L+ F  H G V  + F      +  +G +D +V LW +       TL GH+  + 
Sbjct: 639  RTGQCLKVFQGHEGWVRSVAFHPGG-GILASGSEDAAVRLWEVDSGRCLLTLRGHSGWIH 697

Query: 383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
            ++ F      +A+ S  G I+LW  E  + ++ + GH  +  ++ F P G+   SGS D 
Sbjct: 698  AVRFSPNGQWLASSSQDGKIQLWHPESGEPLQAMQGHTGWVRSIAFAPDGQTLISGSDDQ 757

Query: 563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
             L++WD+++   +   +GHT  + ++ F+ DGR
Sbjct: 758  TLRLWDVQRGLLLKCLQGHTGWVRSVDFSADGR 790



 Score = 82.8 bits (203), Expect = 5e-15
 Identities = 42/127 (33%), Positives = 62/127 (48%)
 Frame = +2

Query: 281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
            R+  +   D +  LW I       TL GHTS V S+AF      +A+GS  G +KLWD++
Sbjct: 1000 RVLASASQDKTARLWDIETGRCLWTLQGHTSWVRSVAFHPDGHTLASGSDDGTVKLWDVQ 1059

Query: 461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
              ++  +LSGH S   ++ F   G+  ASG  D  +++WD     C H    H  G+  +
Sbjct: 1060 TGRLADSLSGHGSGVWSVVFAADGKRLASGGDDKTVRLWDTTSMQCTHVLNRHASGVLCV 1119

Query: 641  RFTPDGR 661
                D R
Sbjct: 1120 AIEADSR 1126



 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 34/105 (32%), Positives = 53/105 (50%)
 Frame = +2

Query: 344 STSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFH 523
           S S  +   S V S+AF     L+A    +G I+LW   D + +    GH S+  ++ F 
Sbjct: 559 SQSIFTEALSTVSSVAFSPDGQLLATSEINGTIRLWQAADAQQLAYCRGHTSWVWSIAFS 618

Query: 524 PFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           P G   ASGS D  +++WD R   C+  ++GH   + ++ F P G
Sbjct: 619 PDGRVLASGSADRTVRLWDYRTGQCLKVFQGHEGWVRSVAFHPGG 663



 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 28/98 (28%), Positives = 45/98 (45%)
 Frame = +2

Query: 293  TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
            +G DD +V LW +       +LSGH S V S+ F +    +A+G     ++LWD    + 
Sbjct: 1046 SGSDDGTVKLWDVQTGRLADSLSGHGSGVWSVVFAADGKRLASGGDDKTVRLWDTTSMQC 1105

Query: 473  IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
               L+ H S    +         AS S D  + +WD++
Sbjct: 1106 THVLNRHASGVLCVAIEADSRILASSSADETITLWDLQ 1143



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 21/64 (32%), Positives = 34/64 (53%)
 Frame = +2

Query: 293  TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
            +GGDD +V LW       T  L+ H S V  +A ++   ++A+ S+   I LWDL+    
Sbjct: 1088 SGGDDKTVRLWDTTSMQCTHVLNRHASGVLCVAIEADSRILASSSADETITLWDLQGGNY 1147

Query: 473  IRTL 484
            + T+
Sbjct: 1148 LGTM 1151



 Score = 36.2 bits (82), Expect = 0.53
 Identities = 15/55 (27%), Positives = 30/55 (54%)
 Frame = +2

Query: 497 SYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
           S  +++ F P G+  A+  ++  +++W       +   +GHT  + +I F+PDGR
Sbjct: 568 STVSSVAFSPDGQLLATSEINGTIRLWQAADAQQLAYCRGHTSWVWSIAFSPDGR 622



>gb:BA000045_744426 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1184

 Score = 96.7 bits (239), Expect = 3e-19
 Identities = 54/151 (35%), Positives = 73/151 (48%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  L     H   V+ + F     R   TG  D +V LW         TL  HT  V SI
Sbjct: 765  GRCLATLAGHGDWVSAVAFAPDG-RSLATGSLDRTVRLWETITGQCLKTLQEHTDQVFSI 823

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            AF      +A+GS +  +KLWD E  + +RTL G      A+ F P G+   SGS D  +
Sbjct: 824  AFHPQGHTLASGSPTQTVKLWDTESGQCLRTLQGKTVTVLAVAFSPHGQTLVSGSDDRLV 883

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
            ++WD+R   C    +GH RG++T+   PDGR
Sbjct: 884  RLWDVRTGECTRVLRGHLRGVTTVAVAPDGR 914



 Score = 92.0 bits (227), Expect = 8e-18
 Identities = 46/154 (29%), Positives = 80/154 (51%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G  L+    H+G++  + F     R+  +G  D +  LW  G     +TL GHTS +
Sbjct: 930  ALSGQCLRTLREHTGSIRSVAFAPDG-RLLASGSQDGTAKLWDPGTGRCVATLRGHTSWI 988

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+AF     L+A+GS  G  ++WD    + ++ L+GH     ++ F   G+  ASGS D
Sbjct: 989  RSVAFAPDGGLLASGSQDGTARIWDTRTGECLQILAGHTYLICSVAFSLDGQLLASGSQD 1048

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
              +++W+++   C+ T    T  + ++ F+PDG+
Sbjct: 1049 QTIRLWEVQTGACLRTLTEKTGMVFSLAFSPDGQ 1082



 Score = 89.0 bits (219), Expect = 7e-17
 Identities = 47/127 (37%), Positives = 64/127 (50%)
 Frame = +2

Query: 281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
            R   + G D SV +W         TL  HT  + S+AF     L+A+GS  G  KLWD  
Sbjct: 914  RTLASAGADLSVKIWDALSGQCLRTLREHTGSIRSVAFAPDGRLLASGSQDGTAKLWDPG 973

Query: 461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
              + + TL GH S+  ++ F P G   ASGS D   +IWD R   C+    GHT  I ++
Sbjct: 974  TGRCVATLRGHTSWIRSVAFAPDGGLLASGSQDGTARIWDTRTGECLQILAGHTYLICSV 1033

Query: 641  RFTPDGR 661
             F+ DG+
Sbjct: 1034 AFSLDGQ 1040



 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 46/153 (30%), Positives = 75/153 (49%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G  L     H+G V+ + F      +  + G D +V LW        +TL GHT P+
Sbjct: 678  AATGRCLATLQGHTGVVHSVAFAPDGS-LLASAGQDSTVKLWDAATGRCLATLQGHTEPI 736

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+ F      +A+ S    +KLW+    + + TL+GH  + +A+ F P G   A+GS+D
Sbjct: 737  RSVVFSPDGHRLASASHDRTVKLWNPATGRCLATLAGHGDWVSAVAFAPDGRSLATGSLD 796

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
              +++W+     C+ T + HT  + +I F P G
Sbjct: 797  RTVRLWETITGQCLKTLQEHTDQVFSIAFHPQG 829



 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 50/154 (32%), Positives = 69/154 (44%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A+ G  L     H G V    F      +  + G D +V LW        +TL GHT  V
Sbjct: 636  ARIGQCLATLRGHIGWVRSAAFAPDGS-LLASAGQDSTVKLWDAATGRCLATLQGHTGVV 694

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             S+AF     L+A+      +KLWD    + + TL GH     ++ F P G   AS S D
Sbjct: 695  HSVAFAPDGSLLASAGQDSTVKLWDAATGRCLATLQGHTEPIRSVVFSPDGHRLASASHD 754

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
              +K+W+     C+ T  GH   +S + F PDGR
Sbjct: 755  RTVKLWNPATGRCLATLAGHGDWVSAVAFAPDGR 788



 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 42/124 (33%), Positives = 60/124 (48%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F +   D +V LW        +TL GH   V S AF     L+A+      +KLWD    
Sbjct: 622 FASASQDGTVKLWDARIGQCLATLRGHIGWVRSAAFAPDGSLLASAGQDSTVKLWDAATG 681

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
           + + TL GH     ++ F P G   AS   D+ +K+WD     C+ T +GHT  I ++ F
Sbjct: 682 RCLATLQGHTGVVHSVAFAPDGSLLASAGQDSTVKLWDAATGRCLATLQGHTEPIRSVVF 741

Query: 647 TPDG 658
           +PDG
Sbjct: 742 SPDG 745



 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 41/123 (33%), Positives = 60/123 (48%)
 Frame = +2

Query: 290  LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
            ++G DD  V LW +     T  L GH   V ++A       +A+  +   +K+WD    +
Sbjct: 875  VSGSDDRLVRLWDVRTGECTRVLRGHLRGVTTVAVAPDGRTLASAGADLSVKIWDALSGQ 934

Query: 470  MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFT 649
             +RTL  H     ++ F P G   ASGS D   K+WD     C+ T +GHT  I ++ F 
Sbjct: 935  CLRTLREHTGSIRSVAFAPDGRLLASGSQDGTAKLWDPGTGRCVATLRGHTSWIRSVAFA 994

Query: 650  PDG 658
            PDG
Sbjct: 995  PDG 997



 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 41/121 (33%), Positives = 60/121 (49%), Gaps = 1/121 (0%)
 Frame = +2

Query: 299 GDDHS-VNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMI 475
           GDD+S + LW         +  GHT  V ++AF       A+ S  G +KLWD    + +
Sbjct: 583 GDDNSEIRLWRAADGQQQLSCQGHTDWVCAVAFAPNGQTFASASQDGTVKLWDARIGQCL 642

Query: 476 RTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
            TL GH  +  +  F P G   AS   D+ +K+WD     C+ T +GHT  + ++ F PD
Sbjct: 643 ATLRGHIGWVRSAAFAPDGSLLASAGQDSTVKLWDAATGRCLATLQGHTGVVHSVAFAPD 702

Query: 656 G 658
           G
Sbjct: 703 G 703



 Score = 79.7 bits (195), Expect = 4e-14
 Identities = 41/123 (33%), Positives = 58/123 (47%)
 Frame = +2

Query: 293  TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
            +G    +V LW         TL G T  V ++AF      + +GS   L++LWD+   + 
Sbjct: 834  SGSPTQTVKLWDTESGQCLRTLQGKTVTVLAVAFSPHGQTLVSGSDDRLVRLWDVRTGEC 893

Query: 473  IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
             R L GH    T +   P G   AS   D ++KIWD     C+ T + HT  I ++ F P
Sbjct: 894  TRVLRGHLRGVTTVAVAPDGRTLASAGADLSVKIWDALSGQCLRTLREHTGSIRSVAFAP 953

Query: 653  DGR 661
            DGR
Sbjct: 954  DGR 956



 Score = 78.6 bits (192), Expect = 9e-14
 Identities = 39/125 (31%), Positives = 63/125 (50%)
 Frame = +2

Query: 284  MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
            +  +G  D +  +W          L+GHT  + S+AF     L+A+GS    I+LW+++ 
Sbjct: 999  LLASGSQDGTARIWDTRTGECLQILAGHTYLICSVAFSLDGQLLASGSQDQTIRLWEVQT 1058

Query: 464  TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
               +RTL+       +L F P G+  ASGS D  +K+W +    C+ T   HT  + +I 
Sbjct: 1059 GACLRTLTEKTGMVFSLAFSPDGQILASGSNDMTVKLWQVGTGRCVKTLGPHTSLVVSIA 1118

Query: 644  FTPDG 658
            + PDG
Sbjct: 1119 YAPDG 1123



 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 44/157 (28%), Positives = 73/157 (46%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G  L     H+  +  + F     R+  +   D +V LW+       +TL+GH   V
Sbjct: 720  AATGRCLATLQGHTEPIRSVVFSPDGHRL-ASASHDRTVKLWNPATGRCLATLAGHGDWV 778

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             ++AF      +A GS    ++LW+    + ++TL  H     ++ FHP G   ASGS  
Sbjct: 779  SAVAFAPDGRSLATGSLDRTVRLWETITGQCLKTLQEHTDQVFSIAFHPQGHTLASGSPT 838

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
              +K+WD     C+ T +G T  +  + F+P G+ +V
Sbjct: 839  QTVKLWDTESGQCLRTLQGKTVTVLAVAFSPHGQTLV 875



 Score = 66.6 bits (161), Expect = 4e-10
 Identities = 33/94 (35%), Positives = 48/94 (51%)
 Frame = +2

Query: 377 VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM 556
           V S+AF      +A G  +  I+LW   D +   +  GH  +  A+ F P G+ FAS S 
Sbjct: 568 VFSVAFSPDGEQIAVGDDNSEIRLWRAADGQQQLSCQGHTDWVCAVAFAPNGQTFASASQ 627

Query: 557 DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           D  +K+WD R   C+ T +GH   + +  F PDG
Sbjct: 628 DGTVKLWDARIGQCLATLRGHIGWVRSAAFAPDG 661



 Score = 63.5 bits (153), Expect = 3e-09
 Identities = 29/110 (26%), Positives = 56/110 (50%)
 Frame = +2

Query: 281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
            ++  +G  D ++ LW +       TL+  T  V S+AF     ++A+GS+   +KLW + 
Sbjct: 1040 QLLASGSQDQTIRLWEVQTGACLRTLTEKTGMVFSLAFSPDGQILASGSNDMTVKLWQVG 1099

Query: 461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTY 610
              + ++TL  H S   ++ + P G   AS S+D  ++++D     C+  +
Sbjct: 1100 TGRCVKTLGPHTSLVVSIAYAPDGSTLASASLDETIRLFDPATGACLRRF 1149



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 29/98 (29%), Positives = 45/98 (45%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  L+     +G V  L F     ++  +G +D +V LW +G      TL  HTS V SI
Sbjct: 1059 GACLRTLTEKTGMVFSLAFSPDG-QILASGSNDMTVKLWQVGTGRCVKTLGPHTSLVVSI 1117

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSY 502
            A+      +A+ S    I+L+D      +R  +  R+Y
Sbjct: 1118 AYAPDGSTLASASLDETIRLFDPATGACLRRFTVERTY 1155



>pir|AE1861|AE1861 serine/threonine kinase with WD-40 repeat
           [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_681430 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 677

 Score = 96.3 bits (238), Expect = 4e-19
 Identities = 50/152 (32%), Positives = 82/152 (53%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           K G  ++    HS  V+ L       +  ++G DD++V +W++      +TL+GHT  V 
Sbjct: 466 KTGKVIRTITGHSDAVHTLAISPNG-KTLVSGSDDNTVKVWNLNTGRLINTLTGHTFWVR 524

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
           S+A     + +A+GS    +K+W+LE   +  TL+G+    T++ F+P G   AS S D 
Sbjct: 525 SVAISPDGVNIASGSFDKTVKIWNLETGTLTHTLAGNGETVTSIAFNPDGNTLASASRDR 584

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
            +KIW +     + T KG T  I++I F+PDG
Sbjct: 585 TIKIWKVGAGTRVRTLKGSTETITSIAFSPDG 616



 Score = 92.0 bits (227), Expect = 8e-18
 Identities = 44/150 (29%), Positives = 78/150 (52%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  +     HS  VN + F     +  ++GGDD+++ +W++       T++GH+  V ++
Sbjct: 426 GEDISSLKGHSRKVNAVVFSPDG-KTLVSGGDDNTIKIWNLKTGKVIRTITGHSDAVHTL 484

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           A       + +GS    +K+W+L   ++I TL+GH  +  ++   P G   ASGS D  +
Sbjct: 485 AISPNGKTLVSGSDDNTVKVWNLNTGRLINTLTGHTFWVRSVAISPDGVNIASGSFDKTV 544

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           KIW++      HT  G+   +++I F PDG
Sbjct: 545 KIWNLETGTLTHTLAGNGETVTSIAFNPDG 574



 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 43/122 (35%), Positives = 66/122 (54%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +G  D +V +W++   T T TL+G+   V SIAF+     +A+ S    IK+W +     
Sbjct: 537 SGSFDKTVKIWNLETGTLTHTLAGNGETVTSIAFNPDGNTLASASRDRTIKIWKVGAGTR 596

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           +RTL G     T++ F P G   AS S D  +K+W++     I T +GH   ++T+ FTP
Sbjct: 597 VRTLKGSTETITSIAFSPDGNTLASASRDQTIKLWNLETGKEIRTLEGHENTVTTVAFTP 656

Query: 653 DG 658
           DG
Sbjct: 657 DG 658



 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 37/120 (30%), Positives = 63/120 (52%)
 Frame = +2

Query: 299 GDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIR 478
           G D ++ +W +      S+L GH+  V ++ F      + +G     IK+W+L+  K+IR
Sbjct: 413 GSDRTIKIWQLATGEDISSLKGHSRKVNAVVFSPDGKTLVSGGDDNTIKIWNLKTGKVIR 472

Query: 479 TLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           T++GH      L   P G+   SGS D  +K+W++     I+T  GHT  + ++  +PDG
Sbjct: 473 TITGHSDAVHTLAISPNGKTLVSGSDDNTVKVWNLNTGRLINTLTGHTFWVRSVAISPDG 532



 Score = 75.5 bits (184), Expect = 8e-13
 Identities = 38/93 (40%), Positives = 50/93 (53%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D ++ +W +G  T   TL G T  + SIAF      +A+ S    IKLW+LE  K IRTL
Sbjct: 583 DRTIKIWKVGAGTRVRTLKGSTETITSIAFSPDGNTLASASRDQTIKLWNLETGKEIRTL 642

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
            GH +  T + F P G    SGS D  ++IW I
Sbjct: 643 EGHENTVTTVAFTPDGANLVSGSGDNTMRIWRI 675



 Score = 62.8 bits (151), Expect = 5e-09
 Identities = 37/116 (31%), Positives = 60/116 (51%), Gaps = 6/116 (5%)
 Frame = +2

Query: 341 TSTSTLS-GHTSPVESIAFDSAEI-----LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSY 502
           T+  T+S  +T P +  AF S  I     ++A+  S   IK+W L   + I +L GH   
Sbjct: 379 TTLRTISLANTLPDDENAFVSLAISPNGQIIASCGSDRTIKIWQLATGEDISSLKGHSRK 438

Query: 503 CTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
             A+ F P G+   SG  D  +KIW+++    I T  GH+  + T+  +P+G+ +V
Sbjct: 439 VNAVVFSPDGKTLVSGGDDNTIKIWNLKTGKVIRTITGHSDAVHTLAISPNGKTLV 494



>pir|AE1810|AE1810 WD-40 repeat protein [imported] - Nostoc sp.
            (strain PCC 7120)>gb:BA000019_681021 Nostoc sp. PCC 7120
            DNA, complete genome.
          Length = 1227

 Score = 95.5 bits (236), Expect = 7e-19
 Identities = 51/149 (34%), Positives = 77/149 (51%), Gaps = 1/149 (0%)
 Frame = +2

Query: 218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
            LQ+   HS  V  + F     R+  +G  D  + +W +       TL+     + S+AF 
Sbjct: 1021 LQKLKGHSHWVWTVAFSPDG-RILASGSADSEIKIWDVASGKCLQTLTDPQGMIWSVAFS 1079

Query: 398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                L+A+ S    +KLW+L+  + + TL GH     ++ F P G+  ASGS DT +K+W
Sbjct: 1080 LDGTLLASASEDQTVKLWNLKTGECVHTLKGHEKQVYSVAFSPNGQIAASGSEDTTVKLW 1139

Query: 578  DIRKKGCIHTYK-GHTRGISTIRFTPDGR 661
            DI    C+ T K GHT  I ++ F+PDGR
Sbjct: 1140 DISTGSCVDTLKHGHTAAIRSVAFSPDGR 1168



 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 47/130 (36%), Positives = 74/130 (56%), Gaps = 3/130 (2%)
 Frame = +2

Query: 281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
            ++  +G DD+++ LW++ K      L GH   + S+AF     ++A+GS+   IKLWD+ 
Sbjct: 913  QILASGRDDYTIGLWNL-KTGECHPLRGHQGRIRSVAFHPDGKILASGSADNTIKLWDIS 971

Query: 461  DT---KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGI 631
            DT   K IRTL+GH ++   + F P     AS S D  +++WD     C+   KGH+  +
Sbjct: 972  DTNHSKYIRTLTGHTNWVWTVVFSPDKHTLASSSEDRTIRLWDKDTGDCLQKLKGHSHWV 1031

Query: 632  STIRFTPDGR 661
             T+ F+PDGR
Sbjct: 1032 WTVAFSPDGR 1041



 Score = 91.3 bits (225), Expect = 1e-17
 Identities = 42/131 (32%), Positives = 72/131 (54%), Gaps = 4/131 (3%)
 Frame = +2

Query: 281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAF----DSAEILVAAGSSSGLIKL 448
            R+  +   D ++ LW I       TL GH   V S+ F    D   +L+A+ S+   IKL
Sbjct: 699  RILASASQDQTIKLWDIATGNCQQTLIGHDDWVWSVTFSPVTDDRPLLLASSSADQHIKL 758

Query: 449  WDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRG 628
            WD+   K ++TL GH     ++ F P G+  AS   D+ +++WD++   C   ++GH++ 
Sbjct: 759  WDVATGKCLKTLKGHTREVHSVSFSPDGQTLASSGEDSTVRLWDVKTGQCWQIFEGHSKK 818

Query: 629  ISTIRFTPDGR 661
            + ++RF+PDG+
Sbjct: 819  VYSVRFSPDGQ 829



 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 37/122 (30%), Positives = 64/122 (52%)
 Frame = +2

Query: 305  DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
            D  + LW +       TL GHT  V S++F      +A+      ++LWD++  +  +  
Sbjct: 753  DQHIKLWDVATGKCLKTLKGHTREVHSVSFSPDGQTLASSGEDSTVRLWDVKTGQCWQIF 812

Query: 485  SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
             GH     ++ F P G+  AS   D ++K+WDI++  C++T  GH+  +  I F+PDGR 
Sbjct: 813  EGHSKKVYSVRFSPDGQTLASCGEDRSIKLWDIQRGECVNTLWGHSSQVWAIAFSPDGRT 872

Query: 665  VV 670
            ++
Sbjct: 873  LI 874



 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 36/123 (29%), Positives = 68/123 (55%)
 Frame = +2

Query: 293  TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
            +  +D ++ LW          L GH+  V ++AF     ++A+GS+   IK+WD+   K 
Sbjct: 1003 SSSEDRTIRLWDKDTGDCLQKLKGHSHWVWTVAFSPDGRILASGSADSEIKIWDVASGKC 1062

Query: 473  IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
            ++TL+  +    ++ F   G   AS S D  +K+W+++   C+HT KGH + + ++ F+P
Sbjct: 1063 LQTLTDPQGMIWSVAFSLDGTLLASASEDQTVKLWNLKTGECVHTLKGHEKQVYSVAFSP 1122

Query: 653  DGR 661
            +G+
Sbjct: 1123 NGQ 1125



 Score = 78.6 bits (192), Expect = 9e-14
 Identities = 42/144 (29%), Positives = 71/144 (49%), Gaps = 3/144 (2%)
 Frame = +2

Query: 236  HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTS---TLSGHTSPVESIAFDSAE 406
            H G +  + F     ++  +G  D+++ LW I     +    TL+GHT+ V ++ F   +
Sbjct: 940  HQGRIRSVAFHPDG-KILASGSADNTIKLWDISDTNHSKYIRTLTGHTNWVWTVVFSPDK 998

Query: 407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
              +A+ S    I+LWD +    ++ L GH  +   + F P G   ASGS D+ +KIWD+ 
Sbjct: 999  HTLASSSEDRTIRLWDKDTGDCLQKLKGHSHWVWTVAFSPDGRILASGSADSEIKIWDVA 1058

Query: 587  KKGCIHTYKGHTRGISTIRFTPDG 658
               C+ T       I ++ F+ DG
Sbjct: 1059 SGKCLQTLTDPQGMIWSVAFSLDG 1082



 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 39/124 (31%), Positives = 62/124 (50%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
           + F TG  +  + LW            GHT+ V + AF     ++A+GS+   IKLWD+ 
Sbjct: 615 KYFATGLMNGEIRLWQTSDNKQLRIYKGHTAWVWAFAFSPDSRMLASGSADSTIKLWDVH 674

Query: 461 DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
             + ++TLS + +   ++ F P G   AS S D  +K+WDI    C  T  GH   + ++
Sbjct: 675 TGECLKTLSKNTNKVYSVAFSPDGRILASASQDQTIKLWDIATGNCQQTLIGHDDWVWSV 734

Query: 641 RFTP 652
            F+P
Sbjct: 735 TFSP 738



 Score = 75.9 bits (185), Expect = 6e-13
 Identities = 46/153 (30%), Positives = 73/153 (47%)
 Frame = +2

Query: 203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
            K G   Q F  HS  V  +RF     +   + G+D S+ LW I +    +TL GH+S V 
Sbjct: 804  KTGQCWQIFEGHSKKVYSVRFSPDG-QTLASCGEDRSIKLWDIQRGECVNTLWGHSSQVW 862

Query: 383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
            +IAF      + + S     +LWD+     +  L G+     ++ F P  +  ASG  D 
Sbjct: 863  AIAFSPDGRTLISCSDDQTARLWDVITGNSLNILRGYTRDVYSVAFSPDSQILASGRDDY 922

Query: 563  NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
             + +W+++   C H  +GH   I ++ F PDG+
Sbjct: 923  TIGLWNLKTGEC-HPLRGHQGRIRSVAFHPDGK 954



 Score = 75.9 bits (185), Expect = 6e-13
 Identities = 41/151 (27%), Positives = 71/151 (47%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  L+    H+  V+ + F     +   + G+D +V LW +          GH+  V S+
Sbjct: 764  GKCLKTLKGHTREVHSVSFSPDG-QTLASSGEDSTVRLWDVKTGQCWQIFEGHSKKVYSV 822

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
             F      +A+      IKLWD++  + + TL GH S   A+ F P G    S S D   
Sbjct: 823  RFSPDGQTLASCGEDRSIKLWDIQRGECVNTLWGHSSQVWAIAFSPDGRTLISCSDDQTA 882

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
            ++WD+     ++  +G+TR + ++ F+PD +
Sbjct: 883  RLWDVITGNSLNILRGYTRDVYSVAFSPDSQ 913



 Score = 73.2 bits (178), Expect = 4e-12
 Identities = 34/97 (35%), Positives = 50/97 (51%)
 Frame = +2

Query: 371 SPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASG 550
           S V S+ F       A G  +G I+LW   D K +R   GH ++  A  F P     ASG
Sbjct: 603 SSVVSVKFSPDGKYFATGLMNGEIRLWQTSDNKQLRIYKGHTAWVWAFAFSPDSRMLASG 662

Query: 551 SMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
           S D+ +K+WD+    C+ T   +T  + ++ F+PDGR
Sbjct: 663 SADSTIKLWDVHTGECLKTLSKNTNKVYSVAFSPDGR 699



 Score = 70.5 bits (171), Expect = 3e-11
 Identities = 35/111 (31%), Positives = 56/111 (50%), Gaps = 1/111 (0%)
 Frame = +2

Query: 284  MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
            +  +  +D +V LW++       TL GH   V S+AF     + A+GS    +KLWD+  
Sbjct: 1084 LLASASEDQTVKLWNLKTGECVHTLKGHEKQVYSVAFSPNGQIAASGSEDTTVKLWDIST 1143

Query: 464  TKMIRTLS-GHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYK 613
               + TL  GH +   ++ F P G   ASGS D  +++WD++    + T K
Sbjct: 1144 GSCVDTLKHGHTAAIRSVAFSPDGRLLASGSEDEKIQLWDMQNCSRLKTLK 1194



 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 1/71 (1%)
 Frame = +2

Query: 293  TGGDDHSVNLWSIGKPTSTSTLS-GHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
            +G +D +V LW I   +   TL  GHT+ + S+AF     L+A+GS    I+LWD+++  
Sbjct: 1129 SGSEDTTVKLWDISTGSCVDTLKHGHTAAIRSVAFSPDGRLLASGSEDEKIQLWDMQNCS 1188

Query: 470  MIRTLSGHRSY 502
             ++TL   R Y
Sbjct: 1189 RLKTLKSPRLY 1199



>sp|Q8YV57|YL24_ANASP Hypothetical WD-repeat protein
            all2124.>pir|AF2071|AF2071 WD-40 repeat protein
            [imported] - Nostoc sp. (strain PCC
            7120)>gb:BA000019_683113 Nostoc sp. PCC 7120 DNA,
            complete genome.
          Length = 1683

 Score = 95.1 bits (235), Expect = 1e-18
 Identities = 48/151 (31%), Positives = 76/151 (50%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  L+    H   VN + F     +   +   DHS+ LW         TL+GH++ V ++
Sbjct: 1145 GTLLKTITGHEQTVNNVYFSPDG-KNLASASSDHSIKLWDTTSGQLLMTLTGHSAGVITV 1203

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
             F      +AAGS    +KLW  +D K+++TL+GH+ +  +L F P G+  AS S D  +
Sbjct: 1204 RFSPDGQTIAAGSEDKTVKLWHRQDGKLLKTLNGHQDWVNSLSFSPDGKTLASASADKTI 1263

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
            K+W I     + T KGH   +  + F+ DG+
Sbjct: 1264 KLWRIADGKLVKTLKGHNDSVWDVNFSSDGK 1294



 Score = 89.7 bits (221), Expect = 4e-17
 Identities = 44/153 (28%), Positives = 76/153 (49%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  L+  + H   VN + F     +   +   D++V LW++       TL GHT  V  +
Sbjct: 1436 GKALKTLIGHDNEVNKVNFSPDG-KTLASASRDNTVKLWNVSDGKFKKTLKGHTDEVFWV 1494

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            +F     ++A+ S+   I+LWD     +I++L  H     ++ F+P G   AS S D  +
Sbjct: 1495 SFSPDGKIIASASADKTIRLWDSFSGNLIKSLPAHNDLVYSVNFNPDGSMLASTSADKTV 1554

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            K+W       +HT+ GH+  + +  F+PDGR++
Sbjct: 1555 KLWRSHDGHLLHTFSGHSNVVYSSSFSPDGRYI 1587



 Score = 86.7 bits (213), Expect = 3e-16
 Identities = 43/125 (34%), Positives = 68/125 (54%)
 Frame = +2

Query: 293  TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
            +G  D ++ LWS        TL+GH   V S++F      +A+G S   IKLW   D  +
Sbjct: 1089 SGSLDKTIKLWS-RDGRLFRTLNGHEDAVYSVSFSPDGQTIASGGSDKTIKLWQTSDGTL 1147

Query: 473  IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
            ++T++GH      + F P G+  AS S D ++K+WD      + T  GH+ G+ T+RF+P
Sbjct: 1148 LKTITGHEQTVNNVYFSPDGKNLASASSDHSIKLWDTTSGQLLMTLTGHSAGVITVRFSP 1207

Query: 653  DGRWV 667
            DG+ +
Sbjct: 1208 DGQTI 1212



 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 39/123 (31%), Positives = 66/123 (53%)
 Frame = +2

Query: 293  TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
            +GG D ++ LW     T   T++GH   V ++ F      +A+ SS   IKLWD    ++
Sbjct: 1130 SGGSDKTIKLWQTSDGTLLKTITGHEQTVNNVYFSPDGKNLASASSDHSIKLWDTTSGQL 1189

Query: 473  IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
            + TL+GH +    + F P G+  A+GS D  +K+W  +    + T  GH   ++++ F+P
Sbjct: 1190 LMTLTGHSAGVITVRFSPDGQTIAAGSEDKTVKLWHRQDGKLLKTLNGHQDWVNSLSFSP 1249

Query: 653  DGR 661
            DG+
Sbjct: 1250 DGK 1252



 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 47/149 (31%), Positives = 71/149 (47%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  L     HS  V  +RF     +    G +D +V LW         TL+GH   V S+
Sbjct: 1187 GQLLMTLTGHSAGVITVRFSPDG-QTIAAGSEDKTVKLWHRQDGKLLKTLNGHQDWVNSL 1245

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            +F      +A+ S+   IKLW + D K+++TL GH      + F   G+  AS S D  +
Sbjct: 1246 SFSPDGKTLASASADKTIKLWRIADGKLVKTLKGHNDSVWDVNFSSDGKAIASASRDNTI 1305

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
            K+W+ R    + T+ GH+ G+  + F PD
Sbjct: 1306 KLWN-RHGIELETFTGHSGGVYAVNFLPD 1333



 Score = 75.5 bits (184), Expect = 8e-13
 Identities = 38/123 (30%), Positives = 65/123 (52%)
 Frame = +2

Query: 293  TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
            T G D ++ LW     +   TL G+ + +  I+F     L+A+ ++   +K+W + D K 
Sbjct: 1380 TAGADGNIQLWHSQDGSLLKTLPGNKA-IYGISFTPQGDLIASANADKTVKIWRVRDGKA 1438

Query: 473  IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
            ++TL GH +    + F P G+  AS S D  +K+W++       T KGHT  +  + F+P
Sbjct: 1439 LKTLIGHDNEVNKVNFSPDGKTLASASRDNTVKLWNVSDGKFKKTLKGHTDEVFWVSFSP 1498

Query: 653  DGR 661
            DG+
Sbjct: 1499 DGK 1501



 Score = 73.2 bits (178), Expect = 4e-12
 Identities = 35/118 (29%), Positives = 56/118 (47%)
 Frame = +2

Query: 305  DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
            D +V +W +    +  TL GH + V  + F      +A+ S    +KLW++ D K  +TL
Sbjct: 1425 DKTVKIWRVRDGKALKTLIGHDNEVNKVNFSPDGKTLASASRDNTVKLWNVSDGKFKKTL 1484

Query: 485  SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
             GH      + F P G+  AS S D  +++WD      I +   H   + ++ F PDG
Sbjct: 1485 KGHTDEVFWVSFSPDGKIIASASADKTIRLWDSFSGNLIKSLPAHNDLVYSVNFNPDG 1542



 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 35/102 (34%), Positives = 53/102 (51%)
 Frame = +2

Query: 356  LSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGE 535
            L GH   V SI+       +A+GS    IKLW   D ++ RTL+GH     ++ F P G+
Sbjct: 1068 LEGHKDGVISISISRDGQTIASGSLDKTIKLWS-RDGRLFRTLNGHEDAVYSVSFSPDGQ 1126

Query: 536  FFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
              ASG  D  +K+W       + T  GH + ++ + F+PDG+
Sbjct: 1127 TIASGGSDKTIKLWQTSDGTLLKTITGHEQTVNNVYFSPDGK 1168



 Score = 68.2 bits (165), Expect = 1e-10
 Identities = 36/130 (27%), Positives = 62/130 (47%)
 Frame = +2

Query: 281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
            ++  +   D ++ LW         +L  H   V S+ F+    ++A+ S+   +KLW   
Sbjct: 1501 KIIASASADKTIRLWDSFSGNLIKSLPAHNDLVYSVNFNPDGSMLASTSADKTVKLWRSH 1560

Query: 461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
            D  ++ T SGH +   +  F P G + AS S D  +KIW I     + T   H  G+ + 
Sbjct: 1561 DGHLLHTFSGHSNVVYSSSFSPDGRYIASASEDKTVKIWQI-DGHLLTTLPQHQAGVMSA 1619

Query: 641  RFTPDGRWVV 670
             F+PDG+ ++
Sbjct: 1620 IFSPDGKTLI 1629



 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 40/150 (26%), Positives = 62/150 (41%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  L+    H   VN L F     +   +   D ++ LW I       TL GH   V  +
Sbjct: 1229 GKLLKTLNGHQDWVNSLSFSPDG-KTLASASADKTIKLWRIADGKLVKTLKGHNDSVWDV 1287

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
             F S    +A+ S    IKLW+    ++  T +GH     A+ F P     AS S+D  +
Sbjct: 1288 NFSSDGKAIASASRDNTIKLWNRHGIEL-ETFTGHSGGVYAVNFLPDSNIIASASLDNTI 1346

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
            ++W       +    G++ G+  + F  DG
Sbjct: 1347 RLWQRPLISPLEVLAGNS-GVYAVSFLHDG 1375



 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 36/123 (29%), Positives = 57/123 (46%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  ++   AH+  V  + F      +  T  D  +V LW         T SGH++ V S 
Sbjct: 1520 GNLIKSLPAHNDLVYSVNFNPDGSMLASTSADK-TVKLWRSHDGHLLHTFSGHSNVVYSS 1578

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            +F      +A+ S    +K+W + D  ++ TL  H++   +  F P G+   SGS+DT  
Sbjct: 1579 SFSPDGRYIASASEDKTVKIWQI-DGHLLTTLPQHQAGVMSAIFSPDGKTLISGSLDTTT 1637

Query: 569  KIW 577
            KIW
Sbjct: 1638 KIW 1640



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 19/62 (30%), Positives = 32/62 (51%)
 Frame = +2

Query: 482  LSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
            L GH+    ++     G+  ASGS+D  +K+W  R      T  GH   + ++ F+PDG+
Sbjct: 1068 LEGHKDGVISISISRDGQTIASGSLDKTIKLWS-RDGRLFRTLNGHEDAVYSVSFSPDGQ 1126

Query: 662  WV 667
             +
Sbjct: 1127 TI 1128



>sp|Q8YTC2|YS00_ANASP Hypothetical WD-repeat protein
            alr2800.>pir|AI2155|AI2155 WD-repeat protein [imported] -
            Nostoc sp. (strain PCC 7120)>gb:BA000019_683789 Nostoc
            sp. PCC 7120 DNA, complete genome.
          Length = 1258

 Score = 94.0 bits (232), Expect = 2e-18
 Identities = 46/151 (30%), Positives = 75/151 (49%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  LQ    H+  V C+ F         +   DH++ LW + +     TL  HT  V S+
Sbjct: 758  GTCLQTLTGHTDWVRCVAFSPDG-NTLASSAADHTIKLWDVSQGKCLRTLKSHTGWVRSV 816

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            AF +    +A+GS    IK+W+    + ++T  GH +   ++ + P  +   SGS D  +
Sbjct: 817  AFSADGQTLASGSGDRTIKIWNYHTGECLKTYIGHTNSVYSIAYSPDSKILVSGSGDRTI 876

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
            K+WD +   CI T  GHT  + ++ F+PDG+
Sbjct: 877  KLWDCQTHICIKTLHGHTNEVCSVAFSPDGQ 907



 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 43/121 (35%), Positives = 67/121 (55%)
 Frame = +2

Query: 299  GDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIR 478
            G D +V LWS+       TL+GH   V S+AF      +A+ S    IKLWD++D   ++
Sbjct: 703  GADENVKLWSVRDGVCIKTLTGHEHEVFSVAFHPDGETLASASGDKTIKLWDIQDGTCLQ 762

Query: 479  TLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
            TL+GH  +   + F P G   AS + D  +K+WD+ +  C+ T K HT  + ++ F+ DG
Sbjct: 763  TLTGHTDWVRCVAFSPDGNTLASSAADHTIKLWDVSQGKCLRTLKSHTGWVRSVAFSADG 822

Query: 659  R 661
            +
Sbjct: 823  Q 823



 Score = 92.4 bits (228), Expect = 6e-18
 Identities = 44/122 (36%), Positives = 67/122 (54%)
 Frame = +2

Query: 305  DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
            D ++ LW I   T   TL+GHT  V  +AF      +A+ ++   IKLWD+   K +RTL
Sbjct: 747  DKTIKLWDIQDGTCLQTLTGHTDWVRCVAFSPDGNTLASSAADHTIKLWDVSQGKCLRTL 806

Query: 485  SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
              H  +  ++ F   G+  ASGS D  +KIW+     C+ TY GHT  + +I ++PD + 
Sbjct: 807  KSHTGWVRSVAFSADGQTLASGSGDRTIKIWNYHTGECLKTYIGHTNSVYSIAYSPDSKI 866

Query: 665  VV 670
            +V
Sbjct: 867  LV 868



 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 42/129 (32%), Positives = 67/129 (51%)
 Frame = +2

Query: 281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
            ++  +   D SV LW          L GH++ V S  F     ++A  S+   +K+WD +
Sbjct: 1075 QLLASASADQSVRLWDCCTGRCVGILRGHSNRVYSAIFSPNGEIIATCSTDQTVKIWDWQ 1134

Query: 461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
              K ++TL+GH ++   + F P G+  AS S D  ++IWD+    C H   GHT  +S++
Sbjct: 1135 QGKCLKTLTGHTNWVFDIAFSPDGKILASASHDQTVRIWDVNTGKCHHICIGHTHLVSSV 1194

Query: 641  RFTPDGRWV 667
             F+PDG  V
Sbjct: 1195 AFSPDGEVV 1203



 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 47/145 (32%), Positives = 71/145 (48%), Gaps = 1/145 (0%)
 Frame = +2

Query: 227  FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD-SA 403
            F    GN+    F  +  ++  T   D  V +W +          GH++ V  + F    
Sbjct: 638  FTETLGNILSAAFSPEG-QLLATCDTDCHVRVWEVKSGKLLLICRGHSNWVRFVVFSPDG 696

Query: 404  EILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
            EIL + G+    +KLW + D   I+TL+GH     ++ FHP GE  AS S D  +K+WDI
Sbjct: 697  EILASCGADEN-VKLWSVRDGVCIKTLTGHEHEVFSVAFHPDGETLASASGDKTIKLWDI 755

Query: 584  RKKGCIHTYKGHTRGISTIRFTPDG 658
            +   C+ T  GHT  +  + F+PDG
Sbjct: 756  QDGTCLQTLTGHTDWVRCVAFSPDG 780



 Score = 82.4 bits (202), Expect = 6e-15
 Identities = 42/127 (33%), Positives = 67/127 (52%)
 Frame = +2

Query: 281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
            ++  TG  D +V LW+I       TLS H+  +  +A+     L+A+ S+   ++LWD  
Sbjct: 1033 KIIATGSADCTVKLWNISTGQCLKTLSEHSDKILGMAWSPDGQLLASASADQSVRLWDCC 1092

Query: 461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
              + +  L GH +   +  F P GE  A+ S D  +KIWD ++  C+ T  GHT  +  I
Sbjct: 1093 TGRCVGILRGHSNRVYSAIFSPNGEIIATCSTDQTVKIWDWQQGKCLKTLTGHTNWVFDI 1152

Query: 641  RFTPDGR 661
             F+PDG+
Sbjct: 1153 AFSPDGK 1159



 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 43/150 (28%), Positives = 76/150 (50%)
 Frame = +2

Query: 206  RGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVES 385
            +G  L+   +H+G V  + F     +   +G  D ++ +W+        T  GHT+ V S
Sbjct: 799  QGKCLRTLKSHTGWVRSVAFSADG-QTLASGSGDRTIKIWNYHTGECLKTYIGHTNSVYS 857

Query: 386  IAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTN 565
            IA+     ++ +GS    IKLWD +    I+TL GH +   ++ F P G+  A  S+D +
Sbjct: 858  IAYSPDSKILVSGSGDRTIKLWDCQTHICIKTLHGHTNEVCSVAFSPDGQTLACVSLDQS 917

Query: 566  LKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
            +++W+ R   C+  + G+T     + F+PD
Sbjct: 918  VRLWNCRTGQCLKAWYGNTDWALPVAFSPD 947



 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 38/127 (29%), Positives = 67/127 (52%)
 Frame = +2

Query: 281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
            ++  +G +D +V LW        S+L GHT  +  IAF      +A+ S+   ++LW++ 
Sbjct: 949  QILASGSNDKTVKLWDWQTGKYISSLEGHTDFIYGIAFSPDSQTLASASTDSSVRLWNIS 1008

Query: 461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
              +  + L  H  +  A+ FHP G+  A+GS D  +K+W+I    C+ T   H+  I  +
Sbjct: 1009 TGQCFQILLEHTDWVYAVVFHPQGKIIATGSADCTVKLWNISTGQCLKTLSEHSDKILGM 1068

Query: 641  RFTPDGR 661
             ++PDG+
Sbjct: 1069 AWSPDGQ 1075



 Score = 75.9 bits (185), Expect = 6e-13
 Identities = 41/151 (27%), Positives = 75/151 (49%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  L+ ++ H+ +V  + +   + ++ ++G  D ++ LW         TL GHT+ V S+
Sbjct: 842  GECLKTYIGHTNSVYSIAYSPDS-KILVSGSGDRTIKLWDCQTHICIKTLHGHTNEVCSV 900

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            AF      +A  S    ++LW+    + ++   G+  +   + F P  +  ASGS D  +
Sbjct: 901  AFSPDGQTLACVSLDQSVRLWNCRTGQCLKAWYGNTDWALPVAFSPDRQILASGSNDKTV 960

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
            K+WD +    I + +GHT  I  I F+PD +
Sbjct: 961  KLWDWQTGKYISSLEGHTDFIYGIAFSPDSQ 991



 Score = 73.9 bits (180), Expect = 2e-12
 Identities = 35/118 (29%), Positives = 61/118 (51%)
 Frame = +2

Query: 305  DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
            D SV LW+I        L  HT  V ++ F     ++A GS+   +KLW++   + ++TL
Sbjct: 999  DSSVRLWNISTGQCFQILLEHTDWVYAVVFHPQGKIIATGSADCTVKLWNISTGQCLKTL 1058

Query: 485  SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
            S H      + + P G+  AS S D ++++WD     C+   +GH+  + +  F+P+G
Sbjct: 1059 SEHSDKILGMAWSPDGQLLASASADQSVRLWDCCTGRCVGILRGHSNRVYSAIFSPNG 1116



 Score = 70.5 bits (171), Expect = 3e-11
 Identities = 35/119 (29%), Positives = 57/119 (47%)
 Frame = +2

Query: 305  DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
            D SV LW+           G+T     +AF     ++A+GS+   +KLWD +  K I +L
Sbjct: 915  DQSVRLWNCRTGQCLKAWYGNTDWALPVAFSPDRQILASGSNDKTVKLWDWQTGKYISSL 974

Query: 485  SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
             GH  +   + F P  +  AS S D+++++W+I    C      HT  +  + F P G+
Sbjct: 975  EGHTDFIYGIAFSPDSQTLASASTDSSVRLWNISTGQCFQILLEHTDWVYAVVFHPQGK 1033



 Score = 65.9 bits (159), Expect = 6e-10
 Identities = 32/103 (31%), Positives = 53/103 (51%)
 Frame = +2

Query: 293  TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
            T   D +V +W   +     TL+GHT+ V  IAF     ++A+ S    +++WD+   K 
Sbjct: 1121 TCSTDQTVKIWDWQQGKCLKTLTGHTNWVFDIAFSPDGKILASASHDQTVRIWDVNTGKC 1180

Query: 473  IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCI 601
                 GH    +++ F P GE  ASGS D  ++IW+++   C+
Sbjct: 1181 HHICIGHTHLVSSVAFSPDGEVVASGSQDQTVRIWNVKTGECL 1223



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 23/100 (23%), Positives = 46/100 (46%)
 Frame = +2

Query: 203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
            ++G  L+    H+  V  + F     ++  +   D +V +W +          GHT  V 
Sbjct: 1134 QQGKCLKTLTGHTNWVFDIAFSPDG-KILASASHDQTVRIWDVNTGKCHHICIGHTHLVS 1192

Query: 383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSY 502
            S+AF     +VA+GS    +++W+++  + ++ L   R Y
Sbjct: 1193 SVAFSPDGEVVASGSQDQTVRIWNVKTGECLQILRAKRLY 1232



>gb:CR382136_1669275 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 667

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 45/147 (30%), Positives = 80/147 (54%)
 Frame = +2

Query: 212 YKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIA 391
           YK++ F  H+  V CL+F +K     +TG  D++V +W +       TL+GHT P+ S+ 
Sbjct: 337 YKIKTFEGHTDGVTCLQFNRK---YLMTGSYDNTVKIWKVETGECLRTLTGHTKPIRSLV 393

Query: 392 FDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLK 571
           FDS +++   G     IK+W+    + I T  GH +   +++F    +   SGS D  +K
Sbjct: 394 FDSQKLI--TGGLDSTIKVWNYHTGECISTYRGHDAAVVSVDF--LKKTIVSGSADHTVK 449

Query: 572 IWDIRKKGCIHTYKGHTRGISTIRFTP 652
           +W +  + C +T +GHT  +++++  P
Sbjct: 450 VWHVDSRTC-YTLRGHTDWVNSVKIHP 475



 Score = 44.7 bits (104), Expect = 0.001
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 4/78 (5%)
 Frame = +2

Query: 425 SSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIH 604
           S    IKLWD++  K IRT  GH     ++    F     SG+ D  +K+WD++   C+H
Sbjct: 577 SLDNTIKLWDVKTGKCIRTQFGHIEGVWSISADTFR--IISGAHDRLIKVWDLQNGKCLH 634

Query: 605 TYKGHT----RGISTIRF 646
           T+  ++     G+S  RF
Sbjct: 635 TFGNNSIVSCVGLSDSRF 652



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 22/68 (32%), Positives = 36/68 (52%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           LT   D+++ LW +       T  GH   V SI+ D+  I+  +G+   LIK+WDL++ K
Sbjct: 574 LTSSLDNTIKLWDVKTGKCIRTQFGHIEGVWSISADTFRII--SGAHDRLIKVWDLQNGK 631

Query: 470 MIRTLSGH 493
            + T   +
Sbjct: 632 CLHTFGNN 639



 Score = 34.3 bits (77), Expect = 2.0
 Identities = 12/32 (37%), Positives = 20/32 (62%)
 Frame = +2

Query: 545 SGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
           + S+D  +K+WD++   CI T  GH  G+ +I
Sbjct: 575 TSSLDNTIKLWDVKTGKCIRTQFGHIEGVWSI 606



>gb:BA000045_742896 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1193

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 46/127 (36%), Positives = 67/127 (52%)
 Frame = +2

Query: 281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
            R   +GG D +V LW         +  GH+S + S+AF      +A+G    LIKLWD+ 
Sbjct: 748  RSIASGGADRTVRLWEAATGECRKSFPGHSSLIWSVAFSPDGQSLASGGQDALIKLWDVA 807

Query: 461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
              +  R L GH +   A+ F P G+  ASGS D  +++W      C  T +G+T GI ++
Sbjct: 808  TAQCRRILQGHTNLVYAVAFSPDGQTLASGSADQAVRLWKTDTGQCRKTIQGYTSGIYSV 867

Query: 641  RFTPDGR 661
             F+PDGR
Sbjct: 868  AFSPDGR 874



 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 40/123 (32%), Positives = 64/123 (52%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +G  D +V LW          L GH + + S+ F     ++A+GSS   ++LW+    + 
Sbjct: 626 SGSSDQTVRLWETTTGQCLRILQGHANSIWSVGFSPDGSIMASGSSDQTVRLWETTTGQC 685

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           +R L GH  +  +L F P G   ASGS D  +++W+     C+   +GHT  I ++ F+P
Sbjct: 686 LRILQGHGGWVLSLAFSPDGSIVASGSSDQTVRLWETTTGQCLRILRGHTDWIHSVVFSP 745

Query: 653 DGR 661
           DGR
Sbjct: 746 DGR 748



 Score = 86.3 bits (212), Expect = 4e-16
 Identities = 43/143 (30%), Positives = 75/143 (52%)
 Frame = +2

Query: 233  AHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEIL 412
            AH+G V+ + F     R+  +   D +V LW++      + L+ H++ V S+ F     L
Sbjct: 985  AHTGWVSAVAFSADG-RILASASADGTVRLWNVSNGLCVALLAEHSNWVHSVVFSPDGSL 1043

Query: 413  VAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKK 592
            +A+GS+ G ++LWDL+  +  R + GH S   ++ F   G   AS   D  ++IW     
Sbjct: 1044 LASGSADGTVRLWDLQSNRCTRVIEGHTSPVWSVAFSADGTLLASAGEDRIIRIWRTSTG 1103

Query: 593  GCIHTYKGHTRGISTIRFTPDGR 661
            G    + GH+R + ++ F+PDG+
Sbjct: 1104 GIHRAFPGHSRPVWSVAFSPDGQ 1126



 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 43/144 (29%), Positives = 72/144 (50%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           F    GN++ ++F      +  TG  D  V LW +      +   GHT+ V S+ F    
Sbjct: 563 FTEPLGNISSVQFSPNR-NVLATGDADGKVCLWQLPHGIQINICEGHTAWVWSVGFSPDG 621

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            +VA+GSS   ++LW+    + +R L GH +   ++ F P G   ASGS D  +++W+  
Sbjct: 622 SIVASGSSDQTVRLWETTTGQCLRILQGHANSIWSVGFSPDGSIMASGSSDQTVRLWETT 681

Query: 587 KKGCIHTYKGHTRGISTIRFTPDG 658
              C+   +GH   + ++ F+PDG
Sbjct: 682 TGQCLRILQGHGGWVLSLAFSPDG 705



 Score = 83.6 bits (205), Expect = 3e-15
 Identities = 35/122 (28%), Positives = 68/122 (55%)
 Frame = +2

Query: 293  TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
            TG  D +V +W+      ++ L  HT  V ++AF +   ++A+ S+ G ++LW++ +   
Sbjct: 962  TGSADRTVRIWNAATGRLSTVLQAHTGWVSAVAFSADGRILASASADGTVRLWNVSNGLC 1021

Query: 473  IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
            +  L+ H ++  ++ F P G   ASGS D  +++WD++   C    +GHT  + ++ F+ 
Sbjct: 1022 VALLAEHSNWVHSVVFSPDGSLLASGSADGTVRLWDLQSNRCTRVIEGHTSPVWSVAFSA 1081

Query: 653  DG 658
            DG
Sbjct: 1082 DG 1083



 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 43/151 (28%), Positives = 69/151 (45%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  L+    H G V  L F      +  +G  D +V LW          L GHT  + S+
Sbjct: 683  GQCLRILQGHGGWVLSLAFSPDGS-IVASGSSDQTVRLWETTTGQCLRILRGHTDWIHSV 741

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
             F      +A+G +   ++LW+    +  ++  GH S   ++ F P G+  ASG  D  +
Sbjct: 742  VFSPDGRSIASGGADRTVRLWEAATGECRKSFPGHSSLIWSVAFSPDGQSLASGGQDALI 801

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
            K+WD+    C    +GHT  +  + F+PDG+
Sbjct: 802  KLWDVATAQCRRILQGHTNLVYAVAFSPDGQ 832



 Score = 79.7 bits (195), Expect = 4e-14
 Identities = 43/154 (27%), Positives = 73/154 (47%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G   + F  HS  +  + F     +   +GG D  + LW +        L GHT+ V
Sbjct: 764  AATGECRKSFPGHSSLIWSVAFSPDG-QSLASGGQDALIKLWDVATAQCRRILQGHTNLV 822

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             ++AF      +A+GS+   ++LW  +  +  +T+ G+ S   ++ F P G   AS S D
Sbjct: 823  YAVAFSPDGQTLASGSADQAVRLWKTDTGQCRKTIQGYTSGIYSVAFSPDGRTLASASTD 882

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
              +++WD     C  T +GH   +  + F+PDG+
Sbjct: 883  HTVRLWDTATGECRQTLEGHHSWVFAVAFSPDGQ 916



 Score = 79.7 bits (195), Expect = 4e-14
 Identities = 39/123 (31%), Positives = 63/123 (51%)
 Frame = +2

Query: 293  TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
            +G  D +V LW          L GH   V S+AF     +VA+GSS   ++LW+    + 
Sbjct: 668  SGSSDQTVRLWETTTGQCLRILQGHGGWVLSLAFSPDGSIVASGSSDQTVRLWETTTGQC 727

Query: 473  IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
            +R L GH  +  ++ F P G   ASG  D  +++W+     C  ++ GH+  I ++ F+P
Sbjct: 728  LRILRGHTDWIHSVVFSPDGRSIASGGADRTVRLWEAATGECRKSFPGHSSLIWSVAFSP 787

Query: 653  DGR 661
            DG+
Sbjct: 788  DGQ 790



 Score = 79.3 bits (194), Expect = 5e-14
 Identities = 39/122 (31%), Positives = 64/122 (52%)
 Frame = +2

Query: 293  TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
            +G  D +V LW         T+ G+TS + S+AF      +A+ S+   ++LWD    + 
Sbjct: 836  SGSADQAVRLWKTDTGQCRKTIQGYTSGIYSVAFSPDGRTLASASTDHTVRLWDTATGEC 895

Query: 473  IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
             +TL GH S+  A+ F P G+  ASGS+D  + +W+     C    +GH   + ++ F+P
Sbjct: 896  RQTLEGHHSWVFAVAFSPDGQTLASGSVDHTVLLWETVTGRCRKILEGHHSWVWSVVFSP 955

Query: 653  DG 658
            DG
Sbjct: 956  DG 957



 Score = 73.6 bits (179), Expect = 3e-12
 Identities = 39/127 (30%), Positives = 60/127 (47%)
 Frame = +2

Query: 281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
            R   +   DH+V LW         TL GH S V ++AF      +A+GS    + LW+  
Sbjct: 874  RTLASASTDHTVRLWDTATGECRQTLEGHHSWVFAVAFSPDGQTLASGSVDHTVLLWETV 933

Query: 461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
              +  + L GH S+  ++ F P G   A+GS D  ++IW+          + HT  +S +
Sbjct: 934  TGRCRKILEGHHSWVWSVVFSPDGTTIATGSADRTVRIWNAATGRLSTVLQAHTGWVSAV 993

Query: 641  RFTPDGR 661
             F+ DGR
Sbjct: 994  AFSADGR 1000



 Score = 70.1 bits (170), Expect = 3e-11
 Identities = 33/122 (27%), Positives = 58/122 (47%)
 Frame = +2

Query: 293  TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
            +G  DH+V LW          L GH S V S+ F      +A GS+   +++W+    ++
Sbjct: 920  SGSVDHTVLLWETVTGRCRKILEGHHSWVWSVVFSPDGTTIATGSADRTVRIWNAATGRL 979

Query: 473  IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
               L  H  + +A+ F   G   AS S D  +++W++    C+     H+  + ++ F+P
Sbjct: 980  STVLQAHTGWVSAVAFSADGRILASASADGTVRLWNVSNGLCVALLAEHSNWVHSVVFSP 1039

Query: 653  DG 658
            DG
Sbjct: 1040 DG 1041



 Score = 66.6 bits (161), Expect = 4e-10
 Identities = 31/99 (31%), Positives = 51/99 (51%)
 Frame = +2

Query: 284  MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
            +  +G  D +V LW +     T  + GHTSPV S+AF +   L+A+     +I++W    
Sbjct: 1043 LLASGSADGTVRLWDLQSNRCTRVIEGHTSPVWSVAFSADGTLLASAGEDRIIRIWRTST 1102

Query: 464  TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
              + R   GH     ++ F P G+  ASGS D ++ +W+
Sbjct: 1103 GGIHRAFPGHSRPVWSVAFSPDGQTLASGSQDESIALWE 1141



 Score = 39.3 bits (90), Expect = 0.063
 Identities = 19/73 (26%), Positives = 31/73 (42%)
 Frame = +2

Query: 284  MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
            +  + G+D  + +W            GH+ PV S+AF      +A+GS    I LW+   
Sbjct: 1085 LLASAGEDRIIRIWRTSTGGIHRAFPGHSRPVWSVAFSPDGQTLASGSQDESIALWETHS 1144

Query: 464  TKMIRTLSGHRSY 502
             +  R L   + Y
Sbjct: 1145 AERSRVLRNPKPY 1157



>gb:AE016818_1747903 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 815

 Score = 90.5 bits (223), Expect = 2e-17
 Identities = 45/156 (28%), Positives = 72/156 (46%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           AK        + HSG V  + F     R  ++  +D +V LWS+   T   +  GH  PV
Sbjct: 529 AKDASNTVTLIGHSGPVYSVSFSPDN-RYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPV 587

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             + F       A GS     +LW  +    +R  +GH +    + FHP G +  +GS D
Sbjct: 588 WDVKFSPLGHYFATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSD 647

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
              ++WDI+    +  + GHT  + ++  +PDGRW+
Sbjct: 648 KTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWL 683



 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 44/163 (26%), Positives = 76/163 (46%), Gaps = 15/163 (9%)
 Frame = +2

Query: 227 FVAHSGN--VNCLRFGKKTCRMFLTGGDDHSVNLWSI-GKP------------TSTSTLS 361
           +  H+ N  + CLRF   + R+   G  D  + LWS+ G P            ++T TL 
Sbjct: 481 YTFHNTNREMTCLRFSDDS-RLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVTLI 539

Query: 362 GHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFF 541
           GH+ PV S++F      + + S    ++LW L+    + +  GH      ++F P G +F
Sbjct: 540 GHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLGHYF 599

Query: 542 ASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           A+GS D   ++W       +  + GH   +  + F P+G +V+
Sbjct: 600 ATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVL 642



 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 34/129 (26%), Positives = 58/129 (44%), Gaps = 1/129 (0%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F TG  D +  LWS          +GH + V+ + F      V  GSS    ++WD++  
Sbjct: 599 FATGSHDQTARLWSCDHIYPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTG 658

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTR-GISTIR 643
             +R   GH +   ++   P G +  +GS D  + +WDI     I   +GH +  + ++ 
Sbjct: 659 DSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLS 718

Query: 644 FTPDGRWVV 670
           F  +G  +V
Sbjct: 719 FNKEGNILV 727



 Score = 37.7 bits (86), Expect = 0.18
 Identities = 28/125 (22%), Positives = 48/125 (38%), Gaps = 42/125 (33%)
 Frame = +2

Query: 212 YKLQEFVAHSGNVNCLRF-----------GKKTCRMF----------------------- 289
           Y L+ F  H  +V+C+ F             KTCRM+                       
Sbjct: 617 YPLRIFAGHLNDVDCVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAV 676

Query: 290 -------LTGGDDHSVNLWSIGKPTSTSTLSGH-TSPVESIAFDSAEILVAAGSSSGLIK 445
                   TG +D  + +W IG       + GH  S V S++F+    ++ +G +   ++
Sbjct: 677 SPDGRWLTTGSEDGVIIVWDIGTGKRIKQMRGHGKSAVYSLSFNKEGNILVSGGADQSVR 736

Query: 446 LWDLE 460
           +WDL+
Sbjct: 737 VWDLK 741



>gb:AE017344_1756343 Cryptococcus neoformans var. neoformans JEC21
           chromosome 4, complete sequence.
          Length = 343

 Score = 89.7 bits (221), Expect = 4e-17
 Identities = 50/149 (33%), Positives = 80/149 (53%), Gaps = 2/149 (1%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           +E  AHSG ++C RF     R  +T   D +  LW I + T T   + HT  V SI+   
Sbjct: 140 RELSAHSGYLSCCRFIND--RQIVTSSGDMTCMLWDIEQGTRTMEFNDHTGDVMSISLAP 197

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
              L  +G+     K+WD+   K ++T +GH S   A++F P G+ FA+GS D + K++D
Sbjct: 198 NANLFVSGACDATAKVWDIRTGKAVQTFTGHESDINAVQFFPNGDAFATGSDDASCKLFD 257

Query: 581 IRKKGCIHTYKGHT--RGISTIRFTPDGR 661
           +R    +++Y      RGI+++ F+  GR
Sbjct: 258 LRADRELNSYAHDNILRGITSVAFSISGR 286



 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 31/127 (24%), Positives = 56/127 (44%), Gaps = 2/127 (1%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHT--SP 376
           + G  +Q F  H  ++N ++F       F TG DD S  L+ +      ++ +       
Sbjct: 217 RTGKAVQTFTGHESDINAVQFFPNG-DAFATGSDDASCKLFDLRADRELNSYAHDNILRG 275

Query: 377 VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM 556
           + S+AF  +  ++ AG       +WD    + I  L+GH +  + +     G    +GS 
Sbjct: 276 ITSVAFSISGRVLFAGYDDYNCNVWDTLKGERIGVLAGHENRISCMGVSGDGVALCTGSW 335

Query: 557 DTNLKIW 577
           D+ LK+W
Sbjct: 336 DSLLKVW 342



 Score = 37.0 bits (84), Expect = 0.31
 Identities = 22/104 (21%), Positives = 44/104 (42%), Gaps = 3/104 (2%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           TL GH + + ++ + +    + + S  G + +WD   T  +  +    S+   + + P G
Sbjct: 54  TLKGHLAKIYALHWAADTRHLVSASQDGRLIVWDAYSTNKVHAVPLRSSWVMTVAYAPSG 113

Query: 533 EFFASGSMDTNLKIWDIRKKGCIHTYK---GHTRGISTIRFTPD 655
            F A G +D    ++ +   G     +    H+  +S  RF  D
Sbjct: 114 AFVACGGLDNVCSVYALAPGGQAKVRRELSAHSGYLSCCRFIND 157



 Score = 36.6 bits (83), Expect = 0.41
 Identities = 31/148 (20%), Positives = 55/148 (37%), Gaps = 3/148 (2%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H   +  L +   T R  ++   D  + +W          +   +S V ++A+  +   V
Sbjct: 58  HLAKIYALHWAADT-RHLVSASQDGRLIVWDAYSTNKVHAVPLRSSWVMTVAYAPSGAFV 116

Query: 416 AAGSSSGLIKLWDLE---DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
           A G    +  ++ L      K+ R LS H  Y +   F    +   S S D    +WDI 
Sbjct: 117 ACGGLDNVCSVYALAPGGQAKVRRELSAHSGYLSCCRFINDRQIVTS-SGDMTCMLWDIE 175

Query: 587 KKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           +      +  HT  + +I   P+    V
Sbjct: 176 QGTRTMEFNDHTGDVMSISLAPNANLFV 203



 Score = 35.8 bits (81), Expect = 0.69
 Identities = 19/67 (28%), Positives = 28/67 (41%)
 Frame = +2

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
           K  RTL GH +   AL +        S S D  L +WD      +H     +  + T+ +
Sbjct: 50  KARRTLKGHLAKIYALHWAADTRHLVSASQDGRLIVWDAYSTNKVHAVPLRSSWVMTVAY 109

Query: 647 TPDGRWV 667
            P G +V
Sbjct: 110 APSGAFV 116



>gb:AC058781_1205242 Leishmania major strain Friedlin chromosome 35
           clone L344, complete sequence.
          Length = 589

 Score = 89.7 bits (221), Expect = 4e-17
 Identities = 42/125 (33%), Positives = 74/125 (59%), Gaps = 1/125 (0%)
 Frame = +2

Query: 296 GGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMI 475
           GG D S++++     T ++ L G + P+ ++ FD  +  V  GS +G +++WD+   +++
Sbjct: 30  GGRDASIHVYPFMGYTRSAWLQGLSEPITALGFDPDQTSVVGGSDAGKLQMWDIGSEEVV 89

Query: 476 RTLS-GHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           R  + GH S  T ++    G+FFA+ S D  L+IWD+RK     +YK  T  +  ++F+P
Sbjct: 90  RVFTRGHASTVTDIDVFRSGQFFATVSTDRILRIWDVRKSSGRQSYKDATAPLCAVQFSP 149

Query: 653 DGRWV 667
           +GRWV
Sbjct: 150 NGRWV 154



 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 27/101 (26%), Positives = 49/101 (48%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
           + F T   D  + +W + K +   +    T+P+ ++ F      VA G + G+++L+DL 
Sbjct: 110 QFFATVSTDRILRIWDVRKSSGRQSYKDATAPLCAVQFSPNGRWVATGCARGIVRLYDLV 169

Query: 461 DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
             K++     H    T+L FHP   +   GS D  + +WD+
Sbjct: 170 AGKIVHKFELHTGAITSLHFHPDLYYLVVGSGDGTVSVWDL 210



 Score = 52.8 bits (125), Expect = 5e-06
 Identities = 34/132 (25%), Positives = 62/132 (46%), Gaps = 7/132 (5%)
 Frame = +2

Query: 296 GGDDHSVNLWSIGKPTSTSTLS-GHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           G D   + +W IG        + GH S V  I    +    A  S+  ++++WD      
Sbjct: 72  GSDAGKLQMWDIGSEEVVRVFTRGHASTVTDIDVFRSGQFFATVSTDRILRIWD------ 125

Query: 473 IRTLSGHRSY------CTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
           +R  SG +SY        A++F P G + A+G     ++++D+     +H ++ HT  I+
Sbjct: 126 VRKSSGRQSYKDATAPLCAVQFSPNGRWVATGCARGIVRLYDLVAGKIVHKFELHTGAIT 185

Query: 635 TIRFTPDGRWVV 670
           ++ F PD  ++V
Sbjct: 186 SLHFHPDLYYLV 197



 Score = 37.4 bits (85), Expect = 0.24
 Identities = 27/134 (20%), Positives = 57/134 (42%), Gaps = 5/134 (3%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  + +F  H+G +  L F      + + G  D +V++W +    +    S   +P++++
Sbjct: 171 GKIVHKFELHTGAITSLHFHPDLYYL-VVGSGDGTVSVWDLDSFETRFHSSSQHTPIDAV 229

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIR-----TLSGHRSYCTALEFHPFGEFFASGS 553
            F    +L  +  +  +    +L D   +       + G  +Y +A +   F E   + +
Sbjct: 230 HFSGTRLLATSDHNLRIFDTSNLSDRTAVSLEAPWIMMGDVAYASATDEAWFVETAGATA 289

Query: 554 MDTNLKIWDIRKKG 595
           M   L + DIR+ G
Sbjct: 290 MKCKLSLRDIRRPG 303



>gb:CR382128_1660923 Yarrowia lipolytica chromosome B of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 741

 Score = 89.4 bits (220), Expect = 5e-17
 Identities = 46/149 (30%), Positives = 70/149 (46%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           +  V H+G V  + F     R  L+   D +V LWS+   T      GH  PV  +AF  
Sbjct: 464 KRLVGHAGPVYGVSFSPDQ-RYLLSASADKTVMLWSMDTYTGLVCYKGHNEPVWDVAFSP 522

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
                A  S     +LW  +    +R  +GH S    + FHP G +  +GS D  +++WD
Sbjct: 523 HGHYFATASHDQTARLWSCDHIYPLRIFAGHMSDVDCVIFHPNGTYVFTGSSDRTVRMWD 582

Query: 581 IRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           + K   +  + GHT  I+ +  +PDGRW+
Sbjct: 583 VAKGSSVRVFIGHTAAINCLAVSPDGRWL 611



 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 34/129 (26%), Positives = 56/129 (43%), Gaps = 1/129 (0%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F T   D +  LWS          +GH S V+ + F      V  GSS   +++WD+   
Sbjct: 527 FATASHDQTARLWSCDHIYPLRIFAGHMSDVDCVIFHPNGTYVFTGSSDRTVRMWDVAKG 586

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTR-GISTIR 643
             +R   GH +    L   P G + AS   D  + +W+I     +   +GH +  I ++ 
Sbjct: 587 SSVRVFIGHTAAINCLAVSPDGRWLASAGEDHVIILWEIGSGRRLKIMRGHGKASIYSLA 646

Query: 644 FTPDGRWVV 670
           F+ +G  +V
Sbjct: 647 FSREGTVLV 655



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 26/87 (29%), Positives = 46/87 (52%), Gaps = 2/87 (2%)
 Frame = +2

Query: 206 RGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGH-TSPVE 382
           +G  ++ F+ H+  +NCL       R   + G+DH + LW IG       + GH  + + 
Sbjct: 585 KGSSVRVFIGHTAAINCLAVSPDG-RWLASAGEDHVIILWEIGSGRRLKIMRGHGKASIY 643

Query: 383 SIAFD-SAEILVAAGSSSGLIKLWDLE 460
           S+AF     +LV+AG+    I++WD++
Sbjct: 644 SLAFSREGTVLVSAGADQS-IRVWDVK 669



>pir|AH2195|AH2195 hypothetical protein alr3119 [imported] - Nostoc
           sp. (strain PCC 7120)>gb:BA000019_684108 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 676

 Score = 89.0 bits (219), Expect = 7e-17
 Identities = 46/142 (32%), Positives = 75/142 (52%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H+ +VN + F         +G DD ++ +W++       TL GH+  V +IAF      +
Sbjct: 390 HASDVNSVAFSPNG-EFLASGSDDKTIKVWNLKNKQKIHTLPGHSGWVWAIAFSPDGKTL 448

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
           A+  +   IKLW+L   K IR L GH     ++ F P G+  ASGS+D  +K+W+     
Sbjct: 449 ASTGADKTIKLWNLATGKEIRHLKGHSQGVASVAFSPDGKTLASGSLDKTIKLWNPATGK 508

Query: 596 CIHTYKGHTRGISTIRFTPDGR 661
            I T + H+ G++ + F+PDG+
Sbjct: 509 EIRTLQEHSSGVANVAFSPDGK 530



 Score = 88.2 bits (217), Expect = 1e-16
 Identities = 51/153 (33%), Positives = 74/153 (48%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           K   K+     HSG V  + F      +  TG D  ++ LW++        L GH+  V 
Sbjct: 421 KNKQKIHTLPGHSGWVWAIAFSPDGKTLASTGADK-TIKLWNLATGKEIRHLKGHSQGVA 479

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
           S+AF      +A+GS    IKLW+    K IRTL  H S    + F P G+  ASGS D 
Sbjct: 480 SVAFSPDGKTLASGSLDKTIKLWNPATGKEIRTLQEHSSGVANVAFSPDGKTLASGSWDK 539

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
            +K+W++     IHT KGH+  + ++ F  D +
Sbjct: 540 TIKLWNLTTSKVIHTLKGHSDLVMSVAFNSDSQ 572



 Score = 85.5 bits (210), Expect = 8e-16
 Identities = 40/107 (37%), Positives = 63/107 (58%)
 Frame = +2

Query: 341 TSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEF 520
           T   TL GH S V S+AF      +A+GS    IK+W+L++ + I TL GH  +  A+ F
Sbjct: 382 TQPYTLKGHASDVNSVAFSPNGEFLASGSDDKTIKVWNLKNKQKIHTLPGHSGWVWAIAF 441

Query: 521 HPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
            P G+  AS   D  +K+W++     I   KGH++G++++ F+PDG+
Sbjct: 442 SPDGKTLASTGADKTIKLWNLATGKEIRHLKGHSQGVASVAFSPDGK 488



 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 50/152 (32%), Positives = 76/152 (50%), Gaps = 1/152 (0%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +++    HS  V  + F     +   +G  D ++ LW++       TL GH+  V S+
Sbjct: 507 GKEIRTLQEHSSGVANVAFSPDG-KTLASGSWDKTIKLWNLTTSKVIHTLKGHSDLVMSV 565

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGE-FFASGSMDTN 565
           AF+S    +A+GS    IKLW+L   K IRTL GH     ++ + P      ASGS D  
Sbjct: 566 AFNSDSQTLASGSKDKTIKLWNLSTGKTIRTLRGHSDKVNSVAYVPRDSTVLASGSNDNT 625

Query: 566 LKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
           +K+W++     I T K  +  I +I  +PDGR
Sbjct: 626 IKLWNLTTGEIIRTLKRDSGYIYSIVISPDGR 657



 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 43/148 (29%), Positives = 75/148 (50%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +++    HS  V  + F     +   +G  D ++ LW+        TL  H+S V ++
Sbjct: 465 GKEIRHLKGHSQGVASVAFSPDG-KTLASGSLDKTIKLWNPATGKEIRTLQEHSSGVANV 523

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           AF      +A+GS    IKLW+L  +K+I TL GH     ++ F+   +  ASGS D  +
Sbjct: 524 AFSPDGKTLASGSWDKTIKLWNLTTSKVIHTLKGHSDLVMSVAFNSDSQTLASGSKDKTI 583

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           K+W++     I T +GH+  ++++ + P
Sbjct: 584 KLWNLSTGKTIRTLRGHSDKVNSVAYVP 611



 Score = 62.0 bits (149), Expect = 9e-09
 Identities = 38/116 (32%), Positives = 60/116 (51%), Gaps = 2/116 (1%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           HS  V  + F   + +   +G  D ++ LW++    +  TL GH+  V S+A+   +  V
Sbjct: 558 HSDLVMSVAFNSDS-QTLASGSKDKTIKLWNLSTGKTIRTLRGHSDKVNSVAYVPRDSTV 616

Query: 416 -AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFAS-GSMDTNLKIW 577
            A+GS+   IKLW+L   ++IRTL     Y  ++   P G   AS GS +  +KIW
Sbjct: 617 LASGSNDNTIKLWNLTTGEIIRTLKRDSGYIYSIVISPDGRNLASGGSAENIIKIW 672



 Score = 37.7 bits (86), Expect = 0.18
 Identities = 19/84 (22%), Positives = 39/84 (46%), Gaps = 1/84 (1%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  ++    HS  VN + +  +   +  +G +D+++ LW++       TL   +  + SI
Sbjct: 591 GKTIRTLRGHSDKVNSVAYVPRDSTVLASGSNDNTIKLWNLTTGEIIRTLKRDSGYIYSI 650

Query: 389 AFD-SAEILVAAGSSSGLIKLWDL 457
                   L + GS+  +IK+W +
Sbjct: 651 VISPDGRNLASGGSAENIIKIWPM 674



>gb:AF536325_1809659 Ustilago maydis G-protein beta subunit Bpp1
           (bpp1) gene, complete cds.
          Length = 349

 Score = 88.6 bits (218), Expect = 9e-17
 Identities = 49/149 (32%), Positives = 80/149 (53%), Gaps = 2/149 (1%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           +E  AH+G ++C RF     +  LT   D S  LW I   T  S  + HT  V SI+  S
Sbjct: 146 RELSAHTGYLSCCRFLND--QQILTSSGDMSCILWDIDSGTRISEFNDHTGDVMSISLSS 203

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
              +  +G+   + K+WD+   K ++T +GH S   A++F P G+ FA+GS D + +++D
Sbjct: 204 NPNVFVSGACDAVAKVWDIRSGKAVQTFAGHESDINAVQFFPNGDAFATGSDDASCRLFD 263

Query: 581 IRKKGCIHTYKGHT--RGISTIRFTPDGR 661
           +R    ++TY       GI+++ F+  GR
Sbjct: 264 LRADRELNTYTHDNILCGITSVGFSVSGR 292



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 26/107 (24%), Positives = 45/107 (42%), Gaps = 6/107 (5%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           TL GH + + ++ + S +  + + S  G + +WD   T  +  +    S+     + P G
Sbjct: 58  TLKGHLAKIYAMHWASDKRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYAPSG 117

Query: 533 EFFASGSMDTNLKIWDIRKKGCIHTYK------GHTRGISTIRFTPD 655
              A G +D    I+ +R +   H  K       HT  +S  RF  D
Sbjct: 118 NSVACGGLDNICSIYSLRGRD-PHNIKVGRELSAHTGYLSCCRFLND 163



>gb:AF391288_1267431 Branchiostoma floridae cosmid MPMGc117G0971,
           partial sequence.
          Length = 353

 Score = 88.6 bits (218), Expect = 9e-17
 Identities = 48/187 (25%), Positives = 82/187 (43%), Gaps = 5/187 (2%)
 Frame = +2

Query: 125 SAAAERPTPXXXXXXXXXXXXXXRMA----KRGYKLQEFVA-HSGNVNCLRFGKKTCRMF 289
           +  A +PTP              +      K  Y L+  +A H+  V+ ++F        
Sbjct: 21  TTTASQPTPATTATTTTTSTQNTQPKPQPLKPNYTLKFTLAGHTKAVSSVKFSPNG-EWL 79

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
            +   D  + +W         T+SGH   +  +A+ S   L+ + S    +K+WDL   K
Sbjct: 80  ASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSHLLVSASDDKTLKIWDLNSGK 139

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFT 649
            ++TL GH +Y     F+P      SGS D +++IWD++   C+ T   H+  +S + F 
Sbjct: 140 CLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFN 199

Query: 650 PDGRWVV 670
            DG  +V
Sbjct: 200 RDGSLIV 206



 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 44/158 (27%), Positives = 75/158 (47%), Gaps = 4/158 (2%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L+    HS  V C  F  ++  + ++G  D SV +W +       TL  H+ PV ++
Sbjct: 138 GKCLKTLKGHSNYVFCCNFNPQS-NLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAV 196

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL-SGHRSYCTALEFHPFGEFFASGSMDTN 565
            F+    L+ + S  GL ++WD    + ++TL        + ++F P G++  + ++D  
Sbjct: 197 HFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNT 256

Query: 566 LKIWDIRKKGCIHTYKGHTRG---ISTIRFTPDGRWVV 670
           LK+WD  K  C+ TY GH      I        G+W+V
Sbjct: 257 LKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIV 294



 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 33/130 (25%), Positives = 66/130 (50%), Gaps = 1/130 (0%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  DD ++ +W +       TL GH++ V    F+    L+ +GS    +++WD++ 
Sbjct: 120 LLVSASDDKTLKIWDLNSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKT 179

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHT-YKGHTRGISTI 640
            K ++TL  H    +A+ F+  G    S S D   +IWD     C+ T        +S +
Sbjct: 180 GKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFV 239

Query: 641 RFTPDGRWVV 670
           +F+P+G++++
Sbjct: 240 KFSPNGKYIL 249



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 23/97 (23%), Positives = 45/97 (46%), Gaps = 6/97 (6%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEIL----VAAGSSSGLIKLWDLEDTKM 472
           D+++ LW   K     T +GH +    I F +  +     + +GS   ++ +W+L+  ++
Sbjct: 254 DNTLKLWDYSKGKCLKTYTGHKNEKYCI-FANFSVTGGKWIVSGSEDNMVFIWNLQTKEV 312

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSM--DTNLKIW 577
           ++ L GH         HP     AS ++  D  +K+W
Sbjct: 313 VQKLQGHTDVVLCTACHPTENIIASAALENDKTIKLW 349



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 21/86 (24%), Positives = 38/86 (44%), Gaps = 4/86 (4%)
 Frame = +2

Query: 206 RGYKLQEFVAHSGNVNCL--RFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           +G  L+ +  H     C+   F     +  ++G +D+ V +W++        L GHT  V
Sbjct: 264 KGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVFIWNLQTKEVVQKLQGHTDVV 323

Query: 380 ESIAFDSAEILVAAGS--SSGLIKLW 451
              A    E ++A+ +  +   IKLW
Sbjct: 324 LCTACHPTENIIASAALENDKTIKLW 349



>sp|P38129|TAF5_YEAST Transcription initiation factor TFIID subunit
           5 (TBP-associated factor 5) (TBP-associated factor 90
           kDa) (TAFII-90).>pir|S34023|S34023 TATA box-binding
           protein-associated factor chain TAFII90 - yeast
           (Saccharomyces cerevisiae)>gb:AY692890_1622937
           Saccharomyces cerevisiae clone FLH113143.01X YBR198C
           gene, complete cds.>gb:SCCHRIIFG_1706759 S.cerevisiae
           RIM, MSI1, PGI, and ribosomal protein L21
           genes.>gb:SCYBR198C_1711438 S.cerevisiae chromosome II
           reading frame ORF YBR198c.
          Length = 798

 Score = 88.6 bits (218), Expect = 9e-17
 Identities = 44/146 (30%), Positives = 69/146 (47%)
 Frame = +2

Query: 230 VAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEI 409
           V HSG V    F     +  L+G +D +V LWS+   T+  +  GH  PV  ++F     
Sbjct: 522 VGHSGTVYSTSFSPDN-KYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGH 580

Query: 410 LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRK 589
             A  S     +LW  +    +R  +GH +    + FHP G +  +GS D   ++WD+  
Sbjct: 581 YFATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVST 640

Query: 590 KGCIHTYKGHTRGISTIRFTPDGRWV 667
              +  + GHT  + +I   PDGRW+
Sbjct: 641 GDSVRLFLGHTAPVISIAVCPDGRWL 666



 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 36/158 (22%), Positives = 66/158 (41%), Gaps = 17/158 (10%)
 Frame = +2

Query: 245 NVNCLRFGKKTCRMFLTGGDDHSVNLWSIG-----------------KPTSTSTLSGHTS 373
           +++CL F    CR+   G  D  + +WS+                  +  +  TL GH+ 
Sbjct: 468 DMSCLDFSDD-CRIAAAGFQDSYIKIWSLDGSSLNNPNIALNNNDKDEDPTCKTLVGHSG 526

Query: 374 PVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGS 553
            V S +F      + +GS    ++LW ++    + +  GH      + F P G +FA+ S
Sbjct: 527 TVYSTSFSPDNKYLLSGSEDKTVRLWSMDTHTALVSYKGHNHPVWDVSFSPLGHYFATAS 586

Query: 554 MDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            D   ++W       +  + GH   +  + F P+G +V
Sbjct: 587 HDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYV 624



 Score = 59.3 bits (142), Expect = 6e-08
 Identities = 31/129 (24%), Positives = 59/129 (45%), Gaps = 1/129 (0%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F T   D +  LWS          +GH + V+ ++F      V  GSS    ++WD+   
Sbjct: 582 FATASHDQTARLWSCDHIYPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTG 641

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTR-GISTIR 643
             +R   GH +   ++   P G + ++GS D  + +WDI     +   +GH +  I ++ 
Sbjct: 642 DSVRLFLGHTAPVISIAVCPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLS 701

Query: 644 FTPDGRWVV 670
           ++ +G  ++
Sbjct: 702 YSKEGNVLI 710



 Score = 37.4 bits (85), Expect = 0.24
 Identities = 26/125 (20%), Positives = 48/125 (38%), Gaps = 42/125 (33%)
 Frame = +2

Query: 212 YKLQEFVAHSGNVNCLRF-----------GKKTCRMF----------------------- 289
           Y L+ F  H  +V+C+ F             KTCRM+                       
Sbjct: 600 YPLRIFAGHLNDVDCVSFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGHTAPVISIAV 659

Query: 290 -------LTGGDDHSVNLWSIGKPTSTSTLSGH-TSPVESIAFDSAEILVAAGSSSGLIK 445
                   TG +D  +N+W IG       + GH  + + S+++     ++ +G +   ++
Sbjct: 660 CPDGRWLSTGSEDGIINVWDIGTGKRLKQMRGHGKNAIYSLSYSKEGNVLISGGADHTVR 719

Query: 446 LWDLE 460
           +WDL+
Sbjct: 720 VWDLK 724



>gb:BC075582_2558678 Xenopus tropicalis TAF5-like RNA polymerase II,
           p300/CBP-associated factor (PCAF)-associated factor,
           65kDa, mRNA (cDNA clone MGC:89568 IMAGE:6993997),
           complete cds.
          Length = 588

 Score = 88.2 bits (217), Expect = 1e-16
 Identities = 47/158 (29%), Positives = 75/158 (47%), Gaps = 11/158 (6%)
 Frame = +2

Query: 206 RGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVES 385
           R + L+ +  H  +V+C++F   +     TG  D +V LWS  +  S    +GH  PV +
Sbjct: 414 RTFPLRIYAGHLSDVDCIKFHPNS-NYLATGSTDKTVRLWSTQQGNSVRLFTGHRGPVLA 472

Query: 386 IAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTN 565
           +AF      +A+      +KLWDL    + + L GH    ++L F P     AS SMD +
Sbjct: 473 LAFSPNGKYLASAGEDQRLKLWDLASGTLYKELRGHTDNISSLTFSPDSSLIASASMDNS 532

Query: 566 LKIWDIRKKGC-----------IHTYKGHTRGISTIRF 646
           +++WDIR   C           +  Y G T  I +++F
Sbjct: 533 VRVWDIRNSYCNTPSDGSSSELVGVYTGQTSNILSVQF 570



 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 39/123 (31%), Positives = 59/123 (47%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F +   D +  LW   +       +GH S V+ I F      +A GS+   ++LW  +  
Sbjct: 398 FASASHDRTGRLWCFDRTFPLRIYAGHLSDVDCIKFHPNSNYLATGSTDKTVRLWSTQQG 457

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
             +R  +GHR    AL F P G++ AS   D  LK+WD+         +GHT  IS++ F
Sbjct: 458 NSVRLFTGHRGPVLALAFSPNGKYLASAGEDQRLKLWDLASGTLYKELRGHTDNISSLTF 517

Query: 647 TPD 655
           +PD
Sbjct: 518 SPD 520



 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 38/153 (24%), Positives = 74/153 (48%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +++    HSG V    F   +  + L+  +D S+  W++   T+T    GH  PV  +
Sbjct: 331 GTEMKILRGHSGPVYRTCFLSDSSGL-LSCSEDTSIRYWNLENFTNTVLYQGHAHPVWDL 389

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
                 +  A+ S     +LW  + T  +R  +GH S    ++FHP   + A+GS D  +
Sbjct: 390 DVSPCSLFFASASHDRTGRLWCFDRTFPLRIYAGHLSDVDCIKFHPNSNYLATGSTDKTV 449

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           ++W  ++   +  + GH   +  + F+P+G+++
Sbjct: 450 RLWSTQQGNSVRLFTGHRGPVLALAFSPNGKYL 482



>gb:HSA9770_2009927 Homo sapiens mRNA for putative transcription
           factor, partial.
          Length = 260

 Score = 88.2 bits (217), Expect = 1e-16
 Identities = 48/158 (30%), Positives = 74/158 (46%), Gaps = 11/158 (6%)
 Frame = +2

Query: 206 RGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVES 385
           R Y L+ +  H  +V+C++F   +     TG  D +V LWS  +  S    +GH  PV S
Sbjct: 86  RTYPLRIYAGHLADVDCVKFHPNS-NYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLS 144

Query: 386 IAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTN 565
           +AF      +A+      +KLWDL    + + L GH    T+L F P     AS SMD +
Sbjct: 145 LAFSPNGKYLASAGEDQRLKLWDLASGTLYKELRGHTDNITSLTFSPDSGLIASASMDNS 204

Query: 566 LKIWDIRKKGC-----------IHTYKGHTRGISTIRF 646
           +++WDIR   C           +  Y G    + +++F
Sbjct: 205 VRVWDIRNTYCSAPADGSSSELVGVYTGQMSNVLSVQF 242



 Score = 82.4 bits (202), Expect = 6e-15
 Identities = 37/123 (30%), Positives = 61/123 (49%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F +G  D +  LWS  +       +GH + V+ + F      +A GS+   ++LW  +  
Sbjct: 70  FASGSHDRTARLWSFDRTYPLRIYAGHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQG 129

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
             +R  +GHR    +L F P G++ AS   D  LK+WD+         +GHT  I+++ F
Sbjct: 130 NSVRLFTGHRGPVLSLAFSPNGKYLASAGEDQRLKLWDLASGTLYKELRGHTDNITSLTF 189

Query: 647 TPD 655
           +PD
Sbjct: 190 SPD 192



 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 39/153 (25%), Positives = 76/153 (49%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +++    H G V   RF   +  + L+  +D S+  W +G  T+T    GH  PV  +
Sbjct: 3   GTEMKILRGHCGPVYSTRFLADSSGL-LSCSEDMSIRYWDLGSFTNTVLYQGHAYPVWDL 61

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
                 +  A+GS     +LW  + T  +R  +GH +    ++FHP   + A+GS D  +
Sbjct: 62  DISPYSLYFASGSHDRTARLWSFDRTYPLRIYAGHLADVDCVKFHPNSNYLATGSTDKTV 121

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           ++W  ++   +  + GH   + ++ F+P+G+++
Sbjct: 122 RLWSAQQGNSVRLFTGHRGPVLSLAFSPNGKYL 154



>pir|AC1842|AC1842 WD-40 repeat protein [imported] - Nostoc sp.
            (strain PCC 7120)>gb:BA000019_681275 Nostoc sp. PCC 7120
            DNA, complete genome.
          Length = 1747

 Score = 88.2 bits (217), Expect = 1e-16
 Identities = 47/151 (31%), Positives = 74/151 (49%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  L+    H+  V  + F     +   +G  D++V +W          ++GH   + S+
Sbjct: 1550 GQLLRTLTGHNDEVTSVNFSPDG-QFLASGSTDNTVKIWQTDGRL-IKNITGHGLAIASV 1607

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
             F      +A+ S    IKLW + D K+I  L+GH    T+L F P GE  ASGS D  +
Sbjct: 1608 KFSPDSHTLASASWDNTIKLWQVTDGKLINNLNGHIDGVTSLSFSPDGEILASGSADNTI 1667

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
            K+W++     + T  GH   I+T+ F+PDG+
Sbjct: 1668 KLWNLPNATLLKTLLGHPGKINTLAFSPDGK 1698



 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 41/121 (33%), Positives = 68/121 (56%)
 Frame = +2

Query: 293  TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
            T   D+++ LW         TL+GH   + +++F      +A+GS+   IK+W + D ++
Sbjct: 1493 TASADNTIKLWDSQTQQLIKTLTGHKDRITTLSFHPDNQTIASGSADKTIKIWRVNDGQL 1552

Query: 473  IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
            +RTL+GH    T++ F P G+F ASGS D  +KIW    +  I    GH   I++++F+P
Sbjct: 1553 LRTLTGHNDEVTSVNFSPDGQFLASGSTDNTVKIWQTDGR-LIKNITGHGLAIASVKFSP 1611

Query: 653  D 655
            D
Sbjct: 1612 D 1612



 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 43/147 (29%), Positives = 79/147 (53%), Gaps = 2/147 (1%)
 Frame = +2

Query: 233  AHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGK--PTSTSTLSGHTSPVESIAFDSAE 406
            +   NVN + F     + F + G D ++ +W       +S ST+  + + + ++++    
Sbjct: 1430 SQKSNVNSVSFNPDG-KTFASAGWDGNITIWQRETLAHSSLSTIQKNQNIITTVSYSPDG 1488

Query: 407  ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
              +A  S+   IKLWD +  ++I+TL+GH+   T L FHP  +  ASGS D  +KIW + 
Sbjct: 1489 KTIATASADNTIKLWDSQTQQLIKTLTGHKDRITTLSFHPDNQTIASGSADKTIKIWRVN 1548

Query: 587  KKGCIHTYKGHTRGISTIRFTPDGRWV 667
                + T  GH   ++++ F+PDG+++
Sbjct: 1549 DGQLLRTLTGHNDEVTSVNFSPDGQFL 1575



 Score = 74.7 bits (182), Expect = 1e-12
 Identities = 42/151 (27%), Positives = 79/151 (52%)
 Frame = +2

Query: 218  LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
            ++ F  H+  V  + F   + +  ++   D ++ LW I   +  +T + H   V SI+F 
Sbjct: 1224 IKTFPGHTDIVTDVVFSPDS-KTIVSSSLDKTIKLWRIDG-SIINTWNAHNGWVNSISFS 1281

Query: 398  SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                ++A+G    L+KLW   +  +I+TL+GH+   T+++F P G+  AS S D  +K W
Sbjct: 1282 PDGKMIASGGEDNLVKLWQATNGHLIKTLTGHKERITSVKFSPDGKILASASGDKTIKFW 1341

Query: 578  DIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            +   K  + T   H + +++I F+ D + +V
Sbjct: 1342 NTDGK-FLKTIAAHNQQVNSINFSSDSKTLV 1371



 Score = 70.1 bits (170), Expect = 3e-11
 Identities = 36/117 (30%), Positives = 60/117 (51%), Gaps = 7/117 (5%)
 Frame = +2

Query: 305  DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
            D+++ LW +      + L+GH   V S++F     ++A+GS+   IKLW+L +  +++TL
Sbjct: 1622 DNTIKLWQVTDGKLINNLNGHIDGVTSLSFSPDGEILASGSADNTIKLWNLPNATLLKTL 1681

Query: 485  SGHRSYCTALEFHPFGEFFASGSMDTNLKIW-----DIRKKGC--IHTYKGHTRGIS 634
             GH      L F P G+   SG  D  + +W     D+ ++GC  I  Y  H   +S
Sbjct: 1682 LGHPGKINTLAFSPDGKTLLSGGEDAGVMVWNLDLDDLMQQGCDRITDYLQHNSNVS 1738



 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 42/162 (25%), Positives = 75/162 (46%), Gaps = 11/162 (6%)
 Frame = +2

Query: 215  KLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAF 394
            ++     H+  VN + F     ++  +  DD +V LW I     T T++     V +IAF
Sbjct: 1129 EINRLQGHAQQVNAVSFSPDG-KVLASASDDRTVKLWDIHGQLIT-TITASQKRVTAIAF 1186

Query: 395  DSAEILVAAGSSSGLIKLWDLEDT-----------KMIRTLSGHRSYCTALEFHPFGEFF 541
                  +A  ++   IKL+ L+ +           ++I+T  GH    T + F P  +  
Sbjct: 1187 SHNGKYLATANADYTIKLYALDTSCLIVNNLQKCIQLIKTFPGHTDIVTDVVFSPDSKTI 1246

Query: 542  ASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
             S S+D  +K+W I     I+T+  H   +++I F+PDG+ +
Sbjct: 1247 VSSSLDKTIKLWRI-DGSIINTWNAHNGWVNSISFSPDGKMI 1287



 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 39/156 (25%), Positives = 75/156 (48%), Gaps = 2/156 (1%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSI-GKPTSTSTLSGHTSP 376
            A  G+ ++    H   +  ++F     ++  +   D ++  W+  GK     T++ H   
Sbjct: 1301 ATNGHLIKTLTGHKERITSVKFSPDG-KILASASGDKTIKFWNTDGK--FLKTIAAHNQQ 1357

Query: 377  VESIAFDS-AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGS 553
            V SI F S ++ LV+AG+ S + K+W ++ T +I+T+SG       + F P  +  AS S
Sbjct: 1358 VNSINFSSDSKTLVSAGADSTM-KVWKIDGT-LIKTISGRGEQIRDVTFSPDNKVIASAS 1415

Query: 554  MDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
             D  ++I  +  +      K     ++++ F PDG+
Sbjct: 1416 SDKTVRIRQLNYQ------KSQKSNVNSVSFNPDGK 1445



 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 31/126 (24%), Positives = 63/126 (50%), Gaps = 11/126 (8%)
 Frame = +2

Query: 326  SIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYC 505
            +I      + L GH   V +++F     ++A+ S    +KLWD+   ++I T++  +   
Sbjct: 1123 AIANTQEINRLQGHAQQVNAVSFSPDGKVLASASDDRTVKLWDIHG-QLITTITASQKRV 1181

Query: 506  TALEFHPFGEFFASGSMDTNLKIWDI--------RKKGCIH---TYKGHTRGISTIRFTP 652
            TA+ F   G++ A+ + D  +K++ +          + CI    T+ GHT  ++ + F+P
Sbjct: 1182 TAIAFSHNGKYLATANADYTIKLYALDTSCLIVNNLQKCIQLIKTFPGHTDIVTDVVFSP 1241

Query: 653  DGRWVV 670
            D + +V
Sbjct: 1242 DSKTIV 1247



 Score = 37.7 bits (86), Expect = 0.18
 Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 1/85 (1%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  +     H   V  L F      +  +G  D+++ LW++   T   TL GH   + ++
Sbjct: 1633 GKLINNLNGHIDGVTSLSFSPDG-EILASGSADNTIKLWNLPNATLLKTLLGHPGKINTL 1691

Query: 389  AFD-SAEILVAAGSSSGLIKLWDLE 460
            AF    + L++ G  +G + +W+L+
Sbjct: 1692 AFSPDGKTLLSGGEDAG-VMVWNLD 1715



>sp|O75529|TA5L_HUMAN TAF5-like RNA polymerase II
           p300/CBP-associated factor-associated factor 65 kDa
           subunit 5L (PCAF associated factor 65 beta) (PAF65-
           beta).>gb:AF069736_1880710 Homo sapiens PCAF associated
           factor 65 beta mRNA, complete cds.>gb:HSDJ613A2_2012278
           Human DNA sequence from clone RP4-613A2 on chromosome
           1q42.11-42.3 Contains the 5' end of the NUP133 gene, a
           novel gene, the ABCB10 gene for ATP-binding cassette,
           sub-family B (MDR/TAP), member 10, a high-mobility group
           nucleosomal binding domain 2 (HMGN2) pseudogene, the
           TAF5L gene for TAF5-like RNA polymerase II,
           p300/CBP-associated factor (PCAF)-associated factor,
           65kDa, the 5' end of a novel gene (KIAA0133) and three
           CpG islands, complete sequence.
          Length = 589

 Score = 88.2 bits (217), Expect = 1e-16
 Identities = 48/158 (30%), Positives = 74/158 (46%), Gaps = 11/158 (6%)
 Frame = +2

Query: 206 RGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVES 385
           R Y L+ +  H  +V+C++F   +     TG  D +V LWS  +  S    +GH  PV S
Sbjct: 415 RTYPLRIYAGHLADVDCVKFHPNS-NYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLS 473

Query: 386 IAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTN 565
           +AF      +A+      +KLWDL    + + L GH    T+L F P     AS SMD +
Sbjct: 474 LAFSPNGKYLASAGEDQRLKLWDLASGTLYKELRGHTDNITSLTFSPDSGLIASASMDNS 533

Query: 566 LKIWDIRKKGC-----------IHTYKGHTRGISTIRF 646
           +++WDIR   C           +  Y G    + +++F
Sbjct: 534 VRVWDIRNTYCSAPADGSSSELVGVYTGQMSNVLSVQF 571



 Score = 82.4 bits (202), Expect = 6e-15
 Identities = 37/123 (30%), Positives = 61/123 (49%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F +G  D +  LWS  +       +GH + V+ + F      +A GS+   ++LW  +  
Sbjct: 399 FASGSHDRTARLWSFDRTYPLRIYAGHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQG 458

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
             +R  +GHR    +L F P G++ AS   D  LK+WD+         +GHT  I+++ F
Sbjct: 459 NSVRLFTGHRGPVLSLAFSPNGKYLASAGEDQRLKLWDLASGTLYKELRGHTDNITSLTF 518

Query: 647 TPD 655
           +PD
Sbjct: 519 SPD 521



 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 39/153 (25%), Positives = 76/153 (49%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +++    H G V   RF   +  + L+  +D S+  W +G  T+T    GH  PV  +
Sbjct: 332 GTEMKILRGHCGPVYSTRFLADSSGL-LSCSEDMSIRYWDLGSFTNTVLYQGHAYPVWDL 390

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
                 +  A+GS     +LW  + T  +R  +GH +    ++FHP   + A+GS D  +
Sbjct: 391 DISPYSLYFASGSHDRTARLWSFDRTYPLRIYAGHLADVDCVKFHPNSNYLATGSTDKTV 450

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           ++W  ++   +  + GH   + ++ F+P+G+++
Sbjct: 451 RLWSAQQGNSVRLFTGHRGPVLSLAFSPNGKYL 483



>gb:BC077313_2560027 Xenopus laevis TAF5-like RNA polymerase II,
           p300/CBP-associated factor (PCAF)-associated factor,
           65kDa, mRNA (cDNA clone MGC:80243 IMAGE:5048667),
           complete cds.
          Length = 587

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 47/158 (29%), Positives = 74/158 (46%), Gaps = 11/158 (6%)
 Frame = +2

Query: 206 RGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVES 385
           R + L+ +  H  +V+C++F   +     TG  D +V LWS  +  S    +GH  PV +
Sbjct: 413 RTFPLRIYAGHLSDVDCIKFHPNS-NYLATGSSDKTVRLWSTQQGNSVRLFTGHRGPVLT 471

Query: 386 IAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTN 565
           +AF      +A+      +KLWDL      + L GH    ++L F P     AS SMD +
Sbjct: 472 LAFSPNGKYLASAGEDQRLKLWDLASGTQYKELRGHTDNISSLTFSPDSSLIASASMDNS 531

Query: 566 LKIWDIRKKGC-----------IHTYKGHTRGISTIRF 646
           +++WDIR   C           +  Y G T  I +++F
Sbjct: 532 VRVWDIRNSYCNTPSDGSSSELVGVYTGQTSNILSVQF 569



 Score = 79.7 bits (195), Expect = 4e-14
 Identities = 39/123 (31%), Positives = 58/123 (47%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F +   D +  LW   +       +GH S V+ I F      +A GSS   ++LW  +  
Sbjct: 397 FASASHDRTGRLWCFDRTFPLRIYAGHLSDVDCIKFHPNSNYLATGSSDKTVRLWSTQQG 456

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
             +R  +GHR     L F P G++ AS   D  LK+WD+         +GHT  IS++ F
Sbjct: 457 NSVRLFTGHRGPVLTLAFSPNGKYLASAGEDQRLKLWDLASGTQYKELRGHTDNISSLTF 516

Query: 647 TPD 655
           +PD
Sbjct: 517 SPD 519



 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 40/153 (26%), Positives = 76/153 (49%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +++    HSG V    F   +  + L+  +D S+  W++   T+T    GHT PV  +
Sbjct: 330 GTEMKILRGHSGPVYRTCFLSDSSGL-LSCSEDTSIRYWNLESYTNTVLYQGHTYPVWDL 388

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
                 +  A+ S     +LW  + T  +R  +GH S    ++FHP   + A+GS D  +
Sbjct: 389 DVSPCSLFFASASHDRTGRLWCFDRTFPLRIYAGHLSDVDCIKFHPNSNYLATGSSDKTV 448

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           ++W  ++   +  + GH   + T+ F+P+G+++
Sbjct: 449 RLWSTQQGNSVRLFTGHRGPVLTLAFSPNGKYL 481



>gb:BC075548_2558648 Xenopus tropicalis MGC89488 protein, mRNA (cDNA
           clone MGC:89488 IMAGE:6992155), complete cds.
          Length = 379

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 40/146 (27%), Positives = 76/146 (52%)
 Frame = +2

Query: 233 AHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEIL 412
           AH+  V C+ F       F+T  DD S+  W++ +     +L+ HT+ V    F     L
Sbjct: 100 AHTAVVRCVNFSSDG-HTFITASDDKSIKAWNLHRQRFLYSLTEHTNWVRCARFSPDGRL 158

Query: 413 VAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKK 592
           +A+ S    +++WD+ +   I T   ++ +   ++F+P G   AS  +D+ +K+WDIR  
Sbjct: 159 IASCSDDKTVRIWDITNRLCINTFVDYKGHSNYVDFNPMGTCVASAGVDSTVKVWDIRTN 218

Query: 593 GCIHTYKGHTRGISTIRFTPDGRWVV 670
             +  Y+ H  G++++ F P G +++
Sbjct: 219 KLLQHYQVHNAGVNSLSFHPSGNYLL 244



 Score = 72.8 bits (177), Expect = 5e-12
 Identities = 47/157 (29%), Positives = 71/157 (45%), Gaps = 3/157 (1%)
 Frame = +2

Query: 206 RGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVES 385
           R YK   +  H   V C++F      +  +   D +V LW+      +S L  HT+ V  
Sbjct: 52  RAYK---YPGHKEAVTCVQFSPSG-HLVASSSKDRTVRLWAPNIKGESSVLKAHTAVVRC 107

Query: 386 IAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTN 565
           + F S        S    IK W+L   + + +L+ H ++     F P G   AS S D  
Sbjct: 108 VNFSSDGHTFITASDDKSIKAWNLHRQRFLYSLTEHTNWVRCARFSPDGRLIASCSDDKT 167

Query: 566 LKIWDIRKKGCIHT---YKGHTRGISTIRFTPDGRWV 667
           ++IWDI  + CI+T   YKGH+   + + F P G  V
Sbjct: 168 VRIWDITNRLCINTFVDYKGHS---NYVDFNPMGTCV 201



 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 37/147 (25%), Positives = 65/147 (44%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           L     H+  V C RF     R+  +  DD +V +W I      +T   +      + F+
Sbjct: 137 LYSLTEHTNWVRCARFSPDG-RLIASCSDDKTVRIWDITNRLCINTFVDYKGHSNYVDFN 195

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                VA+      +K+WD+   K+++    H +   +L FHP G +  + S D  +KI 
Sbjct: 196 PMGTCVASAGVDSTVKVWDIRTNKLLQHYQVHNAGVNSLSFHPSGNYLLTASNDGTVKIL 255

Query: 578 DIRKKGCIHTYKGHTRGISTIRFTPDG 658
           D+ +   I+T  GH   + ++ F+  G
Sbjct: 256 DLLEGRLIYTLHGHQGPVLSVAFSKSG 282



 Score = 59.3 bits (142), Expect = 6e-08
 Identities = 34/149 (22%), Positives = 61/149 (40%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           + F  H   V  + F     +   +   D  V +W+    +      GH   V  + F  
Sbjct: 12  RHFKGHKDAVTYVDFSPDG-KQLASSSADACVMIWNFKPQSRAYKYPGHKEAVTCVQFSP 70

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
           +  LVA+ S    ++LW          L  H +    + F   G  F + S D ++K W+
Sbjct: 71  SGHLVASSSKDRTVRLWAPNIKGESSVLKAHTAVVRCVNFSSDGHTFITASDDKSIKAWN 130

Query: 581 IRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           + ++  +++   HT  +   RF+PDGR +
Sbjct: 131 LHRQRFLYSLTEHTNWVRCARFSPDGRLI 159



 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 34/121 (28%), Positives = 59/121 (48%), Gaps = 1/121 (0%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKK-TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAF 394
           +  FV + G+ N + F    TC    + G D +V +W I           H + V S++F
Sbjct: 179 INTFVDYKGHSNYVDFNPMGTC--VASAGVDSTVKVWDIRTNKLLQHYQVHNAGVNSLSF 236

Query: 395 DSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI 574
             +   +   S+ G +K+ DL + ++I TL GH+    ++ F   G+ FASG+ D  + +
Sbjct: 237 HPSGNYLLTASNDGTVKILDLLEGRLIYTLHGHQGPVLSVAFSKSGDQFASGATDAQVLV 296

Query: 575 W 577
           W
Sbjct: 297 W 297



 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 27/107 (25%), Positives = 44/107 (41%)
 Frame = +2

Query: 338 PTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALE 517
           P       GH   V  + F      +A+ S+   + +W+ +         GH+   T ++
Sbjct: 8   PALQRHFKGHKDAVTYVDFSPDGKQLASSSADACVMIWNFKPQSRAYKYPGHKEAVTCVQ 67

Query: 518 FHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           F P G   AS S D  +++W    KG     K HT  +  + F+ DG
Sbjct: 68  FSPSGHLVASSSKDRTVRLWAPNIKGESSVLKAHTAVVRCVNFSSDG 114



 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 23/71 (32%), Positives = 38/71 (53%)
 Frame = +2

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
           LED  + R   GH+   T ++F P G+  AS S D  + IW+ + +   + Y GH   ++
Sbjct: 5   LEDPALQRHFKGHKDAVTYVDFSPDGKQLASSSADACVMIWNFKPQSRAYKYPGHKEAVT 64

Query: 635 TIRFTPDGRWV 667
            ++F+P G  V
Sbjct: 65  CVQFSPSGHLV 75



>gb:AF306867_1260835 Aedes triseriatus unknown mRNA.
          Length = 177

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 39/126 (30%), Positives = 70/126 (55%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +GG D  +N++ +       TL GH   V S+ F     ++   S  G +KL+D+  + +
Sbjct: 51  SGGIDGIINIFDVAAGKVAQTLEGHAMSVRSLCFSPDSQMLLTASDDGHMKLYDVAHSDV 110

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           + TLSGH S+  ++ F   G+ FAS S D  +KIW++ ++ C+HT+  H   +  ++++P
Sbjct: 111 VGTLSGHSSWVLSVSFSGDGKSFASSSSDKTVKIWNVAERQCLHTFSDHQDQVWGVKYSP 170

Query: 653 DGRWVV 670
           D   V+
Sbjct: 171 DSSKVI 176



 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 32/129 (24%), Positives = 65/129 (50%), Gaps = 2/129 (1%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSI--GKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           +  ++G  +  ++L+S+  GKP            + SIA+      +A+G   G+I ++D
Sbjct: 4   KYIISGSHEGKISLYSVESGKPEQVLDPQNGKFTL-SIAYSPDGKYIASGGIDGIINIFD 62

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
           +   K+ +TL GH     +L F P  +   + S D ++K++D+     + T  GH+  + 
Sbjct: 63  VAAGKVAQTLEGHAMSVRSLCFSPDSQMLLTASDDGHMKLYDVAHSDVVGTLSGHSSWVL 122

Query: 635 TIRFTPDGR 661
           ++ F+ DG+
Sbjct: 123 SVSFSGDGK 131



 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 30/106 (28%), Positives = 52/106 (49%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G   Q    H+ +V  L F   + +M LT  DD  + L+ +       TLSGH+S V S+
Sbjct: 66  GKVAQTLEGHAMSVRSLCFSPDS-QMLLTASDDGHMKLYDVAHSDVVGTLSGHSSWVLSV 124

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHP 526
           +F       A+ SS   +K+W++ + + + T S H+     +++ P
Sbjct: 125 SFSGDGKSFASSSSDKTVKIWNVAERQCLHTFSDHQDQVWGVKYSP 170



 Score = 45.4 bits (106), Expect = 9e-04
 Identities = 23/87 (26%), Positives = 45/87 (51%), Gaps = 1/87 (1%)
 Frame = +2

Query: 413 VAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT-ALEFHPFGEFFASGSMDTNLKIWDIRK 589
           + +GS  G I L+ +E  K  + L       T ++ + P G++ ASG +D  + I+D+  
Sbjct: 6   IISGSHEGKISLYSVESGKPEQVLDPQNGKFTLSIAYSPDGKYIASGGIDGIINIFDVAA 65

Query: 590 KGCIHTYKGHTRGISTIRFTPDGRWVV 670
                T +GH   + ++ F+PD + ++
Sbjct: 66  GKVAQTLEGHAMSVRSLCFSPDSQMLL 92



>sp|Q9V3J8|WDS_DROME Will die slowly protein.>gb:AE014298_1124067
           Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003424_1209249 Drosophila melanogaster
           chromosome X, section 8 of 74 of the complete
           sequence.>gb:AF233288_1253294 Drosophila melanogaster
           WDS (wds) and egghead (egh) genes, complete
           cds.>gb:AY118386_1300108 Drosophila melanogaster RE31658
           full insert cDNA.>gb:DMBR25B3_1378189 Drosophila
           melanogaster BAC clone BACR25B3.
          Length = 361

 Score = 87.8 bits (216), Expect = 2e-16
 Identities = 45/157 (28%), Positives = 76/157 (48%), Gaps = 1/157 (0%)
 Frame = +2

Query: 203 KRGYKLQEFVA-HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           K  Y L+  +A H+  V+ ++F         +   D  + +W         T+SGH   +
Sbjct: 59  KPNYTLKFTLAGHTKAVSAVKFSPNG-EWLASSSADKLIKIWGAYDGKFEKTISGHKLGI 117

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             +A+ S   L+ +GS    +K+W+L   K ++TL GH +Y     F+P      SGS D
Sbjct: 118 SDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFD 177

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            +++IWD+R   C+ T   H+  +S + F  DG  +V
Sbjct: 178 ESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIV 214



 Score = 82.0 bits (201), Expect = 8e-15
 Identities = 44/158 (27%), Positives = 75/158 (47%), Gaps = 4/158 (2%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L+    HS  V C  F  ++  + ++G  D SV +W +       TL  H+ PV ++
Sbjct: 146 GKSLKTLKGHSNYVFCCNFNPQS-NLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAV 204

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL-SGHRSYCTALEFHPFGEFFASGSMDTN 565
            F+    L+ + S  GL ++WD    + ++TL        + ++F P G++  + ++D  
Sbjct: 205 HFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNT 264

Query: 566 LKIWDIRKKGCIHTYKGHTRG---ISTIRFTPDGRWVV 670
           LK+WD  K  C+ TY GH      I        G+W+V
Sbjct: 265 LKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIV 302



 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 36/131 (27%), Positives = 68/131 (51%), Gaps = 1/131 (0%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
           R+ ++G DD ++ +W +    S  TL GH++ V    F+    L+ +GS    +++WD+ 
Sbjct: 127 RLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVR 186

Query: 461 DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHT-YKGHTRGIST 637
             K ++TL  H    +A+ F+  G    S S D   +IWD     C+ T        +S 
Sbjct: 187 TGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSF 246

Query: 638 IRFTPDGRWVV 670
           ++F+P+G++++
Sbjct: 247 VKFSPNGKYIL 257



 Score = 43.9 bits (102), Expect = 0.003
 Identities = 23/97 (23%), Positives = 45/97 (46%), Gaps = 6/97 (6%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEIL----VAAGSSSGLIKLWDLEDTKM 472
           D+++ LW   K     T +GH +    I F +  +     + +GS   ++ +W+L+  ++
Sbjct: 262 DNTLKLWDYSKGKCLKTYTGHKNEKYCI-FANFSVTGGKWIVSGSEDNMVYIWNLQSKEV 320

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSM--DTNLKIW 577
           ++ L GH         HP     AS ++  D  +K+W
Sbjct: 321 VQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLW 357



 Score = 35.8 bits (81), Expect = 0.69
 Identities = 21/86 (24%), Positives = 38/86 (44%), Gaps = 4/86 (4%)
 Frame = +2

Query: 206 RGYKLQEFVAHSGNVNCL--RFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           +G  L+ +  H     C+   F     +  ++G +D+ V +W++        L GHT  V
Sbjct: 272 KGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTV 331

Query: 380 ESIAFDSAEILVAAGS--SSGLIKLW 451
              A    E ++A+ +  +   IKLW
Sbjct: 332 LCTACHPTENIIASAALENDKTIKLW 357



>gb:AC135228_1742183 Oryza sativa chromosome 3 BAC OSJNBb0122C16
           genomic sequence, complete sequence.
          Length = 380

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 48/165 (29%), Positives = 82/165 (49%), Gaps = 11/165 (6%)
 Frame = +2

Query: 209 GYKLQEFVA-HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTS-TSTLSGHTSPVE 382
           GY L+  +A H   V+ ++F     R+  +   D  + +WS     S  + L+GH   V 
Sbjct: 8   GYALRATLAGHRRAVSAVKFSPDG-RLLASASADKLLRVWSTSDLASPVAELAGHGEGVS 66

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLED---------TKMIRTLSGHRSYCTALEFHPFGE 535
            +AF     L+A+ S    +++WDL D          ++++TLSGH +Y   L F P G 
Sbjct: 67  DLAFSPDGRLIASASDDRTVRIWDLGDGGGGGGGGEPRLMKTLSGHTNYAFCLAFSPHGN 126

Query: 536 FFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
             ASGS D  +++W++R   C+     H+  ++++ F  DG  +V
Sbjct: 127 MLASGSFDETVRVWEVRSGRCLRVLPAHSEPVTSVDFNRDGAMIV 171



 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 45/159 (28%), Positives = 77/159 (48%), Gaps = 10/159 (6%)
 Frame = +2

Query: 224 EFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIG---------KPTSTSTLSGHTSP 376
           E   H   V+ L F     R+  +  DD +V +W +G         +P    TLSGHT+ 
Sbjct: 57  ELAGHGEGVSDLAFSPDG-RLIASASDDRTVRIWDLGDGGGGGGGGEPRLMKTLSGHTNY 115

Query: 377 VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM 556
              +AF     ++A+GS    +++W++   + +R L  H    T+++F+  G    SGS 
Sbjct: 116 AFCLAFSPHGNMLASGSFDETVRVWEVRSGRCLRVLPAHSEPVTSVDFNRDGAMIVSGSY 175

Query: 557 DTNLKIWDIRKKGCIHT-YKGHTRGISTIRFTPDGRWVV 670
           D   +IWD     CI T     +  +S  +F+P+G++V+
Sbjct: 176 DGLCRIWDSATGHCIKTLIDDESPPVSFAKFSPNGKFVL 214



 Score = 44.7 bits (104), Expect = 0.001
 Identities = 26/91 (28%), Positives = 41/91 (45%), Gaps = 5/91 (5%)
 Frame = +2

Query: 320 LWSIGKPTSTSTLSGHTSPVESI--AFDSAE-ILVAAGSSSGLIKLWDLEDTKMIRTLSG 490
           LW+        T +GH +    I  AF       + +GS    + +WDL+  K+++ L G
Sbjct: 280 LWNFSAGKFLKTYTGHVNTKYCIPAAFSITNGKYIVSGSEDKCVYIWDLQSRKILQKLEG 339

Query: 491 HRSYCTALEFHPFGEFFASGSM--DTNLKIW 577
           H     A+  HP     ASG +  D  +K+W
Sbjct: 340 HTDTVIAVSCHPNENMIASGGLDGDKTVKVW 370



 Score = 42.4 bits (98), Expect = 0.007
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 3/74 (4%)
 Frame = +2

Query: 443 KLWDLEDTKMIRTLSGH--RSYCTALEFH-PFGEFFASGSMDTNLKIWDIRKKGCIHTYK 613
           +LW+    K ++T +GH    YC    F    G++  SGS D  + IWD++ +  +   +
Sbjct: 279 RLWNFSAGKFLKTYTGHVNTKYCIPAAFSITNGKYIVSGSEDKCVYIWDLQSRKILQKLE 338

Query: 614 GHTRGISTIRFTPD 655
           GHT  +  +   P+
Sbjct: 339 GHTDTVIAVSCHPN 352



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 20/85 (23%), Positives = 37/85 (43%), Gaps = 4/85 (4%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCL--RFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           G  L+ +  H     C+   F     +  ++G +D  V +W +        L GHT  V 
Sbjct: 286 GKFLKTYTGHVNTKYCIPAAFSITNGKYIVSGSEDKCVYIWDLQSRKILQKLEGHTDTVI 345

Query: 383 SIAFDSAEILVAAGSSSG--LIKLW 451
           +++    E ++A+G   G   +K+W
Sbjct: 346 AVSCHPNENMIASGGLDGDKTVKVW 370



>gb:AE014297_1138788 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003685_1220781 Drosophila melanogaster
           chromosome 3R, section 23 of 118 of the complete
           sequence.>gb:AF132174_1243586 Drosophila melanogaster
           clone LD21537 unknown mRNA.
          Length = 331

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 40/120 (33%), Positives = 66/120 (55%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +G  D  + ++ +       TL GH  PV S+ F     L+   S  G +KL+D+  + +
Sbjct: 187 SGAIDGIITIFDVAAGKVVQTLEGHAMPVRSLCFSPNSQLLLTASDDGHMKLYDVTHSDV 246

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           + TLSGH S+   + F   G+ FAS S D ++KIWD  ++ C+HT+  HT  +  +R++P
Sbjct: 247 VGTLSGHASWVLCVAFSEDGKHFASSSSDNSVKIWDTSERKCLHTFAEHTDQVWGVRYSP 306



 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 31/125 (24%), Positives = 64/125 (51%), Gaps = 1/125 (0%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE-SIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           ++G +D  ++++S+    +  TL         SIA+      +A+G+  G+I ++D+   
Sbjct: 143 ISGLNDGKISMYSVETGKAEQTLDAQNGKYTLSIAYSPDGKYIASGAIDGIITIFDVAAG 202

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
           K+++TL GH     +L F P  +   + S D ++K++D+     + T  GH   +  + F
Sbjct: 203 KVVQTLEGHAMPVRSLCFSPNSQLLLTASDDGHMKLYDVTHSDVVGTLSGHASWVLCVAF 262

Query: 647 TPDGR 661
           + DG+
Sbjct: 263 SEDGK 267



 Score = 59.3 bits (142), Expect = 6e-08
 Identities = 36/123 (29%), Positives = 56/123 (45%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  +Q    H+  V  L F   + ++ LT  DD  + L+ +       TLSGH S V  +
Sbjct: 202 GKVVQTLEGHAMPVRSLCFSPNS-QLLLTASDDGHMKLYDVTHSDVVGTLSGHASWVLCV 260

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           AF       A+ SS   +K+WD  + K + T + H      + + P  +  AS S D +L
Sbjct: 261 AFSEDGKHFASSSSDNSVKIWDTSERKCLHTFAEHTDQVWGVRYSPGNDKVASASEDKSL 320

Query: 569 KIW 577
            I+
Sbjct: 321 NIY 323



 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 32/132 (24%), Positives = 56/132 (42%), Gaps = 11/132 (8%)
 Frame = +2

Query: 308 HSVNLWSI--GKPTSTSTLSGHTSPVESIAFD------SAEILVAAGSSSGLIKLWDLED 463
           H   LW+   G+ T+ S         E   FD        +  +  G    L+K+WDL++
Sbjct: 12  HDSQLWACTWGRDTAASDPDDAVVEPEENPFDFDKKEARPKDFLVTGGLDDLVKVWDLQE 71

Query: 464 T---KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
               K+   L GH     ++     G+  AS S+D+ + +WD R     H        + 
Sbjct: 72  DNTLKLRHKLKGHALGVVSVAVSSDGQTIASSSLDSTMCLWDARSGDKKHLLSFGPVDLW 131

Query: 635 TIRFTPDGRWVV 670
           T++F+P  ++V+
Sbjct: 132 TVQFSPCNKYVI 143



>sp|Q91WQ5|TA5L_MOUSE TAF5-like RNA polymerase II
           p300/CBP-associated factor-associated factor 65 kDa
           subunit 5L (PCAF associated factor 65 beta) (PAF65-
           beta).>gb:AK033477_1163354 Mus musculus adult male colon
           cDNA, RIKEN full-length enriched library,
           clone:9030217F08 product:PCAF ASSOCIATED FACTOR 65 BETA
           (PUTATIVE TRANSCRIPTION FACTOR) homolog [Homo sapiens],
           full insert sequence.>gb:BC013550_2091832 Mus musculus
           TAF5-like RNA polymerase II, p300/CBP-associated factor
           (PCAF)-associated factor, mRNA (cDNA clone MGC:19341
           IMAGE:4222283), complete cds.
          Length = 589

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 47/158 (29%), Positives = 74/158 (46%), Gaps = 11/158 (6%)
 Frame = +2

Query: 206 RGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVES 385
           R Y L+ +  H  +V+C++F   +     TG  D +V LWS  +  S    +GH  PV S
Sbjct: 415 RTYPLRIYAGHLADVDCVKFHPNS-NYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLS 473

Query: 386 IAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTN 565
           ++F      +A+      +KLWDL    + + L GH    T+L F P     AS SMD +
Sbjct: 474 LSFSPNGKYLASAGEDQRLKLWDLASGTLFKELRGHTDSITSLAFSPDSGLIASASMDNS 533

Query: 566 LKIWDIRKKGC-----------IHTYKGHTRGISTIRF 646
           +++WDIR   C           +  Y G    + +++F
Sbjct: 534 VRVWDIRSTCCNTPADGSSGELVGVYTGQMSNVLSVQF 571



 Score = 83.2 bits (204), Expect = 4e-15
 Identities = 37/123 (30%), Positives = 61/123 (49%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F +G  D +  LWS  +       +GH + V+ + F      +A GS+   ++LW  +  
Sbjct: 399 FASGSHDRTARLWSFDRTYPLRIYAGHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQG 458

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
             +R  +GHR    +L F P G++ AS   D  LK+WD+         +GHT  I+++ F
Sbjct: 459 NSVRLFTGHRGPVLSLSFSPNGKYLASAGEDQRLKLWDLASGTLFKELRGHTDSITSLAF 518

Query: 647 TPD 655
           +PD
Sbjct: 519 SPD 521



 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 39/153 (25%), Positives = 76/153 (49%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +++    H G V   RF   +  + L+  +D S+  W +G  T+T    GH  PV  +
Sbjct: 332 GTEMKILRGHCGPVYSTRFLADSSGL-LSCSEDMSIRYWDLGSFTNTVLYQGHAYPVWDV 390

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
                 +  A+GS     +LW  + T  +R  +GH +    ++FHP   + A+GS D  +
Sbjct: 391 DISPFSLYFASGSHDRTARLWSFDRTYPLRIYAGHLADVDCVKFHPNSNYLATGSTDKTV 450

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           ++W  ++   +  + GH   + ++ F+P+G+++
Sbjct: 451 RLWSAQQGNSVRLFTGHRGPVLSLSFSPNGKYL 483



>gb:AF044334_2052254 Mus musculus pleiotropic regulator 1 (PLRG1)
           mRNA, complete cds.
          Length = 513

 Score = 87.0 bits (214), Expect = 3e-16
 Identities = 44/145 (30%), Positives = 72/145 (49%), Gaps = 1/145 (0%)
 Frame = +2

Query: 212 YKLQEFVA-HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           +KL   ++ H G V C+       + F+TG  D ++ +W +       +L+GH S V  +
Sbjct: 193 WKLYRVISGHLGWVRCIAVEPGN-QWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGV 251

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
              +    + +      +K WDLE  K+IR   GH S    L+ HP  +   + S D+  
Sbjct: 252 IVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTLDVLVTCSRDSTA 311

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIR 643
           +IWD+R K  +HT  GHT  ++T+R
Sbjct: 312 RIWDVRTKASVHTLSGHTNAVATVR 336



 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 45/128 (35%), Positives = 62/128 (48%)
 Frame = +2

Query: 275 TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           T  + +T   D +  +W +    S  TLSGHT+ V ++   +AE  +  GS    I+LWD
Sbjct: 298 TLDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWD 357

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
           L   K   TL+ H+    A+  HP    FASGS D N+K W     G I    GH   I+
Sbjct: 358 LVAGKTRVTLTNHKKSVRAVVLHPLLYTFASGSPD-NIKQWKFPDGGFIQNLSGHNAIIN 416

Query: 635 TIRFTPDG 658
           T+    DG
Sbjct: 417 TLAVNADG 424



>gb:BC020786_1977204 Homo sapiens pleiotropic regulator 1 (PRL1
           homolog, Arabidopsis), mRNA (cDNA clone MGC:22797
           IMAGE:4809482), complete cds.
          Length = 505

 Score = 87.0 bits (214), Expect = 3e-16
 Identities = 44/145 (30%), Positives = 72/145 (49%), Gaps = 1/145 (0%)
 Frame = +2

Query: 212 YKLQEFVA-HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           +KL   ++ H G V C+       + F+TG  D ++ +W +       +L+GH S V  +
Sbjct: 185 WKLYRVISGHLGWVRCIAVEPGN-QWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGV 243

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
              +    + +      +K WDLE  K+IR   GH S    L+ HP  +   + S D+  
Sbjct: 244 IVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTA 303

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIR 643
           +IWD+R K  +HT  GHT  ++T+R
Sbjct: 304 RIWDVRTKASVHTLSGHTNAVATVR 328



 Score = 75.5 bits (184), Expect = 8e-13
 Identities = 44/128 (34%), Positives = 61/128 (47%)
 Frame = +2

Query: 275 TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           T  + +T   D +  +W +    S  TLSGHT+ V ++   +AE  +  GS    I+LWD
Sbjct: 290 TIDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWD 349

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
           L   K   TL+ H+    A+  HP    FASGS D N+K W       I    GH   I+
Sbjct: 350 LVAGKTRVTLTNHKKSVRAVVLHPRHYTFASGSPD-NIKQWKFPDGSFIQNLSGHNAIIN 408

Query: 635 TIRFTPDG 658
           T+    DG
Sbjct: 409 TLTVNSDG 416



>gb:AK089463_1175945 Mus musculus B6-derived CD11 +ve dendritic
           cells cDNA, RIKEN full-length enriched library,
           clone:F730035H20 product:PCAF ASSOCIATED FACTOR 65 BETA
           (PUTATIVE TRANSCRIPTION FACTOR) homolog [Homo sapiens],
           full insert sequence.
          Length = 560

 Score = 87.0 bits (214), Expect = 3e-16
 Identities = 44/131 (33%), Positives = 66/131 (50%)
 Frame = +2

Query: 206 RGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVES 385
           R Y L+ +  H  +V+C++F   +     TG  D +V LWS  +  S    +GH  PV S
Sbjct: 415 RTYPLRIYAGHLADVDCVKFHPNS-NYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLS 473

Query: 386 IAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTN 565
           ++F      +A+      +KLWDL    + + L GH    T+L F P     AS SMD +
Sbjct: 474 LSFSPNGKYLASAGEDQRLKLWDLASGTLFKELRGHTDSITSLAFSPDSGLIASASMDNS 533

Query: 566 LKIWDIRKKGC 598
           +++WDIR   C
Sbjct: 534 VRVWDIRSTCC 544



 Score = 83.2 bits (204), Expect = 4e-15
 Identities = 37/123 (30%), Positives = 61/123 (49%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F +G  D +  LWS  +       +GH + V+ + F      +A GS+   ++LW  +  
Sbjct: 399 FASGSHDRTARLWSFDRTYPLRIYAGHLADVDCVKFHPNSNYLATGSTDKTVRLWSAQQG 458

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
             +R  +GHR    +L F P G++ AS   D  LK+WD+         +GHT  I+++ F
Sbjct: 459 NSVRLFTGHRGPVLSLSFSPNGKYLASAGEDQRLKLWDLASGTLFKELRGHTDSITSLAF 518

Query: 647 TPD 655
           +PD
Sbjct: 519 SPD 521



 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 39/153 (25%), Positives = 76/153 (49%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +++    H G V   RF   +  + L+  +D S+  W +G  T+T    GH  PV  +
Sbjct: 332 GTEMKILRGHCGPVYSTRFLADSSGL-LSCSEDMSIRYWDLGSFTNTVLYQGHAYPVWDV 390

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
                 +  A+GS     +LW  + T  +R  +GH +    ++FHP   + A+GS D  +
Sbjct: 391 DISPFSLYFASGSHDRTARLWSFDRTYPLRIYAGHLADVDCVKFHPNSNYLATGSTDKTV 450

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           ++W  ++   +  + GH   + ++ F+P+G+++
Sbjct: 451 RLWSAQQGNSVRLFTGHRGPVLSLSFSPNGKYL 483



>sp|Q9WUC8|PLR1_RAT Pleiotropic regulator 1.>gb:AF128241_2055602
           Rattus norvegicus pleiotropic regulator 1 (PLRG1) mRNA,
           complete cds.>gb:BC087742_2110200 Rattus norvegicus
           pleiotropic regulator 1 homolog (Arabidopsis), mRNA
           (cDNA clone MGC:105439 IMAGE:7314208), complete cds.
          Length = 514

 Score = 87.0 bits (214), Expect = 3e-16
 Identities = 44/145 (30%), Positives = 72/145 (49%), Gaps = 1/145 (0%)
 Frame = +2

Query: 212 YKLQEFVA-HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           +KL   ++ H G V C+       + F+TG  D ++ +W +       +L+GH S V  +
Sbjct: 194 WKLYRVISGHLGWVRCIAVEPGN-QWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGV 252

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
              +    + +      +K WDLE  K+IR   GH S    L+ HP  +   + S D+  
Sbjct: 253 IVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTA 312

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIR 643
           +IWD+R K  +HT  GHT  ++T+R
Sbjct: 313 RIWDVRTKASVHTLSGHTNAVATVR 337



 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 45/128 (35%), Positives = 62/128 (48%)
 Frame = +2

Query: 275 TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           T  + +T   D +  +W +    S  TLSGHT+ V ++   +AE  +  GS    I+LWD
Sbjct: 299 TIDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWD 358

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
           L   K   TL+ H+    A+  HP    FASGS D N+K W     G I    GH   I+
Sbjct: 359 LVAGKTRVTLTNHKKSVRAVVLHPLHYTFASGSPD-NIKQWKFPDGGFIQNLSGHNAIIN 417

Query: 635 TIRFTPDG 658
           T+    DG
Sbjct: 418 TLAVNTDG 425



>sp|Q922V4|PLR1_MOUSE Pleiotropic regulator 1.>gb:AK075993_1171153
           Mus musculus 10 days embryo whole body cDNA, RIKEN
           full-length enriched library, clone:2610016P18
           product:pleiotropic regulator 1, PRL1 homolog
           (Arabidopsis), full insert sequence.>gb:AK076007_1171164
           Mus musculus 10 days embryo whole body cDNA, RIKEN
           full-length enriched library, clone:2610028C07
           product:pleiotropic regulator 1, PRL1 homolog
           (Arabidopsis), full insert sequence.>gb:AK077197_1171725
           Mus musculus adult male testis cDNA, RIKEN full-length
           enriched library, clone:4933427K15 product:pleiotropic
           regulator 1, PRL1 homolog (Arabidopsis), full insert
           sequence.>gb:BC006750_2090362 Mus musculus pleiotropic
           regulator 1, PRL1 homolog (Arabidopsis), mRNA (cDNA
           clone MGC:12092 IMAGE:3709134), complete cds.
          Length = 513

 Score = 87.0 bits (214), Expect = 3e-16
 Identities = 44/145 (30%), Positives = 72/145 (49%), Gaps = 1/145 (0%)
 Frame = +2

Query: 212 YKLQEFVA-HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           +KL   ++ H G V C+       + F+TG  D ++ +W +       +L+GH S V  +
Sbjct: 193 WKLYRVISGHLGWVRCIAVEPGN-QWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGV 251

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
              +    + +      +K WDLE  K+IR   GH S    L+ HP  +   + S D+  
Sbjct: 252 IVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTLDVLVTCSRDSTA 311

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIR 643
           +IWD+R K  +HT  GHT  ++T+R
Sbjct: 312 RIWDVRTKASVHTLSGHTNAVATVR 336



 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 45/128 (35%), Positives = 62/128 (48%)
 Frame = +2

Query: 275 TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           T  + +T   D +  +W +    S  TLSGHT+ V ++   +AE  +  GS    I+LWD
Sbjct: 298 TLDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWD 357

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
           L   K   TL+ H+    A+  HP    FASGS D N+K W     G I    GH   I+
Sbjct: 358 LVAGKTRVTLTNHKKSVRAVVLHPLLYTFASGSPD-NIKQWKFPDGGFIQNLSGHNAIIN 416

Query: 635 TIRFTPDG 658
           T+    DG
Sbjct: 417 TLAVNADG 424



>sp|O43660|PLR1_HUMAN Pleiotropic regulator 1.>gb:AX878187_1477336
           Sequence 13092 from Patent
           EP1074617.>gb:AF044333_1878791 Homo sapiens pleiotropic
           regulator 1 (PLRG1) mRNA, complete cds.
          Length = 514

 Score = 87.0 bits (214), Expect = 3e-16
 Identities = 44/145 (30%), Positives = 72/145 (49%), Gaps = 1/145 (0%)
 Frame = +2

Query: 212 YKLQEFVA-HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           +KL   ++ H G V C+       + F+TG  D ++ +W +       +L+GH S V  +
Sbjct: 194 WKLYRVISGHLGWVRCIAVEPGN-QWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGV 252

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
              +    + +      +K WDLE  K+IR   GH S    L+ HP  +   + S D+  
Sbjct: 253 IVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTA 312

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIR 643
           +IWD+R K  +HT  GHT  ++T+R
Sbjct: 313 RIWDVRTKASVHTLSGHTNAVATVR 337



 Score = 75.5 bits (184), Expect = 8e-13
 Identities = 44/128 (34%), Positives = 61/128 (47%)
 Frame = +2

Query: 275 TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           T  + +T   D +  +W +    S  TLSGHT+ V ++   +AE  +  GS    I+LWD
Sbjct: 299 TIDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWD 358

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
           L   K   TL+ H+    A+  HP    FASGS D N+K W       I    GH   I+
Sbjct: 359 LVAGKTRVTLTNHKKSVRAVVLHPRHYTFASGSPD-NIKQWKFPDGSFIQNLSGHNAIIN 417

Query: 635 TIRFTPDG 658
           T+    DG
Sbjct: 418 TLTVNSDG 425



>gb:HSA011376_2000038 Homo sapiens mRNA for hypothetical protein
           (WDR5 gene), partial.
          Length = 362

 Score = 86.7 bits (213), Expect = 3e-16
 Identities = 48/182 (26%), Positives = 81/182 (44%), Gaps = 1/182 (0%)
 Frame = +2

Query: 128 AAAERPTPXXXXXXXXXXXXXXRMAKRGYKLQEFVA-HSGNVNCLRFGKKTCRMFLTGGD 304
           AA  +PTP                 K  Y L+  +A H+  V+ ++F         +   
Sbjct: 40  AARAQPTPSSSATQSKPTP-----VKPNYALKFTLAGHTKAVSSVKFSPNG-EWLASSSA 93

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D  + +W         T+SGH   +  +A+ S   L+ + S    +K+WD+   K ++TL
Sbjct: 94  DKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTL 153

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
            GH +Y     F+P      SGS D +++IWD++   C+ T   H+  +S + F  DG  
Sbjct: 154 KGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSL 213

Query: 665 VV 670
           +V
Sbjct: 214 IV 215



 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 44/158 (27%), Positives = 75/158 (47%), Gaps = 4/158 (2%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L+    HS  V C  F  ++  + ++G  D SV +W +       TL  H+ PV ++
Sbjct: 147 GKCLKTLKGHSNYVFCCNFNPQS-NLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAV 205

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL-SGHRSYCTALEFHPFGEFFASGSMDTN 565
            F+    L+ + S  GL ++WD    + ++TL        + ++F P G++  + ++D  
Sbjct: 206 HFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNT 265

Query: 566 LKIWDIRKKGCIHTYKGHTRG---ISTIRFTPDGRWVV 670
           LK+WD  K  C+ TY GH      I        G+W+V
Sbjct: 266 LKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIV 303



 Score = 72.0 bits (175), Expect = 9e-12
 Identities = 33/130 (25%), Positives = 66/130 (50%), Gaps = 1/130 (0%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  DD ++ +W +       TL GH++ V    F+    L+ +GS    +++WD++ 
Sbjct: 129 LLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKT 188

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHT-YKGHTRGISTI 640
            K ++TL  H    +A+ F+  G    S S D   +IWD     C+ T        +S +
Sbjct: 189 GKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFV 248

Query: 641 RFTPDGRWVV 670
           +F+P+G++++
Sbjct: 249 KFSPNGKYIL 258



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 24/97 (24%), Positives = 46/97 (47%), Gaps = 6/97 (6%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEIL----VAAGSSSGLIKLWDLEDTKM 472
           D+++ LW   K     T +GH +    I F +  +     + +GS   L+ +W+L+  ++
Sbjct: 263 DNTLKLWDYSKGKCLKTYTGHKNEKYCI-FANFSVTGGKWIVSGSEDNLVYIWNLQTKEI 321

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSM--DTNLKIW 577
           ++ L GH     +   HP     AS ++  D  +K+W
Sbjct: 322 VQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW 358



 Score = 36.6 bits (83), Expect = 0.41
 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 4/86 (4%)
 Frame = +2

Query: 206 RGYKLQEFVAHSGNVNCL--RFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           +G  L+ +  H     C+   F     +  ++G +D+ V +W++        L GHT  V
Sbjct: 273 KGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVV 332

Query: 380 ESIAFDSAEILVAAGS--SSGLIKLW 451
            S A    E ++A+ +  +   IKLW
Sbjct: 333 ISTACHPTENIIASAALENDKTIKLW 358



>sp|P61964|WDR5_HUMAN WD-repeat protein 5.>sp|P61965|WDR5_MOUSE
           WD-repeat protein 5 (WD-repeat protein
           BIG-3).>gb:AK075937_1171116 Mus musculus ES cells cDNA,
           RIKEN full-length enriched library, clone:2410008O07
           product:WD repeat protein BIG-3 mRNA, full insert
           sequence.>gb:AX405754_1467682 Sequence 169 from Patent
           WO0222660.>gb:AK000552_1907995 Homo sapiens cDNA
           FLJ20545 fis, clone KAT11476.>gb:BC001635_1967731 Homo
           sapiens WD repeat domain 5, transcript variant 1, mRNA
           (cDNA clone MGC:1025 IMAGE:3538255), complete
           cds.>gb:BX649632_1991884 Human DNA sequence from clone
           LL09NC01-251B2 on chromosome 9, complete
           sequence.>gb:AF416510_2065338 Mus musculus WD repeat
           protein BIG-3 mRNA, complete cds.>gb:BC016103_2092180
           Mus musculus WD repeat domain 5, mRNA (cDNA clone
           MGC:27687 IMAGE:4919781), complete
           cds.>gb:BC025801_2095138 Mus musculus WD repeat domain
           5, mRNA (cDNA clone MGC:36316 IMAGE:5132525), complete
           cds.
          Length = 334

 Score = 86.7 bits (213), Expect = 3e-16
 Identities = 48/182 (26%), Positives = 81/182 (44%), Gaps = 1/182 (0%)
 Frame = +2

Query: 128 AAAERPTPXXXXXXXXXXXXXXRMAKRGYKLQEFVA-HSGNVNCLRFGKKTCRMFLTGGD 304
           AA  +PTP                 K  Y L+  +A H+  V+ ++F         +   
Sbjct: 12  AARAQPTPSSSATQSKPTP-----VKPNYALKFTLAGHTKAVSSVKFSPNG-EWLASSSA 65

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D  + +W         T+SGH   +  +A+ S   L+ + S    +K+WD+   K ++TL
Sbjct: 66  DKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTL 125

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
            GH +Y     F+P      SGS D +++IWD++   C+ T   H+  +S + F  DG  
Sbjct: 126 KGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSL 185

Query: 665 VV 670
           +V
Sbjct: 186 IV 187



 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 44/158 (27%), Positives = 75/158 (47%), Gaps = 4/158 (2%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L+    HS  V C  F  ++  + ++G  D SV +W +       TL  H+ PV ++
Sbjct: 119 GKCLKTLKGHSNYVFCCNFNPQS-NLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAV 177

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL-SGHRSYCTALEFHPFGEFFASGSMDTN 565
            F+    L+ + S  GL ++WD    + ++TL        + ++F P G++  + ++D  
Sbjct: 178 HFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNT 237

Query: 566 LKIWDIRKKGCIHTYKGHTRG---ISTIRFTPDGRWVV 670
           LK+WD  K  C+ TY GH      I        G+W+V
Sbjct: 238 LKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIV 275



 Score = 72.0 bits (175), Expect = 9e-12
 Identities = 33/130 (25%), Positives = 66/130 (50%), Gaps = 1/130 (0%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  DD ++ +W +       TL GH++ V    F+    L+ +GS    +++WD++ 
Sbjct: 101 LLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKT 160

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHT-YKGHTRGISTI 640
            K ++TL  H    +A+ F+  G    S S D   +IWD     C+ T        +S +
Sbjct: 161 GKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFV 220

Query: 641 RFTPDGRWVV 670
           +F+P+G++++
Sbjct: 221 KFSPNGKYIL 230



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 24/97 (24%), Positives = 46/97 (47%), Gaps = 6/97 (6%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEIL----VAAGSSSGLIKLWDLEDTKM 472
           D+++ LW   K     T +GH +    I F +  +     + +GS   L+ +W+L+  ++
Sbjct: 235 DNTLKLWDYSKGKCLKTYTGHKNEKYCI-FANFSVTGGKWIVSGSEDNLVYIWNLQTKEI 293

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSM--DTNLKIW 577
           ++ L GH     +   HP     AS ++  D  +K+W
Sbjct: 294 VQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW 330



 Score = 36.6 bits (83), Expect = 0.41
 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 4/86 (4%)
 Frame = +2

Query: 206 RGYKLQEFVAHSGNVNCL--RFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           +G  L+ +  H     C+   F     +  ++G +D+ V +W++        L GHT  V
Sbjct: 245 KGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVV 304

Query: 380 ESIAFDSAEILVAAGS--SSGLIKLW 451
            S A    E ++A+ +  +   IKLW
Sbjct: 305 ISTACHPTENIIASAALENDKTIKLW 330



>sp|P46800|GBLP_DICDI Guanine nucleotide-binding protein beta
           subunit-like protein.>gb:AC116305_1206126 Dictyostelium
           discoideum chromosome 2 map 1005175-1418323 strain AX4,
           complete sequence.
          Length = 329

 Score = 86.7 bits (213), Expect = 3e-16
 Identities = 48/127 (37%), Positives = 68/127 (53%), Gaps = 4/127 (3%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD-LEDT 466
           L+G  D+++ LW I K  ST    GHT  V S+AF S    + +GS    IK+W+ L + 
Sbjct: 86  LSGSWDNTLRLWDITKGVSTRLFKGHTQDVMSVAFSSDNRQIISGSRDATIKVWNTLGEC 145

Query: 467 KMIRTLSG---HRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIST 637
           K   TL G   H+ + + + F P      SGS D  +KIWDI+   C HT   HT  ++T
Sbjct: 146 KF--TLEGPEAHQDWVSCIRFSPNTPTIVSGSWDNKVKIWDIKSFKCNHTLTDHTGYVNT 203

Query: 638 IRFTPDG 658
           +  +PDG
Sbjct: 204 VTISPDG 210



 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 39/158 (24%), Positives = 71/158 (44%), Gaps = 4/158 (2%)
 Frame = +2

Query: 206 RGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWS-IGKPTSTSTLSG---HTS 373
           +G   + F  H+ +V  + F     R  ++G  D ++ +W+ +G+     TL G   H  
Sbjct: 101 KGVSTRLFKGHTQDVMSVAFSSDN-RQIISGSRDATIKVWNTLGE--CKFTLEGPEAHQD 157

Query: 374 PVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGS 553
            V  I F      + +GS    +K+WD++  K   TL+ H  Y   +   P G   ASG 
Sbjct: 158 WVSCIRFSPNTPTIVSGSWDNKVKIWDIKSFKCNHTLTDHTGYVNTVTISPDGSLCASGG 217

Query: 554 MDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            DT   +W++     ++  +     I+ + F+P+  W+
Sbjct: 218 KDTFACLWELSSGKPLYKLEARNT-INALAFSPNKYWL 254



 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 34/113 (30%), Positives = 53/113 (46%), Gaps = 7/113 (6%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFDSAEI-LVAAGSSSGLIKLWDLEDT------KMIRTLSGHRSYCTA 511
           +L GH   V SIA        + + S    + +W L  T      K  R+L GH  +   
Sbjct: 16  SLVGHNGFVTSIAVSPENPDTIISSSRDKTVMVWQLTPTDATSPGKAHRSLKGHSHFVQD 75

Query: 512 LEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           +     G+F  SGS D  L++WDI K      +KGHT+ + ++ F+ D R ++
Sbjct: 76  VVISHDGQFALSGSWDNTLRLWDITKGVSTRLFKGHTQDVMSVAFSSDNRQII 128



 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 38/156 (24%), Positives = 66/156 (42%), Gaps = 9/156 (5%)
 Frame = +2

Query: 230 VAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTS------TLSGHTSPVESIA 391
           V H+G V  +    +     ++   D +V +W +    +TS      +L GH+  V+ + 
Sbjct: 18  VGHNGFVTSIAVSPENPDTIISSSRDKTVMVWQLTPTDATSPGKAHRSLKGHSHFVQDVV 77

Query: 392 FDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLK 571
                    +GS    ++LWD+      R   GH     ++ F        SGS D  +K
Sbjct: 78  ISHDGQFALSGSWDNTLRLWDITKGVSTRLFKGHTQDVMSVAFSSDNRQIISGSRDATIK 137

Query: 572 IWDIRKKGCIHTYKG---HTRGISTIRFTPDGRWVV 670
           +W+   + C  T +G   H   +S IRF+P+   +V
Sbjct: 138 VWNTLGE-CKFTLEGPEAHQDWVSCIRFSPNTPTIV 172



>gb:BC067651_2554823 Danio rerio cDNA clone IMAGE:6963216, partial
           cds.
          Length = 745

 Score = 86.3 bits (212), Expect = 4e-16
 Identities = 43/124 (34%), Positives = 63/124 (50%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           L+ F  H  +V C RF   +     TG  D +V LW +         +GH  P+ S+AF 
Sbjct: 565 LRIFAGHLADVTCTRFHPNS-NYVATGSSDRTVRLWDVLNGNCVRIFTGHKGPIHSLAFS 623

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                +A+GS+ G + LWD+    MI  L GH     AL+F   GE  ASGS+D  +++W
Sbjct: 624 PNGKFLASGSTDGRVLLWDIGHGLMIAELKGHTGTIYALKFSRDGEIIASGSIDNTVRLW 683

Query: 578 DIRK 589
           D+ +
Sbjct: 684 DVMR 687



 Score = 82.0 bits (201), Expect = 8e-15
 Identities = 43/124 (34%), Positives = 62/124 (50%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F++GG D    LW+          +GH + V    F      VA GSS   ++LWD+ + 
Sbjct: 545 FVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYVATGSSDRTVRLWDVLNG 604

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
             +R  +GH+    +L F P G+F ASGS D  + +WDI     I   KGHT  I  ++F
Sbjct: 605 NCVRIFTGHKGPIHSLAFSPNGKFLASGSTDGRVLLWDIGHGLMIAELKGHTGTIYALKF 664

Query: 647 TPDG 658
           + DG
Sbjct: 665 SRDG 668



 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 39/144 (27%), Positives = 68/144 (47%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           HSG V  + F        L+  +D ++ LWS+   T      GH  PV    F       
Sbjct: 487 HSGPVYGVSFSPDR-NYLLSSSEDGTIRLWSLQTFTCLVGYKGHNYPVWDTQFSPFGYYF 545

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
            +G    + +LW  +  + +R  +GH +  T   FHP   + A+GS D  +++WD+    
Sbjct: 546 VSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYVATGSSDRTVRLWDVLNGN 605

Query: 596 CIHTYKGHTRGISTIRFTPDGRWV 667
           C+  + GH   I ++ F+P+G+++
Sbjct: 606 CVRIFTGHKGPIHSLAFSPNGKFL 629



 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 29/109 (26%), Positives = 49/109 (44%)
 Frame = +2

Query: 341 TSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEF 520
           + +  L GH+ PV  ++F      + + S  G I+LW L+    +    GH       +F
Sbjct: 479 SESKILHGHSGPVYGVSFSPDRNYLLSSSEDGTIRLWSLQTFTCLVGYKGHNYPVWDTQF 538

Query: 521 HPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            PFG +F SG  D   ++W       +  + GH   ++  RF P+  +V
Sbjct: 539 SPFGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVTCTRFHPNSNYV 587



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 22/87 (25%), Positives = 40/87 (45%)
 Frame = +2

Query: 410 LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRK 589
           L+   S   L ++ D + +   + L GH      + F P   +  S S D  +++W ++ 
Sbjct: 460 LIDKESDDVLERIMDEKTSSESKILHGHSGPVYGVSFSPDRNYLLSSSEDGTIRLWSLQT 519

Query: 590 KGCIHTYKGHTRGISTIRFTPDGRWVV 670
             C+  YKGH   +   +F+P G + V
Sbjct: 520 FTCLVGYKGHNYPVWDTQFSPFGYYFV 546



>gb:BC062834_2553423 Danio rerio zgc:77675, mRNA (cDNA clone
           MGC:77675 IMAGE:6997311), complete cds.
          Length = 305

 Score = 86.3 bits (212), Expect = 4e-16
 Identities = 38/126 (30%), Positives = 66/126 (52%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +G  D  +N++ I       TL GH  P+ S+ F     L+   S  G IK++D++   +
Sbjct: 165 SGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANL 224

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
             TLSGH S+  ++ F P    F S S D ++K+WD   + C++T+  H   + ++++ P
Sbjct: 225 AGTLSGHGSWVLSVAFSPDDTHFVSSSSDKSIKVWDTSSRSCVNTFFDHQDQVWSVKYNP 284

Query: 653 DGRWVV 670
            G  +V
Sbjct: 285 TGSKIV 290



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 30/122 (24%), Positives = 59/122 (48%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D  + LW +       ++        ++AF      +A GS  G + ++ +E  K   +L
Sbjct: 85  DAHIRLWDLETGKQIKSMDAGPVDAWTVAFSPDSKYIATGSHLGKVNIFGVESGKKEHSL 144

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
                +  ++ + P G++ ASG++D  + I+DI     +HT +GH   I ++ F+PD + 
Sbjct: 145 DTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQL 204

Query: 665 VV 670
           +V
Sbjct: 205 LV 206



 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 32/121 (26%), Positives = 58/121 (47%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           TG     VN++ +       +L      + SIA+      +A+G+  G+I ++D+   K+
Sbjct: 123 TGSHLGKVNIFGVESGKKEHSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKL 182

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           + TL GH     +L F P  +   + S D  +KI+D++      T  GH   + ++ F+P
Sbjct: 183 LHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHGSWVLSVAFSP 242

Query: 653 D 655
           D
Sbjct: 243 D 243



 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 32/124 (25%), Positives = 55/124 (44%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L     H+  +  L F   + ++ +T  DD  + ++ +       TLSGH S V S+
Sbjct: 180 GKLLHTLEGHAMPIRSLTFSPDS-QLLVTASDDGYIKIYDVQHANLAGTLSGHGSWVLSV 238

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           AF   +    + SS   IK+WD      + T   H+    +++++P G    S   D  +
Sbjct: 239 AFSPDDTHFVSSSSDKSIKVWDTSSRSCVNTFFDHQDQVWSVKYNPTGSKIVSAGDDRAI 298

Query: 569 KIWD 580
            I+D
Sbjct: 299 HIYD 302



>gb:BC064237_2553790 Xenopus tropicalis hypothetical protein
           LOC394977, mRNA (cDNA clone IMAGE:5335963), partial cds.
          Length = 515

 Score = 85.9 bits (211), Expect = 6e-16
 Identities = 45/145 (31%), Positives = 71/145 (48%), Gaps = 1/145 (0%)
 Frame = +2

Query: 212 YKLQEFVA-HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           +KL   ++ H G V CL       + F+TG  D ++ +W +       +L+GH S V  +
Sbjct: 195 WKLYRVISGHLGWVRCLAVEPGN-QWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGV 253

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
                   + +      +K WDLE  K+IR   GH S    L+ HP  +   + S D+  
Sbjct: 254 IVSGRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTA 313

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIR 643
           +IWD+R K  +HT  GHT  ++T+R
Sbjct: 314 RIWDVRTKAGVHTLVGHTNAVATVR 338



 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 41/128 (32%), Positives = 59/128 (46%)
 Frame = +2

Query: 275 TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           T  + +T   D +  +W +       TL GHT+ V ++   +AE  +  GS    I+LWD
Sbjct: 300 TIDVLVTCSRDSTARIWDVRTKAGVHTLVGHTNAVATVRCQAAEPQIITGSHDTTIRLWD 359

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
           +   K   TL+ H+    A+  HP    FASGS D N+K W       I    GH   I+
Sbjct: 360 MVGGKTRVTLTNHKKSVRAVVLHPRQYTFASGSPD-NIKQWKFPDGNFIQNLSGHNAIIN 418

Query: 635 TIRFTPDG 658
           T+    DG
Sbjct: 419 TLAVNSDG 426



>gb:BA000045_740981 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 551

 Score = 85.9 bits (211), Expect = 6e-16
 Identities = 44/127 (34%), Positives = 66/127 (51%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
           RM+ +G DD ++ LWS    T   TL GHT  V ++ F      +A+  S   ++LWD+ 
Sbjct: 284 RMYASGDDDGAIRLWS-PAGTLLQTLEGHTGTVRAVVFTPDGRALASAGSDRRVRLWDVG 342

Query: 461 DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
             K+  TL GH      L   P G   ASGS D ++++WDI     ++  +GH   +  +
Sbjct: 343 TGKLRHTLKGHSQPVWTLAMAPDGRILASGSGDRSVRLWDIASGRQLYRLRGHGDWVFAV 402

Query: 641 RFTPDGR 661
            F+PDGR
Sbjct: 403 AFSPDGR 409



 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 44/151 (29%), Positives = 72/151 (47%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  LQ    H+G V  + F     R   + G D  V LW +G      TL GH+ PV ++
Sbjct: 302 GTLLQTLEGHTGTVRAVVFTPDG-RALASAGSDRRVRLWDVGTGKLRHTLKGHSQPVWTL 360

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           A      ++A+GS    ++LWD+   + +  L GH  +  A+ F P G   AS   D  +
Sbjct: 361 AMAPDGRILASGSGDRSVRLWDIASGRQLYRLRGHGDWVFAVAFSPDGRTLASAGKDETI 420

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
           ++W+      + T +GH+  +  + ++ DGR
Sbjct: 421 RLWNSADGKLLATLRGHSAPVRALDWSKDGR 451



 Score = 75.5 bits (184), Expect = 8e-13
 Identities = 40/129 (31%), Positives = 61/129 (47%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
           R+  +G  D SV LW I        L GH   V ++AF      +A+      I+LW+  
Sbjct: 367 RILASGSGDRSVRLWDIASGRQLYRLRGHGDWVFAVAFSPDGRTLASAGKDETIRLWNSA 426

Query: 461 DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
           D K++ TL GH +   AL++   G   AS S D  + +WD+  +       GHT  ++ +
Sbjct: 427 DGKLLATLRGHSAPVRALDWSKDGRTLASASWDKTVALWDVPGRTVRTRLSGHTGRVTAV 486

Query: 641 RFTPDGRWV 667
              PDG+ V
Sbjct: 487 SLAPDGQLV 495



 Score = 70.1 bits (170), Expect = 3e-11
 Identities = 37/130 (28%), Positives = 66/130 (50%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
           R   + G D ++ LW+       +TL GH++PV ++ +      +A+ S    + LWD+ 
Sbjct: 409 RTLASAGKDETIRLWNSADGKLLATLRGHSAPVRALDWSKDGRTLASASWDKTVALWDVP 468

Query: 461 DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
              +   LSGH    TA+   P G+  ASGS+D  +++W    +  IH +      + ++
Sbjct: 469 GRTVRTRLSGHTGRVTAVSLAPDGQLVASGSIDGTVRLWRPDTRRQIHRF-DLPDWVLSL 527

Query: 641 RFTPDGRWVV 670
            F+PDGR ++
Sbjct: 528 GFSPDGRMLI 537



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 36/123 (29%), Positives = 55/123 (44%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L     HS  V  L + K   R   +   D +V LW +   T  + LSGHT  V ++
Sbjct: 428 GKLLATLRGHSAPVRALDWSKDG-RTLASASWDKTVALWDVPGRTVRTRLSGHTGRVTAV 486

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           +      LVA+GS  G ++LW  +  + I        +  +L F P G    +G  D+ L
Sbjct: 487 SLAPDGQLVASGSIDGTVRLWRPDTRRQIHRFD-LPDWVLSLGFSPDGRMLIAGGKDSTL 545

Query: 569 KIW 577
           ++W
Sbjct: 546 RLW 548



 Score = 40.4 bits (93), Expect = 0.028
 Identities = 21/62 (33%), Positives = 30/62 (48%)
 Frame = +2

Query: 476 RTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
           RT+  H     A    P G  +ASG  D  +++W       + T +GHT  +  + FTPD
Sbjct: 265 RTVGAHPGPVWASAVRPDGRMYASGDDDGAIRLWS-PAGTLLQTLEGHTGTVRAVVFTPD 323

Query: 656 GR 661
           GR
Sbjct: 324 GR 325



>sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase pkwA
           (EC 2.7.1.37).>gb:AF115313_480098 Thermomonospora
           curvata PkwR (pkwR) and PkwA (pkwA) genes, complete cds.
          Length = 742

 Score = 85.9 bits (211), Expect = 6e-16
 Identities = 42/125 (33%), Positives = 64/125 (51%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           M  +G  D +  LW++   T  + L GHT  V ++AF     +VA+GS  G I+LWD+  
Sbjct: 557 MVASGSRDGTARLWNVATGTEHAVLKGHTDYVYAVAFSPDGSMVASGSRDGTIRLWDVAT 616

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
            K    L        +L F P G     GS D+ + +WD+     +HT++GHT  +  + 
Sbjct: 617 GKERDVLQAPAENVVSLAFSPDGSMLVHGS-DSTVHLWDVASGEALHTFEGHTDWVRAVA 675

Query: 644 FTPDG 658
           F+PDG
Sbjct: 676 FSPDG 680



 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 39/124 (31%), Positives = 59/124 (47%)
 Frame = +2

Query: 296 GGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMI 475
           G  D  +++W +       TL GHT  V ++AF     L+A+GS    ++LWD+   +  
Sbjct: 477 GSGDKLIHVWDVASGDELHTLEGHTDWVRAVAFSPDGALLASGSDDATVRLWDVAAAEER 536

Query: 476 RTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
               GH  Y   + F P G   ASGS D   ++W++         KGHT  +  + F+PD
Sbjct: 537 AVFEGHTHYVLDIAFSPDGSMVASGSRDGTARLWNVATGTEHAVLKGHTDYVYAVAFSPD 596

Query: 656 GRWV 667
           G  V
Sbjct: 597 GSMV 600



 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 45/154 (29%), Positives = 69/154 (44%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +L     H+  V  + F      +  +G DD +V LW +      +   GHT  V  I
Sbjct: 491 GDELHTLEGHTDWVRAVAFSPDGA-LLASGSDDATVRLWDVAAAEERAVFEGHTHYVLDI 549

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           AF     +VA+GS  G  +LW++        L GH  Y  A+ F P G   ASGS D  +
Sbjct: 550 AFSPDGSMVASGSRDGTARLWNVATGTEHAVLKGHTDYVYAVAFSPDGSMVASGSRDGTI 609

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           ++WD+         +     + ++ F+PDG  +V
Sbjct: 610 RLWDVATGKERDVLQAPAENVVSLAFSPDGSMLV 643



 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 37/125 (29%), Positives = 60/125 (48%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           M  +G  D ++ LW +        L      V S+AF     ++  GS S  + LWD+  
Sbjct: 599 MVASGSRDGTIRLWDVATGKERDVLQAPAENVVSLAFSPDGSMLVHGSDS-TVHLWDVAS 657

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
            + + T  GH  +  A+ F P G   ASGS D  +++WD+  +    T +GHT  + ++ 
Sbjct: 658 GEALHTFEGHTDWVRAVAFSPDGALLASGSDDRTIRLWDVAAQEEHTTLEGHTEPVHSVA 717

Query: 644 FTPDG 658
           F P+G
Sbjct: 718 FHPEG 722



 Score = 72.0 bits (175), Expect = 9e-12
 Identities = 36/98 (36%), Positives = 51/98 (52%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           L  G D +V+LW +    +  T  GHT  V ++AF     L+A+GS    I+LWD+   +
Sbjct: 642 LVHGSDSTVHLWDVASGEALHTFEGHTDWVRAVAFSPDGALLASGSDDRTIRLWDVAAQE 701

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
              TL GH     ++ FHP G   AS S D  ++IW I
Sbjct: 702 EHTTLEGHTEPVHSVAFHPEGTTLASASEDGTIRIWPI 739



 Score = 70.5 bits (171), Expect = 3e-11
 Identities = 34/95 (35%), Positives = 50/95 (52%)
 Frame = +2

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
           ++AF     L+A GS   LI +WD+     + TL GH  +  A+ F P G   ASGS D 
Sbjct: 464 AVAFSPGGSLLAGGSGDKLIHVWDVASGDELHTLEGHTDWVRAVAFSPDGALLASGSDDA 523

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            +++WD+        ++GHT  +  I F+PDG  V
Sbjct: 524 TVRLWDVAAAEERAVFEGHTHYVLDIAFSPDGSMV 558



 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 26/83 (31%), Positives = 40/83 (48%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L  F  H+  V  + F      +  +G DD ++ LW +      +TL GHT PV S+
Sbjct: 658 GEALHTFEGHTDWVRAVAFSPDGA-LLASGSDDRTIRLWDVAAQEEHTTLEGHTEPVHSV 716

Query: 389 AFDSAEILVAAGSSSGLIKLWDL 457
           AF      +A+ S  G I++W +
Sbjct: 717 AFHPEGTTLASASEDGTIRIWPI 739



>gb:BC077844_2560496 Xenopus laevis WD repeat domain 5, mRNA (cDNA
           clone MGC:80538 IMAGE:5161701), complete cds.
          Length = 334

 Score = 85.5 bits (210), Expect = 8e-16
 Identities = 43/157 (27%), Positives = 75/157 (47%), Gaps = 1/157 (0%)
 Frame = +2

Query: 203 KRGYKLQEFVA-HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           K  Y L+  +A H+  V+ ++F         +   D  + +W         T+SGH   +
Sbjct: 32  KPNYTLKFTLAGHTKAVSSVKFSPNG-EWLASSSADKLIKIWGAYDGKFEKTISGHKLGI 90

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             +A+ S   L+ + S    +K+WD+   K ++TL GH +Y     F+P      SGS D
Sbjct: 91  SDVAWSSDSNLLVSASDDKTLKIWDISSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFD 150

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            +++IWD++   C+ T   H+  +S + F  DG  +V
Sbjct: 151 ESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIV 187



 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 43/158 (27%), Positives = 74/158 (46%), Gaps = 4/158 (2%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L+    HS  V C  F  ++  + ++G  D SV +W +       TL  H+ PV ++
Sbjct: 119 GKCLKTLKGHSNYVFCCNFNPQS-NLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAV 177

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL-SGHRSYCTALEFHPFGEFFASGSMDTN 565
            F+    L+ + S  GL ++WD    + ++TL        + ++F P G++  + ++D  
Sbjct: 178 HFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNT 237

Query: 566 LKIWDIRKKGCIHTYKGHTRG---ISTIRFTPDGRWVV 670
           LK+WD  K  C+ TY  H      I        G+W+V
Sbjct: 238 LKLWDYSKGKCLKTYTCHKNEKYCIFANFSVTGGKWIV 275



 Score = 72.4 bits (176), Expect = 7e-12
 Identities = 34/130 (26%), Positives = 66/130 (50%), Gaps = 1/130 (0%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  DD ++ +W I       TL GH++ V    F+    L+ +GS    +++WD++ 
Sbjct: 101 LLVSASDDKTLKIWDISSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKT 160

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHT-YKGHTRGISTI 640
            K ++TL  H    +A+ F+  G    S S D   +IWD     C+ T        +S +
Sbjct: 161 GKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFV 220

Query: 641 RFTPDGRWVV 670
           +F+P+G++++
Sbjct: 221 KFSPNGKYIL 230



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 23/97 (23%), Positives = 45/97 (46%), Gaps = 6/97 (6%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEIL----VAAGSSSGLIKLWDLEDTKM 472
           D+++ LW   K     T + H +    I F +  +     + +GS   L+ +W+L+  ++
Sbjct: 235 DNTLKLWDYSKGKCLKTYTCHKNEKYCI-FANFSVTGGKWIVSGSEDNLVYIWNLQTKEV 293

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSM--DTNLKIW 577
           ++ L GH     +   HP     AS ++  D  +K+W
Sbjct: 294 VQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW 330



 Score = 36.6 bits (83), Expect = 0.41
 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 4/86 (4%)
 Frame = +2

Query: 206 RGYKLQEFVAHSGNVNCL--RFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           +G  L+ +  H     C+   F     +  ++G +D+ V +W++        L GHT  V
Sbjct: 245 KGKCLKTYTCHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEVVQKLQGHTDVV 304

Query: 380 ESIAFDSAEILVAAGS--SSGLIKLW 451
            S A    E ++A+ +  +   IKLW
Sbjct: 305 ISTACHPTENIIASAALENDKTIKLW 330



>gb:BC074136_2557654 Xenopus laevis MGC81859 protein, mRNA (cDNA
           clone MGC:81859 IMAGE:7008405), complete cds.
          Length = 305

 Score = 85.5 bits (210), Expect = 8e-16
 Identities = 38/126 (30%), Positives = 66/126 (52%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +G  D  +N++ I       TL GH  P+ S+ F +   L+   S  G IK++D++   +
Sbjct: 165 SGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSTDSQLLVTASDDGYIKIYDVQHASL 224

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
             TLSGH S+   + F P    F S S D ++K+WD+  + C+HT+  H   +  +++  
Sbjct: 225 AATLSGHGSWVLNVAFSPDDAHFVSSSSDKSVKVWDVSARTCVHTFLDHQDQVWGVKYNR 284

Query: 653 DGRWVV 670
           +G  +V
Sbjct: 285 NGSKIV 290



 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 30/122 (24%), Positives = 58/122 (47%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D  + LW +       ++        S+AF      +A GS  G + ++ +E  K   +L
Sbjct: 85  DAHIRLWDLESGKQIRSIDAGPVDAWSVAFSPDSQHLATGSHVGKVNIFGVETGKKEYSL 144

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
                +  ++ + P G++ ASG++D  + I+DI     +HT +GH   I ++ F+ D + 
Sbjct: 145 DTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSTDSQL 204

Query: 665 VV 670
           +V
Sbjct: 205 LV 206



 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 31/121 (25%), Positives = 56/121 (46%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           TG     VN++ +       +L      + SIA+      +A+G+  G+I ++D+   K+
Sbjct: 123 TGSHVGKVNIFGVETGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKL 182

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           + TL GH     +L F    +   + S D  +KI+D++      T  GH   +  + F+P
Sbjct: 183 LHTLEGHAMPIRSLTFSTDSQLLVTASDDGYIKIYDVQHASLAATLSGHGSWVLNVAFSP 242

Query: 653 D 655
           D
Sbjct: 243 D 243



 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 28/124 (22%), Positives = 56/124 (45%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L     H+  +  L F   + ++ +T  DD  + ++ +   +  +TLSGH S V ++
Sbjct: 180 GKLLHTLEGHAMPIRSLTFSTDS-QLLVTASDDGYIKIYDVQHASLAATLSGHGSWVLNV 238

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           AF   +    + SS   +K+WD+     + T   H+     ++++  G    S   D  +
Sbjct: 239 AFSPDDAHFVSSSSDKSVKVWDVSARTCVHTFLDHQDQVWGVKYNRNGSKIVSVGDDQEI 298

Query: 569 KIWD 580
            ++D
Sbjct: 299 HVYD 302



>gb:BC066132_2554253 Xenopus tropicalis hypothetical protein
           MGC76037, mRNA (cDNA clone MGC:76037 IMAGE:5385003),
           complete cds.>gb:BC077270_2559984 Xenopus laevis cDNA
           clone MGC:80035 IMAGE:4030874, complete cds.
          Length = 410

 Score = 85.5 bits (210), Expect = 8e-16
 Identities = 39/125 (31%), Positives = 67/125 (53%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + +T  +D ++ +W         TL GHT  V+ I+FD +  L+A+ S+   IKLWD + 
Sbjct: 122 VMVTASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG 181

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
            + IRT+ GH    +++   P G+   S S D  +K+W+++   C+ T+ GH   +  +R
Sbjct: 182 FECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVR 241

Query: 644 FTPDG 658
              DG
Sbjct: 242 PNQDG 246



 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 39/114 (34%), Positives = 54/114 (47%)
 Frame = +2

Query: 329 IGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           I +P     LSGH SPV  + F     ++   S    IK+WD E     RTL GH     
Sbjct: 95  IPRPPEKYALSGHRSPVTRVIFHPVFSVMVTASEDATIKVWDYETGDFERTLKGHTDSVQ 154

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + F   G+  AS S D  +K+WD +   CI T  GH   +S++   P+G  +V
Sbjct: 155 DISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIV 208



 Score = 66.6 bits (161), Expect = 4e-10
 Identities = 27/99 (27%), Positives = 53/99 (53%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           L+G  D ++ +W I       TL GH + V  + F      + + +    I++WD ++ +
Sbjct: 312 LSGSRDKTIKMWDISIGMCLMTLVGHDNWVRGVQFHPGGKFILSCADDKTIRIWDYKNKR 371

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            ++TL+ H  + T+L+FH    +  +GS+D  +K+W+ R
Sbjct: 372 CMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR 410



 Score = 66.2 bits (160), Expect = 5e-10
 Identities = 42/174 (24%), Positives = 78/174 (44%), Gaps = 20/174 (11%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           GY ++ F  H   V  +R   +   +  +  +D +V +W +      + L  H   VE I
Sbjct: 224 GYCVKTFTGHREWVRMVR-PNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECI 282

Query: 389 AF--DSAEILVA------------------AGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           ++  +S+   ++                  +GS    IK+WD+     + TL GH ++  
Sbjct: 283 SWAPESSYSTISDATGSETKKSGKPGPFLLSGSRDKTIKMWDISIGMCLMTLVGHDNWVR 342

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            ++FHP G+F  S + D  ++IWD + K C+ T   H   ++++ F     +VV
Sbjct: 343 GVQFHPGGKFILSCADDKTIRIWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVV 396



 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 28/120 (23%), Positives = 53/120 (44%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D ++ LW         T+ GH   V S+A       + + S    IK+W+++    ++T 
Sbjct: 171 DMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTF 230

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
           +GHR +   +  +  G   AS S D  +++W +  K C    + H   +  I + P+  +
Sbjct: 231 TGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSY 290



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 21/82 (25%), Positives = 33/82 (40%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L   V H   V  ++F     +  L+  DD ++ +W         TL+ H   V S+
Sbjct: 328 GMCLMTLVGHDNWVRGVQFHPGG-KFILSCADDKTIRIWDYKNKRCMKTLNAHEHFVTSL 386

Query: 389 AFDSAEILVAAGSSSGLIKLWD 454
            F      V  GS    +K+W+
Sbjct: 387 DFHKTAPYVVTGSVDQTVKVWE 408



>gb:AE016818_1748408 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 513

 Score = 85.5 bits (210), Expect = 8e-16
 Identities = 47/145 (32%), Positives = 72/145 (49%), Gaps = 8/145 (5%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H   + C  F   T    +TG  D++  +W     T   TL GH++ V  +A+ +   ++
Sbjct: 140 HGATILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPLCTLKGHSNWVLCVAWSADGEVI 199

Query: 416 AAGSSSGLIKLWDLEDTKMI-RTLSGHRSYCTALEFHPF-----GE--FFASGSMDTNLK 571
           A GS    I+LWD E  + +   L GH  + T+L + P      GE    AS S D  +K
Sbjct: 200 ATGSMDATIRLWDSEKGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASASKDGTIK 259

Query: 572 IWDIRKKGCIHTYKGHTRGISTIRF 646
           IWD  ++ CI+T  GHT  +S I++
Sbjct: 260 IWDTTRRVCIYTLSGHTSSVSCIKW 284



 Score = 65.9 bits (159), Expect = 6e-10
 Identities = 38/129 (29%), Positives = 61/129 (47%), Gaps = 1/129 (0%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTST-LSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
           + +TG DD ++ LW+  K +     ++GH   V  +AF      + + S    IKLWD  
Sbjct: 371 LMVTGSDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWDGR 430

Query: 461 DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
           D K I T  GH +    + +        S S DT LK+WD++ +       GH   + T+
Sbjct: 431 DGKFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLTVDLPGHNDEVYTV 490

Query: 641 RFTPDGRWV 667
            ++ DG+ V
Sbjct: 491 DWSVDGKRV 499



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 28/90 (31%), Positives = 48/90 (53%), Gaps = 1/90 (1%)
 Frame = +2

Query: 404 EILVAAGSSSGLIKLWD-LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
           E L+  GS    + LW+ L+ +K I  ++GH+     + F P G +  S S D ++K+WD
Sbjct: 369 EELMVTGSDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAFSPDGRYIVSASFDNSIKLWD 428

Query: 581 IRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            R    I T++GH   +  + ++ D R +V
Sbjct: 429 GRDGKFIATFRGHVASVYQVAWSSDCRLLV 458



 Score = 48.9 bits (115), Expect = 8e-05
 Identities = 25/99 (25%), Positives = 47/99 (47%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
           R  ++   D+S+ LW        +T  GH + V  +A+ S   L+ + S    +K+WD++
Sbjct: 413 RYIVSASFDNSIKLWDGRDGKFIATFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVK 472

Query: 461 DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
             K+   L GH      +++   G+   SG  D  +++W
Sbjct: 473 TRKLTVDLPGHNDEVYTVDWSVDGKRVCSGGKDKMVRLW 511



 Score = 44.7 bits (104), Expect = 0.001
 Identities = 38/163 (23%), Positives = 62/163 (38%), Gaps = 41/163 (25%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDL-EDTKMIRT 481
           D ++ +W   +     TLSGHTS V  I +    +L +A S    ++ WD+    K I  
Sbjct: 255 DGTIKIWDTTRRVCIYTLSGHTSSVSCIKWGGRNVLYSA-SHDRTVRCWDMAAGGKCINI 313

Query: 482 LSGHRSYCT--------ALEFHPFG-------------------------------EFFA 544
           L  H  +          AL   PF                                E   
Sbjct: 314 LKSHAHWVNHLSLSTDYALRMGPFDHTGTKPASPEDAQARALRNYEKVAKKNGTMEELMV 373

Query: 545 SGSMDTNLKIWD-IRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           +GS D  + +W+ ++    I    GH + ++ + F+PDGR++V
Sbjct: 374 TGSDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAFSPDGRYIV 416



>gb:AB007645_1510148 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K8K14.>gb:AY057698_1564110 Arabidopsis
           thaliana AT5g67320/K8K14_4 mRNA, complete
           cds.>gb:AY143932_1583389 Arabidopsis thaliana
           At5g67320/K8K14_4 mRNA, complete cds.
          Length = 613

 Score = 85.5 bits (210), Expect = 8e-16
 Identities = 47/153 (30%), Positives = 80/153 (52%), Gaps = 9/153 (5%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD--- 397
           F  H G VNC+++   T  +  +  DD +  +W+I + T    L  HT  + +I +    
Sbjct: 444 FTGHQGEVNCVKWDP-TGSLLASCSDDSTAKIWNIKQSTFVHDLREHTKEIYTIRWSPTG 502

Query: 398 ------SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
                 + ++ +A+ S    +KLWD E  KM+ + +GHR    +L F P GE+ ASGS+D
Sbjct: 503 PGTNNPNKQLTLASASFDSTVKLWDAELGKMLCSFNGHREPVYSLAFSPNGEYIASGSLD 562

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
            ++ IW I++   + TY G+  GI  + +  +G
Sbjct: 563 KSIHIWSIKEGKIVKTYTGN-GGIFEVCWNKEG 594



 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 39/141 (27%), Positives = 71/141 (50%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H G +  L++ KK   + LTG  D +  +W +           H+ P   + + +  +  
Sbjct: 364 HKGPIFSLKWNKKGDYL-LTGSVDRTAVVWDVKAEEWKQQFEFHSGPTLDVDWRN-NVSF 421

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
           A  S+  +I L  + +T+  +T +GH+     +++ P G   AS S D+  KIW+I++  
Sbjct: 422 ATSSTDSMIYLCKIGETRPAKTFTGHQGEVNCVKWDPTGSLLASCSDDSTAKIWNIKQST 481

Query: 596 CIHTYKGHTRGISTIRFTPDG 658
            +H  + HT+ I TIR++P G
Sbjct: 482 FVHDLREHTKEIYTIRWSPTG 502



 Score = 65.5 bits (158), Expect = 8e-10
 Identities = 38/158 (24%), Positives = 68/158 (43%), Gaps = 9/158 (5%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           Q+F  HSG    L    +    F T   D  + L  IG+     T +GH   V  + +D 
Sbjct: 401 QQFEFHSGPT--LDVDWRNNVSFATSSTDSMIYLCKIGETRPAKTFTGHQGEVNCVKWDP 458

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGE---------FFASGS 553
              L+A+ S     K+W+++ +  +  L  H      + + P G            AS S
Sbjct: 459 TGSLLASCSDDSTAKIWNIKQSTFVHDLREHTKEIYTIRWSPTGPGTNNPNKQLTLASAS 518

Query: 554 MDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            D+ +K+WD      + ++ GH   + ++ F+P+G ++
Sbjct: 519 FDSTVKLWDAELGKMLCSFNGHREPVYSLAFSPNGEYI 556



 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 30/146 (20%), Positives = 66/146 (45%), Gaps = 17/146 (11%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGH---------------- 367
           H+  V C      +  +  +G  D +  +WSI + +  +  +G                 
Sbjct: 264 HTSEV-CACAWSPSASLLASGSGDATARIWSIPEGSFKAVHTGRNINALILKHAKGKSNE 322

Query: 368 -TSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFA 544
            +  V ++ ++    L+A GS  G  ++W L   ++I TLS H+    +L+++  G++  
Sbjct: 323 KSKDVTTLDWNGEGTLLATGSCDGQARIWTLNG-ELISTLSKHKGPIFSLKWNKKGDYLL 381

Query: 545 SGSMDTNLKIWDIRKKGCIHTYKGHT 622
           +GS+D    +WD++ +     ++ H+
Sbjct: 382 TGSVDRTAVVWDVKAEEWKQQFEFHS 407



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 29/122 (23%), Positives = 54/122 (44%), Gaps = 17/122 (13%)
 Frame = +2

Query: 356 LSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED----------------TKMIRTLS 487
           L GHTS V + A+  +  L+A+GS     ++W + +                 K  +  S
Sbjct: 261 LEGHTSEVCACAWSPSASLLASGSGDATARIWSIPEGSFKAVHTGRNINALILKHAKGKS 320

Query: 488 GHRSY-CTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
             +S   T L+++  G   A+GS D   +IW +  +  I T   H   I ++++   G +
Sbjct: 321 NEKSKDVTTLDWNGEGTLLATGSCDGQARIWTLNGE-LISTLSKHKGPIFSLKWNKKGDY 379

Query: 665 VV 670
           ++
Sbjct: 380 LL 381



 Score = 32.3 bits (72), Expect = 7.7
 Identities = 15/37 (40%), Positives = 18/37 (48%)
 Frame = +2

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
           +R L GH S   A  + P     ASGS D   +IW I
Sbjct: 258 VRILEGHTSEVCACAWSPSASLLASGSGDATARIWSI 294



>gb:BC084871_2564115 Xenopus laevis hypothetical LOC495399, mRNA
           (cDNA clone MGC:85560 IMAGE:6931761), complete cds.
          Length = 517

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 44/145 (30%), Positives = 71/145 (48%), Gaps = 1/145 (0%)
 Frame = +2

Query: 212 YKLQEFVA-HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           +KL   ++ H G V CL       + F+TG  D ++ +W +       +L+GH S V  +
Sbjct: 197 WKLYRVISGHLGWVRCLAVEPGN-QWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGV 255

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
                   + +      +K WDLE  K+IR   GH S    L+ HP  +   + S D+  
Sbjct: 256 IVSGRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLITCSRDSTA 315

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIR 643
           +IWD++ K  +HT  GHT  ++T+R
Sbjct: 316 RIWDVKTKASVHTLVGHTNAVATVR 340



 Score = 72.8 bits (177), Expect = 5e-12
 Identities = 42/128 (32%), Positives = 60/128 (46%)
 Frame = +2

Query: 275 TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           T  + +T   D +  +W +    S  TL GHT+ V ++   +AE  +  GS    I+LWD
Sbjct: 302 TIDVLITCSRDSTARIWDVKTKASVHTLVGHTNAVATVRCQAAEPQIITGSHDTTIRLWD 361

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
           +   K   TL+ H+    A+  HP    FASGS D N+K W       I    GH   I+
Sbjct: 362 MVAGKTRVTLTNHKKSVRAVVLHPRQYTFASGSPD-NIKQWKFPDGNFIQNLSGHNAIIN 420

Query: 635 TIRFTPDG 658
           T+    DG
Sbjct: 421 TLAVNSDG 428



>gb:BC081008_2561918 Xenopus laevis WD repeat domain 5, mRNA (cDNA
           clone MGC:81485 IMAGE:6636637), complete
           cds.>gb:BC088786_2565883 Xenopus tropicalis hypothetical
           LOC496891, mRNA (cDNA clone MGC:107779 IMAGE:7017022),
           complete cds.
          Length = 334

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 43/157 (27%), Positives = 75/157 (47%), Gaps = 1/157 (0%)
 Frame = +2

Query: 203 KRGYKLQEFVA-HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           K  Y L+  +A H+  V+ ++F         +   D  + +W         T+SGH   +
Sbjct: 32  KPNYTLKFTLAGHTKAVSSVKFSPNG-EWLASSSADKLIKIWGAYDGKFEKTISGHKLGI 90

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             +A+ S   L+ + S    +K+WD+   K ++TL GH +Y     F+P      SGS D
Sbjct: 91  SDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFD 150

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            +++IWD++   C+ T   H+  +S + F  DG  +V
Sbjct: 151 ESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIV 187



 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 43/158 (27%), Positives = 74/158 (46%), Gaps = 4/158 (2%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L+    HS  V C  F  ++  + ++G  D SV +W +       TL  H+ PV ++
Sbjct: 119 GKCLKTLKGHSNYVFCCNFNPQS-NLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAV 177

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL-SGHRSYCTALEFHPFGEFFASGSMDTN 565
            F+    L+ + S  GL ++WD    + ++TL        + ++F P G++  + ++D  
Sbjct: 178 HFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNT 237

Query: 566 LKIWDIRKKGCIHTYKGHTRG---ISTIRFTPDGRWVV 670
           LK+WD  K  C+ TY  H      I        G+W+V
Sbjct: 238 LKLWDYSKGKCLKTYTCHKNEKYCIFANFSVTGGKWIV 275



 Score = 72.0 bits (175), Expect = 9e-12
 Identities = 33/130 (25%), Positives = 66/130 (50%), Gaps = 1/130 (0%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  DD ++ +W +       TL GH++ V    F+    L+ +GS    +++WD++ 
Sbjct: 101 LLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKT 160

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHT-YKGHTRGISTI 640
            K ++TL  H    +A+ F+  G    S S D   +IWD     C+ T        +S +
Sbjct: 161 GKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFV 220

Query: 641 RFTPDGRWVV 670
           +F+P+G++++
Sbjct: 221 KFSPNGKYIL 230



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 23/97 (23%), Positives = 45/97 (46%), Gaps = 6/97 (6%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEIL----VAAGSSSGLIKLWDLEDTKM 472
           D+++ LW   K     T + H +    I F +  +     + +GS   L+ +W+L+  ++
Sbjct: 235 DNTLKLWDYSKGKCLKTYTCHKNEKYCI-FANFSVTGGKWIVSGSEDNLVYIWNLQTKEV 293

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSM--DTNLKIW 577
           ++ L GH     +   HP     AS ++  D  +K+W
Sbjct: 294 VQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW 330



 Score = 36.6 bits (83), Expect = 0.41
 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 4/86 (4%)
 Frame = +2

Query: 206 RGYKLQEFVAHSGNVNCL--RFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           +G  L+ +  H     C+   F     +  ++G +D+ V +W++        L GHT  V
Sbjct: 245 KGKCLKTYTCHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEVVQKLQGHTDVV 304

Query: 380 ESIAFDSAEILVAAGS--SSGLIKLW 451
            S A    E ++A+ +  +   IKLW
Sbjct: 305 ISTACHPTENIIASAALENDKTIKLW 330



>gb:BC052124_2550472 Danio rerio zgc:76895, mRNA (cDNA clone
           MGC:56591 IMAGE:5915175), complete
           cds.>gb:BC066729_2554566 Danio rerio zgc:76895, mRNA
           (cDNA clone MGC:76895 IMAGE:6520391), complete cds.
          Length = 334

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 43/157 (27%), Positives = 75/157 (47%), Gaps = 1/157 (0%)
 Frame = +2

Query: 203 KRGYKLQEFVA-HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           K  Y L+  +A H+  V+ ++F         +   D  + +W         T+SGH   +
Sbjct: 32  KPNYTLKFTLAGHTKAVSSVKFSPSG-EWLASSSADKLIKIWGAYDGKFEKTISGHKLGI 90

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             +A+ S   L+ + S    +K+WD+   K ++TL GH +Y     F+P      SGS D
Sbjct: 91  SDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFD 150

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            +++IWD++   C+ T   H+  +S + F  DG  +V
Sbjct: 151 ESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIV 187



 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 44/158 (27%), Positives = 75/158 (47%), Gaps = 4/158 (2%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L+    HS  V C  F  ++  + ++G  D SV +W +       TL  H+ PV ++
Sbjct: 119 GKCLKTLKGHSNYVFCCNFNPQS-NLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAV 177

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL-SGHRSYCTALEFHPFGEFFASGSMDTN 565
            F+    L+ + S  GL ++WD    + ++TL        + ++F P G++  + ++D  
Sbjct: 178 HFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNT 237

Query: 566 LKIWDIRKKGCIHTYKGHTRG---ISTIRFTPDGRWVV 670
           LK+WD  K  C+ TY GH      I        G+W+V
Sbjct: 238 LKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIV 275



 Score = 72.0 bits (175), Expect = 9e-12
 Identities = 33/130 (25%), Positives = 66/130 (50%), Gaps = 1/130 (0%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  DD ++ +W +       TL GH++ V    F+    L+ +GS    +++WD++ 
Sbjct: 101 LLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKT 160

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHT-YKGHTRGISTI 640
            K ++TL  H    +A+ F+  G    S S D   +IWD     C+ T        +S +
Sbjct: 161 GKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFV 220

Query: 641 RFTPDGRWVV 670
           +F+P+G++++
Sbjct: 221 KFSPNGKYIL 230



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 23/97 (23%), Positives = 46/97 (47%), Gaps = 6/97 (6%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEIL----VAAGSSSGLIKLWDLEDTKM 472
           D+++ LW   K     T +GH +    I F +  +     + +GS   ++ +W+L+  ++
Sbjct: 235 DNTLKLWDYSKGKCLKTYTGHKNEKYCI-FANFSVTGGKWIVSGSEDNMVYIWNLQTKEI 293

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSM--DTNLKIW 577
           ++ L GH     +   HP     AS ++  D  +K+W
Sbjct: 294 VQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW 330



 Score = 37.0 bits (84), Expect = 0.31
 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 4/86 (4%)
 Frame = +2

Query: 206 RGYKLQEFVAHSGNVNCL--RFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           +G  L+ +  H     C+   F     +  ++G +D+ V +W++        L GHT  V
Sbjct: 245 KGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVV 304

Query: 380 ESIAFDSAEILVAAGS--SSGLIKLW 451
            S A    E ++A+ +  +   IKLW
Sbjct: 305 ISTACHPTENIIASAALENDKTIKLW 330



>gb:AK097409_1914851 Homo sapiens cDNA FLJ40090 fis, clone
           TESTI2003596, weakly similar to VEGETATIBLE
           INCOMPATIBILITY PROTEIN HET-E-1.>gb:BC036377_1981915
           Homo sapiens hypothetical protein FLJ25955, mRNA (cDNA
           clone MGC:26723 IMAGE:4824989), complete cds.
          Length = 415

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 45/134 (33%), Positives = 68/134 (50%), Gaps = 1/134 (0%)
 Frame = +2

Query: 272 KTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE-ILVAAGSSSGLIKL 448
           K+   F+TG  D +  LW        +TL GH + V +IAF++     +A GS     KL
Sbjct: 102 KSGSCFITGSYDRTCKLWDTASGEELNTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKL 161

Query: 449 WDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRG 628
           W +E  K   T  GH +    L F+P     A+GSMDT  K+WDI+    ++T +GH+  
Sbjct: 162 WSVETGKCYHTFRGHTAEIVCLSFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHSAE 221

Query: 629 ISTIRFTPDGRWVV 670
           I ++ F   G  ++
Sbjct: 222 IISLSFNTSGDRII 235



 Score = 82.0 bits (201), Expect = 8e-15
 Identities = 44/157 (28%), Positives = 68/157 (43%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A  G K+   + H   ++   F    C + LTG  D +  LW        +TL+GH   +
Sbjct: 248 ADTGRKVNILIGHCAEISSASFNWD-CSLILTGSMDKTCKLWDATNGKCVATLTGHDDEI 306

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
               FD    L+A  S+ G  +++     K I  L GH    + + F+P G    +GS D
Sbjct: 307 LDSCFDYTGKLIATASADGTARIFSAATRKCIAKLEGHEGEISKISFNPQGNHLLTGSSD 366

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
              +IWD +   C+   +GHT  I +  F   G  V+
Sbjct: 367 KTARIWDAQTGQCLQVLEGHTDEIFSCAFNYKGNIVI 403



 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 43/149 (28%), Positives = 67/149 (44%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +L     H   V  + F         TG  D +  LWS+       T  GHT+ +  +
Sbjct: 124 GEELNTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCL 183

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           +F+    LVA GS     KLWD+++ + + TL GH +   +L F+  G+   +GS D  +
Sbjct: 184 SFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHSAEIISLSFNTSGDRIITGSFDHTV 243

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
            +WD      ++   GH   IS+  F  D
Sbjct: 244 VVWDADTGRKVNILIGHCAEISSASFNWD 272



 Score = 73.9 bits (180), Expect = 2e-12
 Identities = 45/152 (29%), Positives = 68/152 (44%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           + G ++     HS  +  L F     R+ +TG  DH+V +W        + L GH + + 
Sbjct: 207 QNGEEVYTLRGHSAEIISLSFNTSGDRI-ITGSFDHTVVVWDADTGRKVNILIGHCAEIS 265

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
           S +F+    L+  GS     KLWD  + K + TL+GH        F   G+  A+ S D 
Sbjct: 266 SASFNWDCSLILTGSMDKTCKLWDATNGKCVATLTGHDDEILDSCFDYTGKLIATASADG 325

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
             +I+    + CI   +GH   IS I F P G
Sbjct: 326 TARIFSAATRKCIAKLEGHEGEISKISFNPQG 357



 Score = 73.6 bits (179), Expect = 3e-12
 Identities = 35/105 (33%), Positives = 53/105 (50%), Gaps = 1/105 (0%)
 Frame = +2

Query: 356 LSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEF-HPFG 532
           L  H  P+ ++A + +      GS     KLWD    + + TL GHR+   A+ F +P+G
Sbjct: 88  LKAHILPLTNVALNKSGSCFITGSYDRTCKLWDTASGEELNTLEGHRNVVYAIAFNNPYG 147

Query: 533 EFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           +  A+GS D   K+W +    C HT++GHT  I  + F P    V
Sbjct: 148 DKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSFNPQSTLV 192



 Score = 72.4 bits (176), Expect = 7e-12
 Identities = 39/147 (26%), Positives = 68/147 (46%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           F  H+  + CL F  ++  +  TG  D +  LW I       TL GH++ + S++F+++ 
Sbjct: 173 FRGHTAEIVCLSFNPQST-LVATGSMDTTAKLWDIQNGEEVYTLRGHSAEIISLSFNTSG 231

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
             +  GS    + +WD +  + +  L GH +  ++  F+       +GSMD   K+WD  
Sbjct: 232 DRIITGSFDHTVVVWDADTGRKVNILIGHCAEISSASFNWDCSLILTGSMDKTCKLWDAT 291

Query: 587 KKGCIHTYKGHTRGISTIRFTPDGRWV 667
              C+ T  GH   I    F   G+ +
Sbjct: 292 NGKCVATLTGHDDEILDSCFDYTGKLI 318



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 24/101 (23%), Positives = 44/101 (43%)
 Frame = +2

Query: 275 TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           T ++  T   D +  ++S       + L GH   +  I+F+     +  GSS    ++WD
Sbjct: 314 TGKLIATASADGTARIFSAATRKCIAKLEGHEGEISKISFNPQGNHLLTGSSDKTARIWD 373

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
            +  + ++ L GH     +  F+  G    +GS D   +IW
Sbjct: 374 AQTGQCLQVLEGHTDEIFSCAFNYKGNIVITGSKDNTCRIW 414



 Score = 32.7 bits (73), Expect = 5.9
 Identities = 16/59 (27%), Positives = 26/59 (44%)
 Frame = +2

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
           + + L  H    T +  +  G  F +GS D   K+WD      ++T +GH   +  I F
Sbjct: 84  LFKVLKAHILPLTNVALNKSGSCFITGSYDRTCKLWDTASGEELNTLEGHRNVVYAIAF 142



>gb:AF091120_1767420 Filobasidiella neoformans G-protein beta
           subunit GPB1 gene, complete cds.
          Length = 352

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 49/150 (32%), Positives = 79/150 (52%), Gaps = 3/150 (2%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           +E  AHSG ++C RF     R  +T   D +  LW I + T T   + HT  V  I+   
Sbjct: 149 RELSAHSGYLSCCRFIND--RQIVTSSGDMTCMLWDIEQGTRTMEFNDHTGDVMCISLAP 206

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
              L  +G+     K+WD+   K ++T +GH S   A++F P G+ FA+GS D + K++D
Sbjct: 207 NANLFVSGACDATAKVWDIRTGKAVQTFTGHESDINAVQFFPNGDAFATGSDDASCKLFD 266

Query: 581 IRKKGCIHTYKGHTR---GISTIRFTPDGR 661
           +R    +++Y  H     GI+++ F+  GR
Sbjct: 267 LRADRELNSY-AHDNILCGITSVAFSISGR 295



 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 31/127 (24%), Positives = 56/127 (44%), Gaps = 2/127 (1%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHT--SP 376
           + G  +Q F  H  ++N ++F       F TG DD S  L+ +      ++ +       
Sbjct: 226 RTGKAVQTFTGHESDINAVQFFPNG-DAFATGSDDASCKLFDLRADRELNSYAHDNILCG 284

Query: 377 VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM 556
           + S+AF  +  ++ AG       +WD    + I  L+GH +  + +     G    +GS 
Sbjct: 285 ITSVAFSISGRVLFAGYDDYNCNVWDTLKGERIGVLAGHENRVSCMGVSGDGVALCTGSW 344

Query: 557 DTNLKIW 577
           D+ LK+W
Sbjct: 345 DSLLKVW 351



 Score = 37.4 bits (85), Expect = 0.24
 Identities = 18/81 (22%), Positives = 35/81 (43%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           TL GH + + ++ + +    + + S  G + +WD   T  +  +    S+     + P G
Sbjct: 54  TLKGHLAKIYALHWAADTRHIVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTAAYAPSG 113

Query: 533 EFFASGSMDTNLKIWDIRKKG 595
              A G +D    I+ +R  G
Sbjct: 114 NLVACGGLDNVCSIYSLRGAG 134



 Score = 34.3 bits (77), Expect = 2.0
 Identities = 32/157 (20%), Positives = 54/157 (34%), Gaps = 12/157 (7%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H   +  L +   T R  ++   D  + +W          +   +S V + A+  +  LV
Sbjct: 58  HLAKIYALHWAADT-RHIVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTAAYAPSGNLV 116

Query: 416 AAGSSSGLIKLWDLE------------DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
           A G    +  ++ L               K+ R LS H  Y +   F    +   S S D
Sbjct: 117 ACGGLDNVCSIYSLRGAGPGAPGAPGGQVKVARELSAHSGYLSCCRFINDRQIVTS-SGD 175

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
               +WDI +      +  HT  +  I   P+    V
Sbjct: 176 MTCMLWDIEQGTRTMEFNDHTGDVMCISLAPNANLFV 212



 Score = 33.1 bits (74), Expect = 4.5
 Identities = 19/67 (28%), Positives = 26/67 (38%)
 Frame = +2

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
           K  RTL GH +   AL +        S S D  L +WD      +H     +  + T  +
Sbjct: 50  KARRTLKGHLAKIYALHWAADTRHIVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTAAY 109

Query: 647 TPDGRWV 667
            P G  V
Sbjct: 110 APSGNLV 116



>gb:CR380959_1653880 Candida glabrata strain CBS138 chromosome M
           complete sequence.
          Length = 806

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 42/146 (28%), Positives = 69/146 (47%)
 Frame = +2

Query: 230 VAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEI 409
           V HSG V    F      + ++G +D +V LWS+   T+     GH  PV  + F     
Sbjct: 530 VGHSGTVYSTSFSPDNMYL-VSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGH 588

Query: 410 LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRK 589
             A+ S     +LW  +    +R  +GH +    + FHP G +  +GS D   ++WD+  
Sbjct: 589 YFASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVST 648

Query: 590 KGCIHTYKGHTRGISTIRFTPDGRWV 667
              +  + GHT  + + + +PDGRW+
Sbjct: 649 GDSVRLFLGHTAPVLSTQVSPDGRWL 674



 Score = 72.0 bits (175), Expect = 9e-12
 Identities = 38/148 (25%), Positives = 64/148 (43%), Gaps = 18/148 (12%)
 Frame = +2

Query: 278 CRMFLTGGDDHSVNLWSI------------------GKPTSTSTLSGHTSPVESIAFDSA 403
           CR+   G  D  + +WS+                   +  + STL GH+  V S +F   
Sbjct: 485 CRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSGTVYSTSFSPD 544

Query: 404 EILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
            + + +GS    +KLW ++    +    GH      ++F P G +FAS S D   ++W  
Sbjct: 545 NMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHYFASASHDQTARLWAC 604

Query: 584 RKKGCIHTYKGHTRGISTIRFTPDGRWV 667
                +  + GHT  + T+ F P+G +V
Sbjct: 605 DHIYPLRIFAGHTNDVDTVSFHPNGCYV 632



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 32/129 (24%), Positives = 60/129 (46%), Gaps = 1/129 (0%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F +   D +  LW+          +GHT+ V++++F      V  GSS    ++WD+   
Sbjct: 590 FASASHDQTARLWACDHIYPLRIFAGHTNDVDTVSFHPNGCYVFTGSSDKTCRMWDVSTG 649

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTR-GISTIR 643
             +R   GH +   + +  P G + A+GS D  + +WDI     I   +GH +  + ++ 
Sbjct: 650 DSVRLFLGHTAPVLSTQVSPDGRWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLS 709

Query: 644 FTPDGRWVV 670
           F  +G  ++
Sbjct: 710 FNKEGNVLI 718



 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 30/112 (26%), Positives = 46/112 (41%), Gaps = 18/112 (16%)
 Frame = +2

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIR------------------TLSGHRSYCT 508
           S+ F     L AAG     IK+W L+ + +I                   TL GH     
Sbjct: 478 SLEFSDDCRLAAAGFQDSYIKIWSLDGSSLINPKYSSSQFDRFSQDNTCSTLVGHSGTVY 537

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
           +  F P   +  SGS D  +K+W +     +  YKGH   +  ++F+P G +
Sbjct: 538 STSFSPDNMYLVSGSEDKTVKLWSMDTHTALVNYKGHNHPVWDVKFSPLGHY 589



 Score = 35.4 bits (80), Expect = 0.91
 Identities = 16/61 (26%), Positives = 32/61 (52%), Gaps = 1/61 (1%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGH-TSPVESIAFDSAEILVAAGSSSGLIKLWDL 457
           R   TG +D  + LW IG       + GH  + V S++F+    ++ +G +   +++WD+
Sbjct: 672 RWLATGSEDGVICLWDIGTGKRIKQMRGHGKNAVHSLSFNKEGNVLISGGADHSVRVWDV 731

Query: 458 E 460
           +
Sbjct: 732 K 732



>gb:BOVPAF45K_1435710 Bovine mRNA for PAF acetylhydrolase 45 kDa
           subunit, complete cds.
          Length = 410

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 39/125 (31%), Positives = 67/125 (53%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  +D ++ +W         TL GHT  VE I+FD +  L+A+ S+   IKLWD + 
Sbjct: 122 VMVSASEDATIKVWDYETGDFERTLKGHTDSVEDISFDHSGKLLASCSADMTIKLWDFQG 181

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
            + IRT+ GH    +++   P G+   S S D  +K+W+++   C+ T+ GH   +  +R
Sbjct: 182 FECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVR 241

Query: 644 FTPDG 658
              DG
Sbjct: 242 PNQDG 246



 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 39/114 (34%), Positives = 55/114 (48%)
 Frame = +2

Query: 329 IGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           I +P     LSGH SPV  + F     ++ + S    IK+WD E     RTL GH     
Sbjct: 95  IPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVE 154

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + F   G+  AS S D  +K+WD +   CI T  GH   +S++   P+G  +V
Sbjct: 155 DISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIV 208



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 26/99 (26%), Positives = 54/99 (54%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           L+G  D ++ +W +       TL GH + V  + F S    + + +    +++WD ++ +
Sbjct: 312 LSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKR 371

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            ++TL+ H  + T+L+FH    +  +GS+D  +K+W+ R
Sbjct: 372 CMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR 410



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 40/174 (22%), Positives = 72/174 (41%), Gaps = 20/174 (11%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           GY ++ F  H   V  +R   +   +  +  +D +V +W +      + L  H   VE I
Sbjct: 224 GYCVKTFTGHREWVRMVR-PNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECI 282

Query: 389 AFDSAEI--------------------LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           ++                          + +GS    IK+WD+     + TL GH ++  
Sbjct: 283 SWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVR 342

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + FH  G+F  S + D  L++WD + K C+ T   H   ++++ F     +VV
Sbjct: 343 GVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVV 396



 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 28/120 (23%), Positives = 53/120 (44%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D ++ LW         T+ GH   V S+A       + + S    IK+W+++    ++T 
Sbjct: 171 DMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTF 230

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
           +GHR +   +  +  G   AS S D  +++W +  K C    + H   +  I + P+  +
Sbjct: 231 TGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSY 290



 Score = 32.7 bits (73), Expect = 5.9
 Identities = 21/82 (25%), Positives = 32/82 (39%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L   V H   V  + F     +  L+  DD ++ +W         TL+ H   V S+
Sbjct: 328 GMCLMTLVGHDNWVRGVLFHSGG-KFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSL 386

Query: 389 AFDSAEILVAAGSSSGLIKLWD 454
            F      V  GS    +K+W+
Sbjct: 387 DFHKTAPYVVTGSVDQTVKVWE 408



>gb:ASPDRUH_582995 Anabaena sp. PCC 7120 DNA downstream region of
           the uptake hydrogenase.
          Length = 186

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 42/126 (33%), Positives = 67/126 (53%), Gaps = 2/126 (1%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIG--KPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           ++G  + S+ +W +   +P    T+ GH+  V S+        +A+GS    IKLW   D
Sbjct: 18  VSGSTNGSIKIWQLTTPRPIPLYTIIGHSQAVRSVVISPDGQTLASGSVDQTIKLWSWRD 77

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
             ++RTL+GH     ++ F P G+  ASGS D  +K WDI     I  + GHT  + ++ 
Sbjct: 78  RNLLRTLTGHSGAVWSVAFSPNGQTLASGSNDRTIKRWDIATGQLIDNFVGHTNPVWSVT 137

Query: 644 FTPDGR 661
           F+PDG+
Sbjct: 138 FSPDGQ 143



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 35/106 (33%), Positives = 55/106 (51%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +G  D ++ LWS        TL+GH+  V S+AF      +A+GS+   IK WD+   ++
Sbjct: 63  SGSVDQTIKLWSWRDRNLLRTLTGHSGAVWSVAFSPNGQTLASGSNDRTIKRWDIATGQL 122

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTY 610
           I    GH +   ++ F P G+  ASGS D  +K+W I+      T+
Sbjct: 123 IDNFVGHTNPVWSVTFSPDGQTLASGSGDQTIKLWSIKSDTSSQTH 168



>gb:AE012949_287446 Chlorobium tepidum TLS section 170 of 194 of the
           complete genome.>gb:AE006470_934614 Chlorobium tepidum
           TLS complete genome.
          Length = 329

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 39/105 (37%), Positives = 60/105 (57%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           TL GH   V  + F      + +GS    +KLWD+E    I T+SGH ++   +++ P G
Sbjct: 42  TLVGHEDRVLGVRFSPDGKKLVSGSFDEKVKLWDVETGNAIHTMSGHTTWVKCVDYSPKG 101

Query: 533 EFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           +  ASGS+D+ ++IWD+    C+H  KGH   +  I F+PDG+ V
Sbjct: 102 DKVASGSIDSTVRIWDVATGQCLHVCKGHDTEVRMIAFSPDGKTV 146



 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 47/154 (30%), Positives = 74/154 (48%), Gaps = 3/154 (1%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRF---GKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           ++  V H   V  +RF   GKK     ++G  D  V LW +    +  T+SGHT+ V+ +
Sbjct: 40  IKTLVGHEDRVLGVRFSPDGKK----LVSGSFDEKVKLWDVETGNAIHTMSGHTTWVKCV 95

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            +      VA+GS    +++WD+   + +    GH +    + F P G+  AS S DT +
Sbjct: 96  DYSPKGDKVASGSIDSTVRIWDVATGQCLHVCKGHDTEVRMIAFSPDGKTVASCSRDTTI 155

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           K WD      + T  GH   I  I F+ DG+ +V
Sbjct: 156 KFWDTETGNEVKTLFGHKSYIECIAFSADGKKLV 189



 Score = 78.6 bits (192), Expect = 9e-14
 Identities = 42/156 (26%), Positives = 79/156 (50%), Gaps = 5/156 (3%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRF---GKKTCRMFLTGGDDHSVNLWSI--GKPTSTSTLSGHTS 373
           G +++    H   + C+ F   GKK     ++ G++  V +W +  GK  +        S
Sbjct: 163 GNEVKTLFGHKSYIECIAFSADGKK----LVSCGEEPVVKIWDLETGKNIANYPTGDTLS 218

Query: 374 PVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGS 553
              S + D ++I +    +   +K+ D    +M++ L GH     AL ++P G   AS +
Sbjct: 219 HFVSFSPDGSQIALCGRDAK--VKVLDAATGQMLKVLEGHEDGVRALCYNPAGTLIASAA 276

Query: 554 MDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
            D ++++WD+ K   +HTY+GHT  + ++ F+PDG+
Sbjct: 277 NDESVRLWDVAKGALVHTYRGHTHEVQSVAFSPDGK 312



 Score = 68.2 bits (165), Expect = 1e-10
 Identities = 42/150 (28%), Positives = 64/150 (42%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  +     H+  V C+ +  K  ++  +G  D +V +W +          GH + V  I
Sbjct: 79  GNAIHTMSGHTTWVKCVDYSPKGDKV-ASGSIDSTVRIWDVATGQCLHVCKGHDTEVRMI 137

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           AF      VA+ S    IK WD E    ++TL GH+SY   + F   G+   S   +  +
Sbjct: 138 AFSPDGKTVASCSRDTTIKFWDTETGNEVKTLFGHKSYIECIAFSADGKKLVSCGEEPVV 197

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           KIWD+     I  Y         + F+PDG
Sbjct: 198 KIWDLETGKNIANYPTGDTLSHFVSFSPDG 227



 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 25/67 (37%), Positives = 36/67 (53%)
 Frame = +2

Query: 458 EDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIST 637
           ED  +I+TL GH      + F P G+   SGS D  +K+WD+     IHT  GHT  +  
Sbjct: 35  EDAALIKTLVGHEDRVLGVRFSPDGKKLVSGSFDEKVKLWDVETGNAIHTMSGHTTWVKC 94

Query: 638 IRFTPDG 658
           + ++P G
Sbjct: 95  VDYSPKG 101



 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 26/95 (27%), Positives = 46/95 (48%)
 Frame = +2

Query: 299 GDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIR 478
           G D  V +           L GH   V ++ ++ A  L+A+ ++   ++LWD+    ++ 
Sbjct: 234 GRDAKVKVLDAATGQMLKVLEGHEDGVRALCYNPAGTLIASAANDESVRLWDVAKGALVH 293

Query: 479 TLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
           T  GH     ++ F P G+  ASGS D  +K+W +
Sbjct: 294 TYRGHTHEVQSVAFSPDGKVIASGSDDFKIKLWGV 328



 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 27/84 (32%), Positives = 38/84 (45%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A  G  L+    H   V  L +      +  +  +D SV LW + K     T  GHT  V
Sbjct: 244 AATGQMLKVLEGHEDGVRALCYNPAGT-LIASAANDESVRLWDVAKGALVHTYRGHTHEV 302

Query: 380 ESIAFDSAEILVAAGSSSGLIKLW 451
           +S+AF     ++A+GS    IKLW
Sbjct: 303 QSVAFSPDGKVIASGSDDFKIKLW 326



>pir|AF1890|AF1890 WD-repeat protein [imported] - Nostoc sp. (strain
           PCC 7120)>gb:BA000019_681663 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 265

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 42/126 (33%), Positives = 67/126 (53%), Gaps = 2/126 (1%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIG--KPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           ++G  + S+ +W +   +P    T+ GH+  V S+        +A+GS    IKLW   D
Sbjct: 97  VSGSTNGSIKIWQLTTPRPIPLYTIIGHSQAVRSVVISPDGQTLASGSVDQTIKLWSWRD 156

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
             ++RTL+GH     ++ F P G+  ASGS D  +K WDI     I  + GHT  + ++ 
Sbjct: 157 RNLLRTLTGHSGAVWSVAFSPNGQTLASGSNDRTIKRWDIATGQLIDNFVGHTNPVWSVT 216

Query: 644 FTPDGR 661
           F+PDG+
Sbjct: 217 FSPDGQ 222



 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 41/129 (31%), Positives = 73/129 (56%), Gaps = 2/129 (1%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
           R+ ++G  D+ + LW++   T  STL GH   V+++A      LVA+GS+   IKLW+L+
Sbjct: 11  RILVSGSWDNRIKLWNLETNTLISTLDGHKDDVQTVAISPNGKLVASGSADNTIKLWNLD 70

Query: 461 DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCI--HTYKGHTRGIS 634
             K + TL  +  +  ++ F P  +   SGS + ++KIW +     I  +T  GH++ + 
Sbjct: 71  THKQLLTLQ-NADWARSIAFSPDNQTLVSGSTNGSIKIWQLTTPRPIPLYTIIGHSQAVR 129

Query: 635 TIRFTPDGR 661
           ++  +PDG+
Sbjct: 130 SVVISPDGQ 138



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 35/106 (33%), Positives = 55/106 (51%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +G  D ++ LWS        TL+GH+  V S+AF      +A+GS+   IK WD+   ++
Sbjct: 142 SGSVDQTIKLWSWRDRNLLRTLTGHSGAVWSVAFSPNGQTLASGSNDRTIKRWDIATGQL 201

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTY 610
           I    GH +   ++ F P G+  ASGS D  +K+W I+      T+
Sbjct: 202 IDNFVGHTNPVWSVTFSPDGQTLASGSGDQTIKLWSIKSDTSSQTH 247



 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 30/98 (30%), Positives = 51/98 (52%)
 Frame = +2

Query: 377 VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM 556
           + S+A      ++ +GS    IKLW+LE   +I TL GH+     +   P G+  ASGS 
Sbjct: 1   MSSLAMSVDGRILVSGSWDNRIKLWNLETNTLISTLDGHKDDVQTVAISPNGKLVASGSA 60

Query: 557 DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           D  +K+W++     + T + +     +I F+PD + +V
Sbjct: 61  DNTIKLWNLDTHKQLLTLQ-NADWARSIAFSPDNQTLV 97



>sp|Q17963|YKY4_CAEEL Hypothetical 40.4 kDa Trp-Asp repeats
           containing protein C14B1.4 in chromosome
           III.>pir|T19266|T19266 hypothetical protein C14B1.4 -
           Caenorhabditis elegans>gb:CEC14B1_1360435 Caenorhabditis
           elegans cosmid C14B1, complete sequence.
          Length = 376

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 49/179 (27%), Positives = 82/179 (45%), Gaps = 2/179 (1%)
 Frame = +2

Query: 128 AAAERPTPXXXXXXXXXXXXXXRMAKRGYKLQ-EFVAHSGNVNCLRFGKKTCRMFL-TGG 301
           A+A+ P P                    YKL      H+ +++  +F    C  +L T  
Sbjct: 57  ASAQTPNPNAAGASASGSA--------NYKLMCTLEGHTKSISSAKFSP--CGKYLGTSS 106

Query: 302 DDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRT 481
            D +V +W++       TL+GH   V  IA+ S    V + S    +K++++  ++M +T
Sbjct: 107 ADKTVKIWNMDHMICERTLTGHKLGVNDIAWSSDSRCVVSASDDKTLKIFEIVTSRMTKT 166

Query: 482 LSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           L GH +Y     F+P      SGS D +++IWD++   CI T   H+  +S + F  DG
Sbjct: 167 LKGHNNYVFCCNFNPQSSLVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDG 225



 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 42/149 (28%), Positives = 77/149 (51%), Gaps = 4/149 (2%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H+  V C  F  ++  + ++G  D SV +W +       TL  H+ PV +++F+    L+
Sbjct: 170 HNNYVFCCNFNPQSS-LVVSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLI 228

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTA-LEFHPFGEFFASGSMDTNLKIWDIRKK 592
           A+GS  GL+++WD  + + I+TL    +   A ++F P G++  + ++D+ LK+WD  K 
Sbjct: 229 ASGSYDGLVRIWDTANGQCIKTLVDDENPPVAFVKFSPNGKYILASNLDSTLKLWDFSKG 288

Query: 593 GCIHTYKGHTRG---ISTIRFTPDGRWVV 670
             +  Y GH      I        G+W++
Sbjct: 289 KTLKQYTGHENSKYCIFANFSVTGGKWII 317



 Score = 73.9 bits (180), Expect = 2e-12
 Identities = 41/146 (28%), Positives = 74/146 (50%), Gaps = 1/146 (0%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H   VN + +   + R  ++  DD ++ ++ I     T TL GH + V    F+    LV
Sbjct: 128 HKLGVNDIAWSSDS-RCVVSASDDKTLKIFEIVTSRMTKTLKGHNNYVFCCNFNPQSSLV 186

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
            +GS    +++WD++    I+TL  H    +A+ F+  G   ASGS D  ++IWD     
Sbjct: 187 VSGSFDESVRIWDVKTGMCIKTLPAHSDPVSAVSFNRDGSLIASGSYDGLVRIWDTANGQ 246

Query: 596 CIHT-YKGHTRGISTIRFTPDGRWVV 670
           CI T        ++ ++F+P+G++++
Sbjct: 247 CIKTLVDDENPPVAFVKFSPNGKYIL 272



 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 31/111 (27%), Positives = 51/111 (45%)
 Frame = +2

Query: 338 PTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALE 517
           P S S  +   +P    +  +     A  S+SG          K++ TL GH    ++ +
Sbjct: 41  PNSISPSNPTGTPAPGASAQTPNPNAAGASASGSANY------KLMCTLEGHTKSISSAK 94

Query: 518 FHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           F P G++  + S D  +KIW++    C  T  GH  G++ I ++ D R VV
Sbjct: 95  FSPCGKYLGTSSADKTVKIWNMDHMICERTLTGHKLGVNDIAWSSDSRCVV 145



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 26/105 (24%), Positives = 47/105 (44%), Gaps = 6/105 (5%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEIL----VAAGSSSGLIKL 448
           +  L    D ++ LW   K  +    +GH +    I F +  +     + +GS    I +
Sbjct: 269 KYILASNLDSTLKLWDFSKGKTLKQYTGHENSKYCI-FANFSVTGGKWIISGSEDCKIYI 327

Query: 449 WDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM--DTNLKIW 577
           W+L+  ++++ L GH     A + HP     ASG++  D  + IW
Sbjct: 328 WNLQTREIVQCLEGHTQPVLASDCHPVQNIIASGALEPDNKIHIW 372



>sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB
           alpha subunit (PAF acetylhydrolase 45 kDa subunit)
           (PAF-AH 45 kDa subunit) (PAF-AH alpha) (PAFAH alpha)
           (Lissencephaly-1 protein) (LIS-1).
          Length = 409

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 39/125 (31%), Positives = 67/125 (53%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  +D ++ +W         TL GHT  VE I+FD +  L+A+ S+   IKLWD + 
Sbjct: 121 VMVSASEDATIKVWDYETGDFERTLKGHTDSVEDISFDHSGKLLASCSADMTIKLWDFQG 180

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
            + IRT+ GH    +++   P G+   S S D  +K+W+++   C+ T+ GH   +  +R
Sbjct: 181 FECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVR 240

Query: 644 FTPDG 658
              DG
Sbjct: 241 PNQDG 245



 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 39/114 (34%), Positives = 55/114 (48%)
 Frame = +2

Query: 329 IGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           I +P     LSGH SPV  + F     ++ + S    IK+WD E     RTL GH     
Sbjct: 94  IPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVE 153

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + F   G+  AS S D  +K+WD +   CI T  GH   +S++   P+G  +V
Sbjct: 154 DISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIV 207



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 26/99 (26%), Positives = 54/99 (54%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           L+G  D ++ +W +       TL GH + V  + F S    + + +    +++WD ++ +
Sbjct: 311 LSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKR 370

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            ++TL+ H  + T+L+FH    +  +GS+D  +K+W+ R
Sbjct: 371 CMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR 409



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 40/174 (22%), Positives = 72/174 (41%), Gaps = 20/174 (11%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           GY ++ F  H   V  +R   +   +  +  +D +V +W +      + L  H   VE I
Sbjct: 223 GYCVKTFTGHREWVRMVR-PNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECI 281

Query: 389 AFDSAEI--------------------LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           ++                          + +GS    IK+WD+     + TL GH ++  
Sbjct: 282 SWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVR 341

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + FH  G+F  S + D  L++WD + K C+ T   H   ++++ F     +VV
Sbjct: 342 GVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVV 395



 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 28/120 (23%), Positives = 53/120 (44%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D ++ LW         T+ GH   V S+A       + + S    IK+W+++    ++T 
Sbjct: 170 DMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTF 229

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
           +GHR +   +  +  G   AS S D  +++W +  K C    + H   +  I + P+  +
Sbjct: 230 TGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSY 289



 Score = 32.7 bits (73), Expect = 5.9
 Identities = 21/82 (25%), Positives = 32/82 (39%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L   V H   V  + F     +  L+  DD ++ +W         TL+ H   V S+
Sbjct: 327 GMCLMTLVGHDNWVRGVLFHSGG-KFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSL 385

Query: 389 AFDSAEILVAAGSSSGLIKLWD 454
            F      V  GS    +K+W+
Sbjct: 386 DFHKTAPYVVTGSVDQTVKVWE 407



>gb:BC055275_2551353 Danio rerio zgc:63538, mRNA (cDNA clone
           MGC:63538 IMAGE:3815924), complete cds.
          Length = 490

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 42/141 (29%), Positives = 69/141 (48%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H+  V C RF     R+  + GDD +V LW       T+  + +      + F+S+   +
Sbjct: 143 HTNWVRCARFSPDG-RLIASCGDDRTVRLWDTSSHQCTNIFTDYGGSATFVDFNSSGTCI 201

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
           A+  +   IK+WD+   K+I+    H +      FHP G +  SGS D+ +KI D+ +  
Sbjct: 202 ASSGADNTIKIWDIRTNKLIQHYKVHNAGVNCFSFHPSGNYLISGSSDSTIKILDLLEGR 261

Query: 596 CIHTYKGHTRGISTIRFTPDG 658
            I+T  GH   + T+ F+ DG
Sbjct: 262 LIYTLHGHKGPVLTVTFSRDG 282



 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 42/148 (28%), Positives = 70/148 (47%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           F AH+ +V  + F +   R+ +T  DD SV +W + +     +L+ HT+ V    F    
Sbjct: 98  FKAHTASVRSVNFSRDGQRL-VTASDDKSVKVWGVERKKFLYSLNRHTNWVRCARFSPDG 156

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            L+A+      ++LWD    +     + +    T ++F+  G   AS   D  +KIWDIR
Sbjct: 157 RLIASCGDDRTVRLWDTSSHQCTNIFTDYGGSATFVDFNSSGTCIASSGADNTIKIWDIR 216

Query: 587 KKGCIHTYKGHTRGISTIRFTPDGRWVV 670
               I  YK H  G++   F P G +++
Sbjct: 217 TNKLIQHYKVHNAGVNCFSFHPSGNYLI 244



 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 35/149 (23%), Positives = 65/149 (43%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           + F  H   ++C  F     +   TG  D S+ +W++          GHT  +  + F  
Sbjct: 12  RHFKGHKDVISCADFNPNN-KQLATGSCDKSLMIWNLAPKARAFRFVGHTDVITGVNFAP 70

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
           +  LVA+ S    ++LW             H +   ++ F   G+   + S D ++K+W 
Sbjct: 71  SGSLVASSSRDQTVRLWTPSIKGESTVFKAHTASVRSVNFSRDGQRLVTASDDKSVKVWG 130

Query: 581 IRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           + +K  +++   HT  +   RF+PDGR +
Sbjct: 131 VERKKFLYSLNRHTNWVRCARFSPDGRLI 159



 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 30/111 (27%), Positives = 47/111 (42%)
 Frame = +2

Query: 338 PTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALE 517
           PT      GH   +    F+     +A GS    + +W+L          GH    T + 
Sbjct: 8   PTLERHFKGHKDVISCADFNPNNKQLATGSCDKSLMIWNLAPKARAFRFVGHTDVITGVN 67

Query: 518 FHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           F P G   AS S D  +++W    KG    +K HT  + ++ F+ DG+ +V
Sbjct: 68  FAPSGSLVASSSRDQTVRLWTPSIKGESTVFKAHTASVRSVNFSRDGQRLV 118



 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 32/118 (27%), Positives = 55/118 (46%), Gaps = 1/118 (0%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKK-TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSA 403
           F  + G+   + F    TC    + G D+++ +W I           H + V   +F  +
Sbjct: 182 FTDYGGSATFVDFNSSGTC--IASSGADNTIKIWDIRTNKLIQHYKVHNAGVNCFSFHPS 239

Query: 404 EILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
              + +GSS   IK+ DL + ++I TL GH+     + F   G+ FASG  D+ + +W
Sbjct: 240 GNYLISGSSDSTIKILDLLEGRLIYTLHGHKGPVLTVTFSRDGDLFASGGADSQVLMW 297



 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 23/71 (32%), Positives = 37/71 (52%)
 Frame = +2

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
           +ED  + R   GH+   +  +F+P  +  A+GS D +L IW++  K     + GHT  I+
Sbjct: 5   MEDPTLERHFKGHKDVISCADFNPNNKQLATGSCDKSLMIWNLAPKARAFRFVGHTDVIT 64

Query: 635 TIRFTPDGRWV 667
            + F P G  V
Sbjct: 65  GVNFAPSGSLV 75



>gb:AY032881_2508795 Xenopus laevis LIS1 mRNA, complete cds.
          Length = 410

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 38/125 (30%), Positives = 67/125 (53%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + +T  +D ++ +W         TL GHT  V+ I+FD +  L+A+ S+   IKLWD + 
Sbjct: 122 VMVTASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG 181

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
            + +RT+ GH    +++   P G+   S S D  +K+W+++   C+ T+ GH   +  +R
Sbjct: 182 FECLRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVR 241

Query: 644 FTPDG 658
              DG
Sbjct: 242 PNQDG 246



 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 38/114 (33%), Positives = 54/114 (47%)
 Frame = +2

Query: 329 IGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           I +P     LSGH SPV  + F     ++   S    IK+WD E     RTL GH     
Sbjct: 95  IPRPPEKYALSGHRSPVTRVIFHPVFSVMVTASEDATIKVWDYETGDFERTLKGHTDSVQ 154

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + F   G+  AS S D  +K+WD +   C+ T  GH   +S++   P+G  +V
Sbjct: 155 DISFDHSGKLLASCSADMTIKLWDFQGFECLRTMHGHDHNVSSVAIMPNGDHIV 208



 Score = 66.6 bits (161), Expect = 4e-10
 Identities = 27/99 (27%), Positives = 53/99 (53%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           L+G  D ++ +W I       TL GH + V  + F      + + +    I++WD ++ +
Sbjct: 312 LSGSRDKTIKMWDISIGMCLMTLVGHDNWVRGVQFHPGGKFILSCADDKTIRIWDYKNKR 371

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            ++TL+ H  + T+L+FH    +  +GS+D  +K+W+ R
Sbjct: 372 CMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR 410



 Score = 66.2 bits (160), Expect = 5e-10
 Identities = 42/174 (24%), Positives = 78/174 (44%), Gaps = 20/174 (11%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           GY ++ F  H   V  +R   +   +  +  +D +V +W +      + L  H   VE I
Sbjct: 224 GYCVKTFTGHREWVRMVR-PNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECI 282

Query: 389 AF--DSAEILVA------------------AGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           ++  +S+   ++                  +GS    IK+WD+     + TL GH ++  
Sbjct: 283 SWAPESSYSTISDATGSETKRSGKPGPFLLSGSRDKTIKMWDISIGMCLMTLVGHDNWVR 342

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            ++FHP G+F  S + D  ++IWD + K C+ T   H   ++++ F     +VV
Sbjct: 343 GVQFHPGGKFILSCADDKTIRIWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVV 396



 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 28/120 (23%), Positives = 53/120 (44%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D ++ LW         T+ GH   V S+A       + + S    IK+W+++    ++T 
Sbjct: 171 DMTIKLWDFQGFECLRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTF 230

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
           +GHR +   +  +  G   AS S D  +++W +  K C    + H   +  I + P+  +
Sbjct: 231 TGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSY 290



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 21/82 (25%), Positives = 33/82 (40%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L   V H   V  ++F     +  L+  DD ++ +W         TL+ H   V S+
Sbjct: 328 GMCLMTLVGHDNWVRGVQFHPGG-KFILSCADDKTIRIWDYKNKRCMKTLNAHEHFVTSL 386

Query: 389 AFDSAEILVAAGSSSGLIKLWD 454
            F      V  GS    +K+W+
Sbjct: 387 DFHKTAPYVVTGSVDQTVKVWE 408



>gb:AK127882_1916943 Homo sapiens cDNA FLJ45988 fis, clone
           PUAEN2006639, weakly similar to Vegetatible
           incompatibility protein HET-E-1.
          Length = 369

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 45/134 (33%), Positives = 68/134 (50%), Gaps = 1/134 (0%)
 Frame = +2

Query: 272 KTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE-ILVAAGSSSGLIKL 448
           K+   F+TG  D +  LW        +TL GH + V +IAF++     +A GS     KL
Sbjct: 102 KSGSCFITGSYDRTCKLWDSASGEELNTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKL 161

Query: 449 WDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRG 628
           W +E  K   T  GH +    L F+P     A+GSMDT  K+WDI+    ++T +GH+  
Sbjct: 162 WSVETGKCYHTFRGHTAEIVCLSFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHSAE 221

Query: 629 ISTIRFTPDGRWVV 670
           I ++ F   G  ++
Sbjct: 222 IISLSFNTSGDRII 235



 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 43/149 (28%), Positives = 67/149 (44%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +L     H   V  + F         TG  D +  LWS+       T  GHT+ +  +
Sbjct: 124 GEELNTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCL 183

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           +F+    LVA GS     KLWD+++ + + TL GH +   +L F+  G+   +GS D  +
Sbjct: 184 SFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHSAEIISLSFNTSGDRIITGSFDHTV 243

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
            +WD      ++   GH   IS+  F  D
Sbjct: 244 VVWDADTGRKVNILIGHCAEISSASFNWD 272



 Score = 73.2 bits (178), Expect = 4e-12
 Identities = 35/105 (33%), Positives = 53/105 (50%), Gaps = 1/105 (0%)
 Frame = +2

Query: 356 LSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEF-HPFG 532
           L  H  P+ ++A + +      GS     KLWD    + + TL GHR+   A+ F +P+G
Sbjct: 88  LKAHILPLTNVALNKSGSCFITGSYDRTCKLWDSASGEELNTLEGHRNVVYAIAFNNPYG 147

Query: 533 EFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           +  A+GS D   K+W +    C HT++GHT  I  + F P    V
Sbjct: 148 DKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSFNPQSTLV 192



 Score = 72.4 bits (176), Expect = 7e-12
 Identities = 39/147 (26%), Positives = 68/147 (46%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           F  H+  + CL F  ++  +  TG  D +  LW I       TL GH++ + S++F+++ 
Sbjct: 173 FRGHTAEIVCLSFNPQST-LVATGSMDTTAKLWDIQNGEEVYTLRGHSAEIISLSFNTSG 231

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
             +  GS    + +WD +  + +  L GH +  ++  F+       +GSMD   K+WD  
Sbjct: 232 DRIITGSFDHTVVVWDADTGRKVNILIGHCAEISSASFNWDCSLILTGSMDKTCKLWDAT 291

Query: 587 KKGCIHTYKGHTRGISTIRFTPDGRWV 667
              C+ T  GH   I    F   G+ +
Sbjct: 292 NGKCVATLTGHDDEILDSCFDYTGKLI 318



 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 34/124 (27%), Positives = 55/124 (44%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           + G ++     HS  +  L F     R+ +TG  DH+V +W        + L GH + + 
Sbjct: 207 QNGEEVYTLRGHSAEIISLSFNTSGDRI-ITGSFDHTVVVWDADTGRKVNILIGHCAEIS 265

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
           S +F+    L+  GS     KLWD  + K + TL+GH        F   G+  A+ S D 
Sbjct: 266 SASFNWDCSLILTGSMDKTCKLWDATNGKCVATLTGHDDEILDSCFDYTGKLIATASADD 325

Query: 563 NLKI 574
            + +
Sbjct: 326 GVSL 329



 Score = 32.3 bits (72), Expect = 7.7
 Identities = 16/59 (27%), Positives = 26/59 (44%)
 Frame = +2

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
           + + L  H    T +  +  G  F +GS D   K+WD      ++T +GH   +  I F
Sbjct: 84  LFKVLKAHILPLTNVALNKSGSCFITGSYDRTCKLWDSASGEELNTLEGHRNVVYAIAF 142



>gb:AK098821_1915232 Homo sapiens cDNA FLJ25955 fis, clone TST03904.
          Length = 415

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 45/134 (33%), Positives = 68/134 (50%), Gaps = 1/134 (0%)
 Frame = +2

Query: 272 KTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE-ILVAAGSSSGLIKL 448
           K+   F+TG  D +  LW        +TL GH + V +IAF++     +A GS     KL
Sbjct: 102 KSGSCFITGSYDRTCKLWDSASGEELNTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKL 161

Query: 449 WDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRG 628
           W +E  K   T  GH +    L F+P     A+GSMDT  K+WDI+    ++T +GH+  
Sbjct: 162 WSVETGKCYHTFRGHTAEIVCLSFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHSAE 221

Query: 629 ISTIRFTPDGRWVV 670
           I ++ F   G  ++
Sbjct: 222 IISLSFNTSGDRII 235



 Score = 82.0 bits (201), Expect = 8e-15
 Identities = 44/157 (28%), Positives = 68/157 (43%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A  G K+   + H   ++   F    C + LTG  D +  LW        +TL+GH   +
Sbjct: 248 ADTGRKVNILIGHCAEISSASFNWD-CSLILTGSMDKTCKLWDATNGKCVATLTGHDDEI 306

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
               FD    L+A  S+ G  +++     K I  L GH    + + F+P G    +GS D
Sbjct: 307 LDSCFDYTGKLIATASADGTARIFSAATRKCIAKLEGHEGEISKISFNPQGNHLLTGSSD 366

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
              +IWD +   C+   +GHT  I +  F   G  V+
Sbjct: 367 KTARIWDAQTGQCLQVLEGHTDEIFSCAFNYKGNIVI 403



 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 43/149 (28%), Positives = 67/149 (44%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +L     H   V  + F         TG  D +  LWS+       T  GHT+ +  +
Sbjct: 124 GEELNTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCL 183

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           +F+    LVA GS     KLWD+++ + + TL GH +   +L F+  G+   +GS D  +
Sbjct: 184 SFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHSAEIISLSFNTSGDRIITGSFDHTV 243

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
            +WD      ++   GH   IS+  F  D
Sbjct: 244 VVWDADTGRKVNILIGHCAEISSASFNWD 272



 Score = 73.9 bits (180), Expect = 2e-12
 Identities = 45/152 (29%), Positives = 68/152 (44%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           + G ++     HS  +  L F     R+ +TG  DH+V +W        + L GH + + 
Sbjct: 207 QNGEEVYTLRGHSAEIISLSFNTSGDRI-ITGSFDHTVVVWDADTGRKVNILIGHCAEIS 265

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
           S +F+    L+  GS     KLWD  + K + TL+GH        F   G+  A+ S D 
Sbjct: 266 SASFNWDCSLILTGSMDKTCKLWDATNGKCVATLTGHDDEILDSCFDYTGKLIATASADG 325

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
             +I+    + CI   +GH   IS I F P G
Sbjct: 326 TARIFSAATRKCIAKLEGHEGEISKISFNPQG 357



 Score = 73.2 bits (178), Expect = 4e-12
 Identities = 35/105 (33%), Positives = 53/105 (50%), Gaps = 1/105 (0%)
 Frame = +2

Query: 356 LSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEF-HPFG 532
           L  H  P+ ++A + +      GS     KLWD    + + TL GHR+   A+ F +P+G
Sbjct: 88  LKAHILPLTNVALNKSGSCFITGSYDRTCKLWDSASGEELNTLEGHRNVVYAIAFNNPYG 147

Query: 533 EFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           +  A+GS D   K+W +    C HT++GHT  I  + F P    V
Sbjct: 148 DKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSFNPQSTLV 192



 Score = 72.4 bits (176), Expect = 7e-12
 Identities = 39/147 (26%), Positives = 68/147 (46%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           F  H+  + CL F  ++  +  TG  D +  LW I       TL GH++ + S++F+++ 
Sbjct: 173 FRGHTAEIVCLSFNPQST-LVATGSMDTTAKLWDIQNGEEVYTLRGHSAEIISLSFNTSG 231

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
             +  GS    + +WD +  + +  L GH +  ++  F+       +GSMD   K+WD  
Sbjct: 232 DRIITGSFDHTVVVWDADTGRKVNILIGHCAEISSASFNWDCSLILTGSMDKTCKLWDAT 291

Query: 587 KKGCIHTYKGHTRGISTIRFTPDGRWV 667
              C+ T  GH   I    F   G+ +
Sbjct: 292 NGKCVATLTGHDDEILDSCFDYTGKLI 318



 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 23/101 (22%), Positives = 43/101 (42%)
 Frame = +2

Query: 275 TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           T ++  T   D +  ++S       + L GH   +  I+F+     +  GSS    ++WD
Sbjct: 314 TGKLIATASADGTARIFSAATRKCIAKLEGHEGEISKISFNPQGNHLLTGSSDKTARIWD 373

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
            +  + ++ L GH     +  F+  G    +GS     +IW
Sbjct: 374 AQTGQCLQVLEGHTDEIFSCAFNYKGNIVITGSKGNTCRIW 414



 Score = 32.3 bits (72), Expect = 7.7
 Identities = 16/59 (27%), Positives = 26/59 (44%)
 Frame = +2

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
           + + L  H    T +  +  G  F +GS D   K+WD      ++T +GH   +  I F
Sbjct: 84  LFKVLKAHILPLTNVALNKSGSCFITGSYDRTCKLWDSASGEELNTLEGHRNVVYAIAF 142



>gb:AE017348_1758402 Cryptococcus neoformans var. neoformans JEC21
           chromosome 8, complete sequence.
          Length = 813

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 43/157 (27%), Positives = 76/157 (48%), Gaps = 6/157 (3%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRF-----GKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGH-T 370
           G  +++ V HSG V  L F             L+   D S+ LWS+   ++     GH  
Sbjct: 514 GLPMRKLVGHSGPVYSLSFDPLYGSAGPPSTLLSSSQDGSIRLWSMDTYSNLVVYRGHGK 573

Query: 371 SPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASG 550
            PV  + +    +  A+ S     +LW  +    +R  +GH S    ++FHP   + A+ 
Sbjct: 574 DPVWDVEWGPMGVYFASASRDRTARLWSSDRVAPLRMYTGHLSDVNCVKFHPNSLYLATA 633

Query: 551 SMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
           S DT+ ++WD+++  C+  + GHT  ++T+  +PDG+
Sbjct: 634 STDTSCRLWDVQRGACVRLFLGHTDSVTTLSISPDGK 670



 Score = 69.3 bits (168), Expect = 6e-11
 Identities = 33/128 (25%), Positives = 60/128 (46%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F +   D +  LWS  +       +GH S V  + F    + +A  S+    +LWD++  
Sbjct: 588 FASASRDRTARLWSSDRVAPLRMYTGHLSDVNCVKFHPNSLYLATASTDTSCRLWDVQRG 647

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
             +R   GH    T L   P G+  AS  +D+++ +WD+     I   +GHT  ++++ F
Sbjct: 648 ACVRLFLGHTDSVTTLSISPDGKTLASAGLDSSIWLWDLGSARPIKKMEGHTGAVTSLTF 707

Query: 647 TPDGRWVV 670
           + +   +V
Sbjct: 708 SAESSVLV 715



 Score = 66.2 bits (160), Expect = 5e-10
 Identities = 33/126 (26%), Positives = 56/126 (44%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           L+ +  H  +VNC++F   +  +  T   D S  LW + +        GHT  V +++  
Sbjct: 608 LRMYTGHLSDVNCVKFHPNSLYL-ATASTDTSCRLWDVQRGACVRLFLGHTDSVTTLSIS 666

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                +A+      I LWDL   + I+ + GH    T+L F        SG +D  ++ W
Sbjct: 667 PDGKTLASAGLDSSIWLWDLGSARPIKKMEGHTGAVTSLTFSAESSVLVSGGLDGTVRCW 726

Query: 578 DIRKKG 595
           D++  G
Sbjct: 727 DVKSAG 732



 Score = 59.3 bits (142), Expect = 6e-08
 Identities = 41/171 (23%), Positives = 71/171 (41%), Gaps = 27/171 (15%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSI--------------------GKPTSTST 355
           H  N N + F + +  M + G  +  V LWS+                    G P     
Sbjct: 463 HGENANSVEFSRDSSLMAV-GSSESCVRLWSLKGDKLKKKKVDIEGNLVEDEGLPMRK-- 519

Query: 356 LSGHTSPVESIAFD------SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGH-RSYCTAL 514
           L GH+ PV S++FD           + + S  G I+LW ++    +    GH +     +
Sbjct: 520 LVGHSGPVYSLSFDPLYGSAGPPSTLLSSSQDGSIRLWSMDTYSNLVVYRGHGKDPVWDV 579

Query: 515 EFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           E+ P G +FAS S D   ++W   +   +  Y GH   ++ ++F P+  ++
Sbjct: 580 EWGPMGVYFASASRDRTARLWSSDRVAPLRMYTGHLSDVNCVKFHPNSLYL 630



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 24/96 (25%), Positives = 46/96 (47%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           +RG  ++ F+ H+ +V  L       +   + G D S+ LW +G       + GHT  V 
Sbjct: 645 QRGACVRLFLGHTDSVTTLSISPDG-KTLASAGLDSSIWLWDLGSARPIKKMEGHTGAVT 703

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSG 490
           S+ F +   ++ +G   G ++ WD++     R++ G
Sbjct: 704 SLTFSAESSVLVSGGLDGTVRCWDVKSAGGERSVDG 739



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 28/113 (24%), Positives = 43/113 (38%), Gaps = 24/113 (21%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM------------------IR 478
           TL  H     S+ F     L+A GSS   ++LW L+  K+                  +R
Sbjct: 459 TLFDHGENANSVEFSRDSSLMAVGSSESCVRLWSLKGDKLKKKKVDIEGNLVEDEGLPMR 518

Query: 479 TLSGHRSYCTALEFHPF------GEFFASGSMDTNLKIWDIRKKGCIHTYKGH 619
            L GH     +L F P            S S D ++++W +     +  Y+GH
Sbjct: 519 KLVGHSGPVYSLSFDPLYGSAGPPSTLLSSSQDGSIRLWSMDTYSNLVVYRGH 571



>gb:CR382138_1671323 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 777

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 39/149 (26%), Positives = 72/149 (48%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           ++ + HSG V  + F     R  ++G +D +V LWS+   ++  +  GH  P+  + F  
Sbjct: 490 RKLIGHSGPVYGVSFSPDN-RYLISGSEDKTVRLWSLDSYSALVSYKGHNQPIWDVKFSP 548

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
                A  S     +LW  +    +R  +GH +    +EFHP   +  +GS D   ++WD
Sbjct: 549 FGHYFATASHDQTARLWATDHIYPLRIFAGHINDVDCIEFHPNSNYVFTGSSDKTCRMWD 608

Query: 581 IRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           ++    +  + GHT  ++ +  + DGRW+
Sbjct: 609 VQTGNSVRIFMGHTGPVNCMAVSSDGRWL 637



 Score = 58.9 bits (141), Expect = 8e-08
 Identities = 34/125 (27%), Positives = 52/125 (41%), Gaps = 1/125 (0%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F T   D +  LW+          +GH + V+ I F      V  GSS    ++WD++  
Sbjct: 553 FATASHDQTARLWATDHIYPLRIFAGHINDVDCIEFHPNSNYVFTGSSDKTCRMWDVQTG 612

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTR-GISTIR 643
             +R   GH      +     G + AS   D  + IWD      + T +GH R  I ++ 
Sbjct: 613 NSVRIFMGHTGPVNCMAVSSDGRWLASAGEDGVVNIWDAGSGRRLKTMRGHGRSSIYSLA 672

Query: 644 FTPDG 658
           F+ DG
Sbjct: 673 FSRDG 677



 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 30/117 (25%), Positives = 50/117 (42%), Gaps = 13/117 (11%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM-------------IRTLSGH 493
           T     + +  + F+    L+AAG     IKLW L+   +              R L GH
Sbjct: 436 TFHNANNDMTCLDFNDDSNLMAAGFQDSFIKLWSLDGKPLKSVFKKDKYNNDNSRKLIGH 495

Query: 494 RSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
                 + F P   +  SGS D  +++W +     + +YKGH + I  ++F+P G +
Sbjct: 496 SGPVYGVSFSPDNRYLISGSEDKTVRLWSLDSYSALVSYKGHNQPIWDVKFSPFGHY 552



 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 23/85 (27%), Positives = 43/85 (50%), Gaps = 1/85 (1%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGH-TSPVES 385
           G  ++ F+ H+G VNC+       R   + G+D  VN+W  G      T+ GH  S + S
Sbjct: 612 GNSVRIFMGHTGPVNCMAVSSDG-RWLASAGEDGVVNIWDAGSGRRLKTMRGHGRSSIYS 670

Query: 386 IAFDSAEILVAAGSSSGLIKLWDLE 460
           +AF     ++ +  +   +++WD++
Sbjct: 671 LAFSRDGGVLVSSGADNTVRVWDVK 695



 Score = 32.3 bits (72), Expect = 7.7
 Identities = 24/110 (21%), Positives = 46/110 (41%), Gaps = 16/110 (14%)
 Frame = +2

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTK---MIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
           A D    ++A   S   IKL  ++ +     + T     +  T L+F+      A+G  D
Sbjct: 403 ASDIKRQILAVEDSRSKIKLGAIQASAPSVCMYTFHNANNDMTCLDFNDDSNLMAAGFQD 462

Query: 560 TNLKIWDIRKKGCIHTYK-------------GHTRGISTIRFTPDGRWVV 670
           + +K+W +  K     +K             GH+  +  + F+PD R+++
Sbjct: 463 SFIKLWSLDGKPLKSVFKKDKYNNDNSRKLIGHSGPVYGVSFSPDNRYLI 512



>gb:BC088497_2565630 Xenopus tropicalis cDNA clone MGC:97562
           IMAGE:6976262, complete cds.
          Length = 537

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 47/129 (36%), Positives = 69/129 (53%), Gaps = 2/129 (1%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSI--GKPTSTSTLSGHTSPVESIAFDS 400
           F AH G VN +RF   + R+  TGG D  V LW +   K  +  +L+G  + + SI FDS
Sbjct: 248 FDAHDGEVNAVRFSPGS-RLLATGGMDRRVKLWDVIGNKCEAKGSLTGSNAGITSIEFDS 306

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
           A   + A S+    ++W ++D ++  TL+GH     + +F        SGS D  LK+WD
Sbjct: 307 AGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWD 366

Query: 581 IRKKGCIHT 607
           +R K CI T
Sbjct: 367 LRSKVCIKT 375



 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 29/112 (25%), Positives = 50/112 (44%), Gaps = 2/112 (1%)
 Frame = +2

Query: 341 TSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIR--TLSGHRSYCTAL 514
           T+  +   H   V ++ F     L+A G     +KLWD+   K     +L+G  +  T++
Sbjct: 243 TAVYSFDAHDGEVNAVRFSPGSRLLATGGMDRRVKLWDVIGNKCEAKGSLTGSNAGITSI 302

Query: 515 EFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           EF   G +  + S D   +IW +      HT  GH+  + + +F  D   +V
Sbjct: 303 EFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIV 354



 Score = 35.8 bits (81), Expect = 0.69
 Identities = 29/132 (21%), Positives = 54/132 (40%), Gaps = 5/132 (3%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           ++G  D  +  W I        L      + ++  +     + + S   LIK+ DL    
Sbjct: 393 MSGHFDKKIRFWDIRTECIVRELELQ-GRITALDLNPERTQLLSCSRDDLIKITDLRANA 451

Query: 470 MIRTLSGHRSYC----TALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTY-KGHTRGIS 634
           + +T S     C    T + F P G + ++GS +  L  W++        + K H+  I+
Sbjct: 452 VQQTFSAPGFKCGSDWTRVIFSPDGSYVSAGSAEGTLYFWNVLTGKVERMFSKQHSSSIN 511

Query: 635 TIRFTPDGRWVV 670
            + ++P G  VV
Sbjct: 512 AVAWSPSGTHVV 523



>gb:BC086465_2564881 Xenopus laevis hypothetical LOC495838, mRNA
           (cDNA clone IMAGE:3401654), partial cds.
          Length = 322

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 47/129 (36%), Positives = 69/129 (53%), Gaps = 2/129 (1%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSI--GKPTSTSTLSGHTSPVESIAFDS 400
           F AH G VN +RF   + R+  TGG D  V LW +   K  +  +L+G  + + SI FDS
Sbjct: 33  FDAHDGEVNAVRFSPGS-RLLATGGMDRRVKLWDVIGNKCEAKGSLTGSNAGITSIEFDS 91

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
           A   + A S+    ++W ++D ++  TL+GH     + +F        SGS D  LK+WD
Sbjct: 92  AGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWD 151

Query: 581 IRKKGCIHT 607
           +R K CI T
Sbjct: 152 LRSKVCIKT 160



 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 29/112 (25%), Positives = 50/112 (44%), Gaps = 2/112 (1%)
 Frame = +2

Query: 341 TSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIR--TLSGHRSYCTAL 514
           T+  +   H   V ++ F     L+A G     +KLWD+   K     +L+G  +  T++
Sbjct: 28  TAVYSFDAHDGEVNAVRFSPGSRLLATGGMDRRVKLWDVIGNKCEAKGSLTGSNAGITSI 87

Query: 515 EFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           EF   G +  + S D   +IW +      HT  GH+  + + +F  D   +V
Sbjct: 88  EFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIV 139



 Score = 35.8 bits (81), Expect = 0.69
 Identities = 29/132 (21%), Positives = 54/132 (40%), Gaps = 5/132 (3%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           ++G  D  +  W I        L      + ++  +     + + S   LIK+ DL    
Sbjct: 178 MSGHFDKKIRFWDIRTECIVRELELQ-GRITALDLNPERTQLLSCSRDDLIKITDLRANA 236

Query: 470 MIRTLSGHRSYC----TALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTY-KGHTRGIS 634
           + +T S     C    T + F P G + ++GS +  L  W++        + K H+  I+
Sbjct: 237 VQQTFSAPGFKCGSDWTRVIFSPDGNYVSAGSAEGTLYFWNVLTGKMERMFSKQHSSSIN 296

Query: 635 TIRFTPDGRWVV 670
            + ++P G  VV
Sbjct: 297 AVAWSPSGTHVV 308



>gb:BC064252_2553805 Xenopus tropicalis hypothetical protein
           MGC76247, mRNA (cDNA clone MGC:76247 IMAGE:5378990),
           complete cds.
          Length = 415

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 47/149 (31%), Positives = 69/149 (46%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +L     H   V  ++F         TG  D +  LWS        T  GHT+ +  +
Sbjct: 124 GEELHTLEGHRNVVYAIQFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCL 183

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           AF+    L+A GS     KLWD++  +   TLSGH +   +L F+  G+   +GS D  +
Sbjct: 184 AFNPQSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFNTTGDRLITGSFDHTV 243

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
            +W+I     IHT  GH   IS+ +F  D
Sbjct: 244 SVWEIPSGRRIHTLIGHRGEISSAQFNWD 272



 Score = 82.4 bits (202), Expect = 6e-15
 Identities = 44/156 (28%), Positives = 74/156 (47%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A+ G     F  H+  + CL F  ++  +  TG  D +  LW I       TLSGH + +
Sbjct: 164 AETGKCYHTFRGHTAEIVCLAFNPQST-LIATGSMDTTAKLWDIQSGEEALTLSGHAAEI 222

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
            S++F++    +  GS    + +W++   + I TL GHR   ++ +F+      A+ SMD
Sbjct: 223 ISLSFNTTGDRLITGSFDHTVSVWEIPSGRRIHTLIGHRGEISSAQFNWDCSLIATASMD 282

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            + K+WD     C+ T  GH   +  + F   G+ V
Sbjct: 283 KSCKLWDSLNGKCVATLTGHEDEVLDVTFDSTGQLV 318



 Score = 75.9 bits (185), Expect = 6e-13
 Identities = 40/154 (25%), Positives = 67/154 (43%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G ++   + H G ++  +F    C +  T   D S  LW        +TL+GH   V  +
Sbjct: 251 GRRIHTLIGHRGEISSAQFNWD-CSLIATASMDKSCKLWDSLNGKCVATLTGHEDEVLDV 309

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            FDS   LVA  S+ G  +++     K +  L GH    + + F+  G    + S D   
Sbjct: 310 TFDSTGQLVATASADGTARVYSASSRKCLAKLEGHEGEISKICFNAQGNRILTASSDKTS 369

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           ++W+     C+   KGHT  I +  F  +G  ++
Sbjct: 370 RLWNPHTGECLQVLKGHTDEIFSCAFNYEGNTII 403



 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 43/130 (33%), Positives = 59/130 (45%), Gaps = 1/130 (0%)
 Frame = +2

Query: 272 KTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE-ILVAAGSSSGLIKL 448
           K+   F+TG  D +  +W         TL GH + V +I F++     +A GS     KL
Sbjct: 102 KSGSSFITGSYDRTCKVWDTASGEELHTLEGHRNVVYAIQFNNPYGDKIATGSFDKTCKL 161

Query: 449 WDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRG 628
           W  E  K   T  GH +    L F+P     A+GSMDT  K+WDI+      T  GH   
Sbjct: 162 WSAETGKCYHTFRGHTAEIVCLAFNPQSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAE 221

Query: 629 ISTIRFTPDG 658
           I ++ F   G
Sbjct: 222 IISLSFNTTG 231



 Score = 73.2 bits (178), Expect = 4e-12
 Identities = 42/145 (28%), Positives = 66/145 (45%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H+  +  L F     R+ +TG  DH+V++W I       TL GH   + S  F+    L+
Sbjct: 218 HAAEIISLSFNTTGDRL-ITGSFDHTVSVWEIPSGRRIHTLIGHRGEISSAQFNWDCSLI 276

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
           A  S     KLWD  + K + TL+GH      + F   G+  A+ S D   +++    + 
Sbjct: 277 ATASMDKSCKLWDSLNGKCVATLTGHEDEVLDVTFDSTGQLVATASADGTARVYSASSRK 336

Query: 596 CIHTYKGHTRGISTIRFTPDGRWVV 670
           C+   +GH   IS I F   G  ++
Sbjct: 337 CLAKLEGHEGEISKICFNAQGNRIL 361



 Score = 73.2 bits (178), Expect = 4e-12
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 1/100 (1%)
 Frame = +2

Query: 356 LSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEF-HPFG 532
           L  H  P+ ++AF+ +      GS     K+WD    + + TL GHR+   A++F +P+G
Sbjct: 88  LRAHILPLTNVAFNKSGSSFITGSYDRTCKVWDTASGEELHTLEGHRNVVYAIQFNNPYG 147

Query: 533 EFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           +  A+GS D   K+W      C HT++GHT  I  + F P
Sbjct: 148 DKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLAFNP 187



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 18/59 (30%), Positives = 28/59 (47%)
 Frame = +2

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
           + + L  H    T + F+  G  F +GS D   K+WD      +HT +GH   +  I+F
Sbjct: 84  LFKVLRAHILPLTNVAFNKSGSSFITGSYDRTCKVWDTASGEELHTLEGHRNVVYAIQF 142



>gb:CR382136_1669320 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 1209

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 41/133 (30%), Positives = 72/133 (54%), Gaps = 3/133 (2%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           + G  +  F  H G V C+ F   T  +F++GGDD+S+ +WS+       TL+GH   + 
Sbjct: 41  RMGTLIDRFEDHEGPVRCVDF-HPTQPLFVSGGDDYSIKVWSLNTRKCIFTLNGHLDYIR 99

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
           +++F      + + S    I++W+ ++ + I  L+GH  Y  + +FHP  +   S S+D 
Sbjct: 100 TVSFHRDLPWIISCSDDQTIRIWNWQNRQEIACLTGHNHYVMSAQFHPSEDLIVSASLDQ 159

Query: 563 NLKIWDI---RKK 592
            +++WDI   RKK
Sbjct: 160 TVRVWDISGLRKK 172



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 30/101 (29%), Positives = 45/101 (44%)
 Frame = +2

Query: 368 TSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFAS 547
           +S  + +AF      V     S  I+LWD     +I     H      ++FHP    F S
Sbjct: 11  SSRAKGVAFHPKRPWVLVSLHSSTIQLWDYRMGTLIDRFEDHEGPVRCVDFHPTQPLFVS 70

Query: 548 GSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           G  D ++K+W +  + CI T  GH   I T+ F  D  W++
Sbjct: 71  GGDDYSIKVWSLNTRKCIFTLNGHLDYIRTVSFHRDLPWII 111



 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 33/120 (27%), Positives = 51/120 (42%)
 Frame = +2

Query: 311 SVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSG 490
           ++ LW     T       H  PV  + F   + L  +G     IK+W L   K I TL+G
Sbjct: 34  TIQLWDYRMGTLIDRFEDHEGPVRCVDFHPTQPLFVSGGDDYSIKVWSLNTRKCIFTLNG 93

Query: 491 HRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           H  Y   + FH    +  S S D  ++IW+ + +  I    GH   + + +F P    +V
Sbjct: 94  HLDYIRTVSFHRDLPWIISCSDDQTIRIWNWQNRQEIACLTGHNHYVMSAQFHPSEDLIV 153



 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 26/88 (29%), Positives = 40/88 (45%), Gaps = 2/88 (2%)
 Frame = +2

Query: 356 LSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM--IRTLSGHRSYCTALEFHPF 529
           L GH   V   AF     L+ +     L+KLW + DTK   + T  GH        FHP 
Sbjct: 209 LEGHDKGVNWAAFHPTLPLIVSAGDDRLVKLWRMSDTKAWEVDTCRGHTGNVLCATFHPN 268

Query: 530 GEFFASGSMDTNLKIWDIRKKGCIHTYK 613
            +   S S D  +++WD+ K+  +  ++
Sbjct: 269 QDLIVSVSDDKTIRVWDLNKRTPVKQFR 296



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 30/125 (24%), Positives = 50/125 (40%), Gaps = 2/125 (1%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIG--KPTSTSTLSGHTSPVESIAFDSAEI 409
           H   VN   F   T  + ++ GDD  V LW +   K     T  GHT  V    F   + 
Sbjct: 212 HDKGVNWAAF-HPTLPLIVSAGDDRLVKLWRMSDTKAWEVDTCRGHTGNVLCATFHPNQD 270

Query: 410 LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRK 589
           L+ + S    I++WDL     ++           +  HP    FA+   D+ + ++ + +
Sbjct: 271 LIVSVSDDKTIRVWDLNKRTPVKQFRREHDRFWLVASHPKINLFAT-CHDSGVMVFKLER 329

Query: 590 KGCIH 604
           +   H
Sbjct: 330 ERPAH 334



>gb:AY064077_1293671 Aedes aegypti clone unKRc2 unknown protein
           (GI8) mRNA, complete cds.
          Length = 335

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 37/126 (29%), Positives = 69/126 (54%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +G  D  +N++ +       TL GH   V S+ F     ++   S  G +KL+D+  + +
Sbjct: 192 SGAIDGIINIFDVAAGKVAQTLEGHAMSVRSLCFSPDSQMLLTASDDGHMKLYDVAHSDV 251

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           + TLSGH S+  ++ F   G+ F S S D  +KIW++ ++ C+HT++ H   +  ++++P
Sbjct: 252 VGTLSGHSSWVLSVSFSGDGKSFTSSSSDKTVKIWNVAERQCLHTFEDHQDQVWGVKYSP 311

Query: 653 DGRWVV 670
           D   V+
Sbjct: 312 DSSKVI 317



 Score = 58.9 bits (141), Expect = 8e-08
 Identities = 32/129 (24%), Positives = 67/129 (51%), Gaps = 2/129 (1%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSI--GKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           +  ++G  +  ++L+S+  GKP      +     + SIA+      +A+G+  G+I ++D
Sbjct: 145 KYIISGSHEGKISLYSVESGKPEQVLDPANGKFTL-SIAYSPDGKYIASGAIDGIINIFD 203

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
           +   K+ +TL GH     +L F P  +   + S D ++K++D+     + T  GH+  + 
Sbjct: 204 VAAGKVAQTLEGHAMSVRSLCFSPDSQMLLTASDDGHMKLYDVAHSDVVGTLSGHSSWVL 263

Query: 635 TIRFTPDGR 661
           ++ F+ DG+
Sbjct: 264 SVSFSGDGK 272



 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 32/124 (25%), Positives = 57/124 (45%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G   Q    H+ +V  L F   + +M LT  DD  + L+ +       TLSGH+S V S+
Sbjct: 207 GKVAQTLEGHAMSVRSLCFSPDS-QMLLTASDDGHMKLYDVAHSDVVGTLSGHSSWVLSV 265

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           +F        + SS   +K+W++ + + + T   H+     +++ P      S S D  +
Sbjct: 266 SFSGDGKSFTSSSSDKTVKIWNVAERQCLHTFEDHQDQVWGVKYSPDSSKVISVSEDRCV 325

Query: 569 KIWD 580
            ++D
Sbjct: 326 NLYD 329



 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 27/123 (21%), Positives = 60/123 (48%), Gaps = 1/123 (0%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D  + +W        + +S     + ++AF   +  + +GS  G I L+ +E  K  + L
Sbjct: 111 DSGLCIWKADSGQLLNQISLGPVDLWTVAFSPCDKYIISGSHEGKISLYSVESGKPEQVL 170

Query: 485 S-GHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
              +  +  ++ + P G++ ASG++D  + I+D+       T +GH   + ++ F+PD +
Sbjct: 171 DPANGKFTLSIAYSPDGKYIASGAIDGIINIFDVAAGKVAQTLEGHAMSVRSLCFSPDSQ 230

Query: 662 WVV 670
            ++
Sbjct: 231 MLL 233



 Score = 37.4 bits (85), Expect = 0.24
 Identities = 21/89 (23%), Positives = 40/89 (44%), Gaps = 3/89 (3%)
 Frame = +2

Query: 413 VAAGSSSGLIKLWDL---EDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
           V  G     +K+WD+      K+  T +GH     +++    GE  AS S+D+ L IW  
Sbjct: 60  VVTGGLDDRVKVWDVTKENKLKLRNTFTGHSLGVVSVDVSSDGEVIASSSLDSGLCIWKA 119

Query: 584 RKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
                ++        + T+ F+P  ++++
Sbjct: 120 DSGQLLNQISLGPVDLWTVAFSPCDKYII 148



>gb:AY064076_1293670 Aedes aegypti clone unKMc3 unknown protein
           (GI8) mRNA, complete cds.
          Length = 335

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 37/126 (29%), Positives = 69/126 (54%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +G  D  +N++ +       TL GH   V S+ F     ++   S  G +KL+D+  + +
Sbjct: 192 SGAIDGIINIFDVAAGKVAQTLEGHAMSVRSLCFSPDSQMLLTASDDGHMKLYDVAHSDV 251

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           + TLSGH S+  ++ F   G+ F S S D  +KIW++ ++ C+HT++ H   +  ++++P
Sbjct: 252 VGTLSGHSSWVLSVSFSGDGKSFTSSSSDKTVKIWNVAERQCLHTFEDHQDQVWGVKYSP 311

Query: 653 DGRWVV 670
           D   V+
Sbjct: 312 DSSKVI 317



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 32/129 (24%), Positives = 66/129 (51%), Gaps = 2/129 (1%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSI--GKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           +  ++G  +  ++L+S+  GKP            + SIA+      +A+G+  G+I ++D
Sbjct: 145 KYIISGSHEGKISLYSVESGKPEQVLDPQNGKFTL-SIAYSPDGKYIASGAIDGIINIFD 203

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
           +   K+ +TL GH     +L F P  +   + S D ++K++D+     + T  GH+  + 
Sbjct: 204 VAAGKVAQTLEGHAMSVRSLCFSPDSQMLLTASDDGHMKLYDVAHSDVVGTLSGHSSWVL 263

Query: 635 TIRFTPDGR 661
           ++ F+ DG+
Sbjct: 264 SVSFSGDGK 272



 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 32/124 (25%), Positives = 57/124 (45%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G   Q    H+ +V  L F   + +M LT  DD  + L+ +       TLSGH+S V S+
Sbjct: 207 GKVAQTLEGHAMSVRSLCFSPDS-QMLLTASDDGHMKLYDVAHSDVVGTLSGHSSWVLSV 265

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           +F        + SS   +K+W++ + + + T   H+     +++ P      S S D  +
Sbjct: 266 SFSGDGKSFTSSSSDKTVKIWNVAERQCLHTFEDHQDQVWGVKYSPDSSKVISVSEDRCV 325

Query: 569 KIWD 580
            ++D
Sbjct: 326 NLYD 329



 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 28/123 (22%), Positives = 59/123 (47%), Gaps = 1/123 (0%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D  + +W        + +S     + ++AF   +  + +GS  G I L+ +E  K  + L
Sbjct: 111 DSGLCIWKADSGQLLNQISLGPVDLWTVAFSPCDKYIISGSHEGKISLYSVESGKPEQVL 170

Query: 485 SGHRSYCT-ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
                  T ++ + P G++ ASG++D  + I+D+       T +GH   + ++ F+PD +
Sbjct: 171 DPQNGKFTLSIAYSPDGKYIASGAIDGIINIFDVAAGKVAQTLEGHAMSVRSLCFSPDSQ 230

Query: 662 WVV 670
            ++
Sbjct: 231 MLL 233



 Score = 34.3 bits (77), Expect = 2.0
 Identities = 20/89 (22%), Positives = 39/89 (43%), Gaps = 3/89 (3%)
 Frame = +2

Query: 413 VAAGSSSGLIKLWDL---EDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
           V  G     +K+WD+      K+  T +G      +++    GE  AS S+D+ L IW  
Sbjct: 60  VVTGGLDDRVKVWDVTKENKLKLRNTFTGRSLGVVSVDVSSDGEVIASSSLDSGLCIWKA 119

Query: 584 RKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
                ++        + T+ F+P  ++++
Sbjct: 120 DSGQLLNQISLGPVDLWTVAFSPCDKYII 148



>gb:AF326340_1262805 Aedes aegypti unknown protein i8 mRNA, complete
           cds.
          Length = 335

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 37/126 (29%), Positives = 69/126 (54%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +G  D  +N++ +       TL GH   V S+ F     ++   S  G +KL+D+  + +
Sbjct: 192 SGAIDGIINIFDVAAGKVAQTLEGHAMSVRSLCFSPDSQMLLTASDDGHMKLYDVAHSDV 251

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           + TLSGH S+  ++ F   G+ F S S D  +KIW++ ++ C+HT++ H   +  ++++P
Sbjct: 252 VGTLSGHSSWVLSVSFSGDGKSFTSSSSDKTVKIWNVAERQCLHTFEDHQDQVWGVKYSP 311

Query: 653 DGRWVV 670
           D   V+
Sbjct: 312 DSSKVI 317



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 32/129 (24%), Positives = 66/129 (51%), Gaps = 2/129 (1%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSI--GKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           +  ++G  +  ++L+S+  GKP            + SIA+      +A+G+  G+I ++D
Sbjct: 145 KYIISGSHEGKISLYSVESGKPEQVLDPQNGKFTL-SIAYSPDGKYIASGAIDGIINIFD 203

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
           +   K+ +TL GH     +L F P  +   + S D ++K++D+     + T  GH+  + 
Sbjct: 204 VAAGKVAQTLEGHAMSVRSLCFSPDSQMLLTASDDGHMKLYDVAHSDVVGTLSGHSSWVL 263

Query: 635 TIRFTPDGR 661
           ++ F+ DG+
Sbjct: 264 SVSFSGDGK 272



 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 32/124 (25%), Positives = 57/124 (45%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G   Q    H+ +V  L F   + +M LT  DD  + L+ +       TLSGH+S V S+
Sbjct: 207 GKVAQTLEGHAMSVRSLCFSPDS-QMLLTASDDGHMKLYDVAHSDVVGTLSGHSSWVLSV 265

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           +F        + SS   +K+W++ + + + T   H+     +++ P      S S D  +
Sbjct: 266 SFSGDGKSFTSSSSDKTVKIWNVAERQCLHTFEDHQDQVWGVKYSPDSSKVISVSEDRCV 325

Query: 569 KIWD 580
            ++D
Sbjct: 326 NLYD 329



 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 28/123 (22%), Positives = 59/123 (47%), Gaps = 1/123 (0%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D  + +W        + +S     + ++AF   +  + +GS  G I L+ +E  K  + L
Sbjct: 111 DSGLCIWKADSGQLLNQISLGPVDLWTVAFSPCDKYIISGSHEGKISLYSVESGKPEQVL 170

Query: 485 SGHRSYCT-ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
                  T ++ + P G++ ASG++D  + I+D+       T +GH   + ++ F+PD +
Sbjct: 171 DPQNGKFTLSIAYSPDGKYIASGAIDGIINIFDVAAGKVAQTLEGHAMSVRSLCFSPDSQ 230

Query: 662 WVV 670
            ++
Sbjct: 231 MLL 233



 Score = 32.3 bits (72), Expect = 7.7
 Identities = 20/89 (22%), Positives = 39/89 (43%), Gaps = 3/89 (3%)
 Frame = +2

Query: 413 VAAGSSSGLIKLWDL---EDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
           V  G     +K+ D+      K+  T +GH     +++    GE  AS S+D+ L IW  
Sbjct: 60  VVTGGLDDRVKVLDVTKENKLKLRNTFTGHSLGVVSVDVSSDGEVIASSSLDSGLCIWKA 119

Query: 584 RKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
                ++        + T+ F+P  ++++
Sbjct: 120 DSGQLLNQISLGPVDLWTVAFSPCDKYII 148



>gb:AF326339_1262804 Aedes aegypti unknown protein i8 mRNA, complete
           cds.
          Length = 335

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 37/126 (29%), Positives = 69/126 (54%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +G  D  +N++ +       TL GH   V S+ F     ++   S  G +KL+D+  + +
Sbjct: 192 SGAIDGIINIFDVAAGKVAQTLEGHAMSVRSLCFSPDSQMLLTASDDGHMKLYDVAHSDV 251

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           + TLSGH S+  ++ F   G+ F S S D  +KIW++ ++ C+HT++ H   +  ++++P
Sbjct: 252 VGTLSGHSSWVLSVSFSGDGKSFTSSSSDKTVKIWNVAERQCLHTFEDHQDQVWGVKYSP 311

Query: 653 DGRWVV 670
           D   V+
Sbjct: 312 DSSKVI 317



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 32/129 (24%), Positives = 66/129 (51%), Gaps = 2/129 (1%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSI--GKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           +  ++G  +  ++L+S+  GKP            + SIA+      +A+G+  G+I ++D
Sbjct: 145 KYIISGSHEGKISLYSVESGKPEQVLDPQNGKFTL-SIAYSPDGKYIASGAIDGIINIFD 203

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
           +   K+ +TL GH     +L F P  +   + S D ++K++D+     + T  GH+  + 
Sbjct: 204 VAAGKVAQTLEGHAMSVRSLCFSPDSQMLLTASDDGHMKLYDVAHSDVVGTLSGHSSWVL 263

Query: 635 TIRFTPDGR 661
           ++ F+ DG+
Sbjct: 264 SVSFSGDGK 272



 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 32/124 (25%), Positives = 57/124 (45%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G   Q    H+ +V  L F   + +M LT  DD  + L+ +       TLSGH+S V S+
Sbjct: 207 GKVAQTLEGHAMSVRSLCFSPDS-QMLLTASDDGHMKLYDVAHSDVVGTLSGHSSWVLSV 265

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           +F        + SS   +K+W++ + + + T   H+     +++ P      S S D  +
Sbjct: 266 SFSGDGKSFTSSSSDKTVKIWNVAERQCLHTFEDHQDQVWGVKYSPDSSKVISVSEDRCV 325

Query: 569 KIWD 580
            ++D
Sbjct: 326 NLYD 329



 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 28/123 (22%), Positives = 59/123 (47%), Gaps = 1/123 (0%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D  + +W        + +S     + ++AF   +  + +GS  G I L+ +E  K  + L
Sbjct: 111 DSGLCIWKADSGQLLNQISLGPVDLWTVAFSPCDKYIISGSHEGKISLYSVESGKPEQVL 170

Query: 485 SGHRSYCT-ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
                  T ++ + P G++ ASG++D  + I+D+       T +GH   + ++ F+PD +
Sbjct: 171 DPQNGKFTLSIAYSPDGKYIASGAIDGIINIFDVAAGKVAQTLEGHAMSVRSLCFSPDSQ 230

Query: 662 WVV 670
            ++
Sbjct: 231 MLL 233



 Score = 37.4 bits (85), Expect = 0.24
 Identities = 21/89 (23%), Positives = 40/89 (44%), Gaps = 3/89 (3%)
 Frame = +2

Query: 413 VAAGSSSGLIKLWDL---EDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
           V  G     +K+WD+      K+  T +GH     +++    GE  AS S+D+ L IW  
Sbjct: 60  VVTGGLDDRVKVWDVTKENKLKLRNTFTGHSLGVVSVDVSSDGEVIASSSLDSGLCIWKA 119

Query: 584 RKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
                ++        + T+ F+P  ++++
Sbjct: 120 DSGQLLNQISLGPVDLWTVAFSPCDKYII 148



>gb:AF079369_1239501 Dictyostelium discoideum transcriptional
           repressor TUP1 mRNA, complete cds.
          Length = 579

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 44/138 (31%), Positives = 69/138 (50%), Gaps = 8/138 (5%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLS----GHTSPVESIAFDSAEILVAAGSSSGLIKL 448
           R  ++G  D    +W I K     TL     G  + V S+A      LVAAGS   +++L
Sbjct: 382 RFIVSGSGDKKAKIWDIEKGKCAFTLGNEEVGPKNGVTSVAMSPDGRLVAAGSLDNIVRL 441

Query: 449 WDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI----RKKGCIHTYKG 616
           WD +    +    GH     ++ F P G+  ASGS+D +LK+WD+     +  C  T+ G
Sbjct: 442 WDAQTGYFLERYEGHLDSVYSVAFSPDGKSLASGSLDKSLKLWDLSGSRSRSRCRATFNG 501

Query: 617 HTRGISTIRFTPDGRWVV 670
           H   + ++ F+PDG W++
Sbjct: 502 HKDFVLSVAFSPDGSWLI 519



 Score = 64.7 bits (156), Expect = 1e-09
 Identities = 36/128 (28%), Positives = 58/128 (45%), Gaps = 4/128 (3%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
           R+   G  D+ V LW            GH   V S+AF      +A+GS    +KLWDL 
Sbjct: 428 RLVAAGSLDNIVRLWDAQTGYFLERYEGHLDSVYSVAFSPDGKSLASGSLDKSLKLWDLS 487

Query: 461 DTKMIR----TLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRG 628
            ++       T +GH+ +  ++ F P G +  SGS D +++ WD R        +GH   
Sbjct: 488 GSRSRSRCRATFNGHKDFVLSVAFSPDGSWLISGSKDRSVQFWDPRNGTTHMMLQGHKNS 547

Query: 629 ISTIRFTP 652
           + ++  +P
Sbjct: 548 VISVALSP 555



 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 40/153 (26%), Positives = 64/153 (41%), Gaps = 9/153 (5%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP-----VESIAFDS 400
           H+  V C+ F       +L  G + S  ++ +            +       + S+ F  
Sbjct: 280 HNSVVCCVNFSNDG--KYLATGCNRSAQIYDVDTGKKVHAFVDESEKDGDLYIRSVCFSP 337

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
               +A G+    +K+WD+   K+  T  GH     +L++   G F  SGS D   KIWD
Sbjct: 338 DGNYLATGAEDKTVKVWDIHTKKIQHTFYGHELDIYSLDYSSDGRFIVSGSGDKKAKIWD 397

Query: 581 IRKKGCIHTY----KGHTRGISTIRFTPDGRWV 667
           I K  C  T      G   G++++  +PDGR V
Sbjct: 398 IEKGKCAFTLGNEEVGPKNGVTSVAMSPDGRLV 430



 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 29/107 (27%), Positives = 53/107 (49%), Gaps = 5/107 (4%)
 Frame = +2

Query: 365 HTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRS-----YCTALEFHPF 529
           H S V  + F +    +A G +    +++D++  K +             Y  ++ F P 
Sbjct: 280 HNSVVCCVNFSNDGKYLATGCNRSA-QIYDVDTGKKVHAFVDESEKDGDLYIRSVCFSPD 338

Query: 530 GEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           G + A+G+ D  +K+WDI  K   HT+ GH   I ++ ++ DGR++V
Sbjct: 339 GNYLATGAEDKTVKVWDIHTKKIQHTFYGHELDIYSLDYSSDGRFIV 385



>gb:BC056820_2552003 Danio rerio TAF5-like RNA polymerase II,
           p300/CBP-associated factor (PCAF)-associated factor,
           mRNA (cDNA clone MGC:63765 IMAGE:2641473), complete cds.
          Length = 601

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 49/158 (31%), Positives = 73/158 (46%), Gaps = 11/158 (6%)
 Frame = +2

Query: 206 RGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVES 385
           R Y L+ +  H  +V+C++F   +     TG  D +V LWS  +  S    +GH  PV +
Sbjct: 427 RTYPLRLYAGHLSDVDCVKFHPNS-NYIATGSTDKTVRLWSTRQGASVRLFTGHRGPVLT 485

Query: 386 IAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTN 565
           +AF      +A+      +KLWDL    + + L GH    ++L F       AS SMD  
Sbjct: 486 LAFSPNGKYLASAGEDQRLKLWDLASGGLFKDLRGHTDTISSLSFSQDSSLVASASMDNT 545

Query: 566 LKIWDIRK-------KGC----IHTYKGHTRGISTIRF 646
           +++WDIR         GC    I  Y G T  I  ++F
Sbjct: 546 VRVWDIRNAHGSAPTDGCSSELIGQYTGSTSNILNVQF 583



 Score = 83.2 bits (204), Expect = 4e-15
 Identities = 40/127 (31%), Positives = 59/127 (46%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F T   D +  LWS  +       +GH S V+ + F      +A GS+   ++LW     
Sbjct: 411 FSTASHDRTARLWSFARTYPLRLYAGHLSDVDCVKFHPNSNYIATGSTDKTVRLWSTRQG 470

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
             +R  +GHR     L F P G++ AS   D  LK+WD+   G     +GHT  IS++ F
Sbjct: 471 ASVRLFTGHRGPVLTLAFSPNGKYLASAGEDQRLKLWDLASGGLFKDLRGHTDTISSLSF 530

Query: 647 TPDGRWV 667
           + D   V
Sbjct: 531 SQDSSLV 537



 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 39/153 (25%), Positives = 71/153 (46%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +++    HSG V    F      + L+  +D +V  W +   T+T    GH  PV  +
Sbjct: 344 GSEIKTLRGHSGPVYRTAFLTDASGL-LSCSEDSTVRYWDLKSFTNTVLYRGHAYPVWDV 402

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
                 +  +  S     +LW    T  +R  +GH S    ++FHP   + A+GS D  +
Sbjct: 403 DVSPCSLYFSTASHDRTARLWSFARTYPLRLYAGHLSDVDCVKFHPNSNYIATGSTDKTV 462

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           ++W  R+   +  + GH   + T+ F+P+G+++
Sbjct: 463 RLWSTRQGASVRLFTGHRGPVLTLAFSPNGKYL 495



>gb:MUSLISB_2128749 Mus musculus LIS mRNA, partial cds.
          Length = 277

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 38/125 (30%), Positives = 67/125 (53%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  +D ++ +W         TL GHT  V+ I+FD +  L+A+ S+   IKLWD + 
Sbjct: 8   VMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG 67

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
            + IRT+ GH    +++   P G+   S S D  +K+W+++   C+ T+ GH   +  +R
Sbjct: 68  FECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVR 127

Query: 644 FTPDG 658
              DG
Sbjct: 128 PNQDG 132



 Score = 62.0 bits (149), Expect = 9e-09
 Identities = 29/87 (33%), Positives = 43/87 (49%)
 Frame = +2

Query: 410 LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRK 589
           ++ + S    IK+WD E     RTL GH      + F   G+  AS S D  +K+WD + 
Sbjct: 8   VMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG 67

Query: 590 KGCIHTYKGHTRGISTIRFTPDGRWVV 670
             CI T  GH   +S++   P+G  +V
Sbjct: 68  FECIRTMHGHDHNVSSVAIMPNGDHIV 94



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 37/164 (22%), Positives = 68/164 (41%), Gaps = 20/164 (12%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           GY ++ F  H   V  +R   +   +  +  +D +V +W +      + L  H   VE I
Sbjct: 110 GYCVKTFTGHREWVRMVR-PNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECI 168

Query: 389 AFDSAEI--------------------LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           ++                          + +GS    IK+WD+     + TL GH ++  
Sbjct: 169 SWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVR 228

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
            + FH  G+F  S + D  L++WD + K C+ T   H   ++++
Sbjct: 229 GVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSL 272



 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 28/120 (23%), Positives = 53/120 (44%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D ++ LW         T+ GH   V S+A       + + S    IK+W+++    ++T 
Sbjct: 57  DMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTF 116

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
           +GHR +   +  +  G   AS S D  +++W +  K C    + H   +  I + P+  +
Sbjct: 117 TGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSY 176



 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 28/142 (19%), Positives = 55/142 (38%), Gaps = 20/142 (14%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D ++ +W +       T +GH   V  +  +    L+A+ S+   +++W +   +    L
Sbjct: 99  DKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAEL 158

Query: 485 SGHRSYCTALEFHPF--------------------GEFFASGSMDTNLKIWDIRKKGCIH 604
             H      + + P                     G F  SGS D  +K+WD+    C+ 
Sbjct: 159 REHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLM 218

Query: 605 TYKGHTRGISTIRFTPDGRWVV 670
           T  GH   +  + F   G++++
Sbjct: 219 TLVGHDNWVRGVLFHSGGKFIL 240



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 17/48 (35%), Positives = 21/48 (43%)
 Frame = +2

Query: 518 FHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
           FHP      S S D  +K+WD        T KGHT  +  I F   G+
Sbjct: 2   FHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGK 49



>gb:MMPAFALIS4_2116876 Mus musculus Pafaha/Lis1 exon 4, Pafaha/Lis1
           exon 5, Pafaha/Lis1 exon 6, Pafaha/Lis1 exon 7,
           Pafaha/Lis1 exon 8, Pafaha/Lis1 exon 9, Pafaha/Lis1 exon
           10, Pafaha/Lis1 exon 11, Pafaha/Lis1 exon 11, and
           Pafaha/Lis1 exon 12, complete sequence; and
           platelet-activating factor acetylhydrolase 45kD subunit
           (Pafaha/Lis1) gene, alternative splice products,
           complete cds.
          Length = 391

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 38/125 (30%), Positives = 67/125 (53%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  +D ++ +W         TL GHT  V+ I+FD +  L+A+ S+   IKLWD + 
Sbjct: 122 VMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG 181

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
            + IRT+ GH    +++   P G+   S S D  +K+W+++   C+ T+ GH   +  +R
Sbjct: 182 FECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVR 241

Query: 644 FTPDG 658
              DG
Sbjct: 242 PNQDG 246



 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 39/114 (34%), Positives = 55/114 (48%)
 Frame = +2

Query: 329 IGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           I +P     LSGH SPV  + F     ++ + S    IK+WD E     RTL GH     
Sbjct: 95  IPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQ 154

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + F   G+  AS S D  +K+WD +   CI T  GH   +S++   P+G  +V
Sbjct: 155 DISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIV 208



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 37/164 (22%), Positives = 68/164 (41%), Gaps = 20/164 (12%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           GY ++ F  H   V  +R   +   +  +  +D +V +W +      + L  H   VE I
Sbjct: 224 GYCVKTFTGHREWVRMVR-PNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECI 282

Query: 389 AFDSAEI--------------------LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           ++                          + +GS    IK+WD+     + TL GH ++  
Sbjct: 283 SWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVR 342

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
            + FH  G+F  S + D  L++WD + K C+ T   H   ++++
Sbjct: 343 GVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSL 386



 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 28/120 (23%), Positives = 53/120 (44%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D ++ LW         T+ GH   V S+A       + + S    IK+W+++    ++T 
Sbjct: 171 DMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTF 230

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
           +GHR +   +  +  G   AS S D  +++W +  K C    + H   +  I + P+  +
Sbjct: 231 TGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSY 290



 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 28/142 (19%), Positives = 55/142 (38%), Gaps = 20/142 (14%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D ++ +W +       T +GH   V  +  +    L+A+ S+   +++W +   +    L
Sbjct: 213 DKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAEL 272

Query: 485 SGHRSYCTALEFHPF--------------------GEFFASGSMDTNLKIWDIRKKGCIH 604
             H      + + P                     G F  SGS D  +K+WD+    C+ 
Sbjct: 273 REHEHVVECISWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLM 332

Query: 605 TYKGHTRGISTIRFTPDGRWVV 670
           T  GH   +  + F   G++++
Sbjct: 333 TLVGHDNWVRGVLFHSGGKFIL 354



>gb:BC043494_1983422 Homo sapiens WD repeat domain 5B, mRNA (cDNA
           clone MGC:49879 IMAGE:6056052), complete
           cds.>gb:CR457279_1993486 Homo sapiens full open reading
           frame cDNA clone RZPDo834A0813D for gene WDR5B, WD
           repeat domain 5B; complete cds, incl. stopcodon.
          Length = 330

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 44/160 (27%), Positives = 78/160 (48%), Gaps = 4/160 (2%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           + G  L+    HS  V C  F   +  + ++G  D +V +W +       TLS H+ PV 
Sbjct: 113 RSGKCLKTLKGHSNYVFCCNFNPPS-NLIISGSFDETVKIWEVKTGKCLKTLSAHSDPVS 171

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL-SGHRSYCTALEFHPFGEFFASGSMD 559
           ++ F+ +  L+ +GS  GL ++WD    + ++TL        + ++F P G++  + ++D
Sbjct: 172 AVHFNCSGSLIVSGSYDGLCRIWDAASGQCLKTLVDDDNPPVSFVKFSPNGKYILTATLD 231

Query: 560 TNLKIWDIRKKGCIHTYKGHTRG---ISTIRFTPDGRWVV 670
             LK+WD  +  C+ TY GH      I        G+W+V
Sbjct: 232 NTLKLWDYSRGRCLKTYTGHKNEKYCIFANFSVTGGKWIV 271



 Score = 79.3 bits (194), Expect = 5e-14
 Identities = 39/147 (26%), Positives = 66/147 (44%)
 Frame = +2

Query: 230 VAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEI 409
           V H+  V+ ++F         +   D  + +W         TL GH   +  +A+ S   
Sbjct: 38  VGHTEAVSSVKFSPNG-EWLASSSADRLIIIWGAYDGKYEKTLYGHNLEISDVAWSSDSS 96

Query: 410 LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRK 589
            + + S    +KLWD+   K ++TL GH +Y     F+P      SGS D  +KIW+++ 
Sbjct: 97  RLVSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPSNLIISGSFDETVKIWEVKT 156

Query: 590 KGCIHTYKGHTRGISTIRFTPDGRWVV 670
             C+ T   H+  +S + F   G  +V
Sbjct: 157 GKCLKTLSAHSDPVSAVHFNCSGSLIV 183



 Score = 75.5 bits (184), Expect = 8e-13
 Identities = 38/146 (26%), Positives = 76/146 (52%), Gaps = 1/146 (0%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H+  ++ + +   + R+ ++  DD ++ LW +       TL GH++ V    F+    L+
Sbjct: 82  HNLEISDVAWSSDSSRL-VSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPSNLI 140

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
            +GS    +K+W+++  K ++TLS H    +A+ F+  G    SGS D   +IWD     
Sbjct: 141 ISGSFDETVKIWEVKTGKCLKTLSAHSDPVSAVHFNCSGSLIVSGSYDGLCRIWDAASGQ 200

Query: 596 CIHT-YKGHTRGISTIRFTPDGRWVV 670
           C+ T        +S ++F+P+G++++
Sbjct: 201 CLKTLVDDDNPPVSFVKFSPNGKYIL 226



 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 34/106 (32%), Positives = 50/106 (47%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           TL GHT  V S+ F      +A+ S+  LI +W   D K  +TL GH    + + +    
Sbjct: 36  TLVGHTEAVSSVKFSPNGEWLASSSADRLIIIWGAYDGKYEKTLYGHNLEISDVAWSSDS 95

Query: 533 EFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
               S S D  LK+WD+R   C+ T KGH+  +    F P    ++
Sbjct: 96  SRLVSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPSNLII 141



 Score = 45.4 bits (106), Expect = 9e-04
 Identities = 25/105 (23%), Positives = 49/105 (46%), Gaps = 6/105 (5%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEIL----VAAGSSSGLIKL 448
           +  LT   D+++ LW   +     T +GH +    I F +  +     + +GS   L+ +
Sbjct: 223 KYILTATLDNTLKLWDYSRGRCLKTYTGHKNEKYCI-FANFSVTGGKWIVSGSEDNLVYI 281

Query: 449 WDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM--DTNLKIW 577
           W+L+  ++++ L GH     +   HP     AS ++  D  +K+W
Sbjct: 282 WNLQTKEIVQKLQGHTDVVISAACHPTENLIASAALENDKTIKLW 326



>gb:AY665285_1958590 Pan troglodytes platelet-activating factor
           acetylhydrolase isoform 1B alpha subunit mRNA, complete
           cds.
          Length = 410

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 38/125 (30%), Positives = 67/125 (53%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  +D ++ +W         TL GHT  V+ I+FD +  L+A+ S+   IKLWD + 
Sbjct: 122 VMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG 181

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
            + IRT+ GH    +++   P G+   S S D  +K+W+++   C+ T+ GH   +  +R
Sbjct: 182 FECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVR 241

Query: 644 FTPDG 658
              DG
Sbjct: 242 PNQDG 246



 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 39/114 (34%), Positives = 55/114 (48%)
 Frame = +2

Query: 329 IGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           I +P     LSGH SPV  + F     ++ + S    IK+WD E     RTL GH     
Sbjct: 95  IPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQ 154

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + F   G+  AS S D  +K+WD +   CI T  GH   +S++   P+G  +V
Sbjct: 155 DISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIV 208



 Score = 65.5 bits (158), Expect = 8e-10
 Identities = 25/99 (25%), Positives = 53/99 (53%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           L+G  D ++ +W +       TL GH + V  + F S    + + +    +++WD ++ +
Sbjct: 312 LSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKR 371

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            ++TL+ H  + T+L+FH    +  +G +D  +K+W+ R
Sbjct: 372 CMKTLNAHEHFVTSLDFHKTAPYVVTGFVDQTVKVWECR 410



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 40/174 (22%), Positives = 72/174 (41%), Gaps = 20/174 (11%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           GY ++ F  H   V  +R   +   +  +  +D +V +W +      + L  H   VE I
Sbjct: 224 GYCVKTFTGHREWVRMVR-PNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECI 282

Query: 389 AFDSAEI--------------------LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           ++                          + +GS    IK+WD+     + TL GH ++  
Sbjct: 283 SWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVR 342

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + FH  G+F  S + D  L++WD + K C+ T   H   ++++ F     +VV
Sbjct: 343 GVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVV 396



 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 28/120 (23%), Positives = 53/120 (44%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D ++ LW         T+ GH   V S+A       + + S    IK+W+++    ++T 
Sbjct: 171 DMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTF 230

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
           +GHR +   +  +  G   AS S D  +++W +  K C    + H   +  I + P+  +
Sbjct: 231 TGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSY 290



>gb:AF400434_1901097 Homo sapiens platelet-activating factor acetyl
           hydrolase isoform Ib alpha subunit (PHFAH1B1) mRNA,
           complete cds.>gb:BC064638_1986604 Homo sapiens
           platelet-activating factor acetylhydrolase, isoform Ib,
           alpha subunit 45kDa, mRNA (cDNA clone MGC:70757
           IMAGE:5786560), complete cds.>gb:HSLIS10_2017041 Human
           platelet activating factor acetylhydrolase, brain
           isoform, 45 kDa subunit (LIS1) gene, exon 11 and
           complete cds.>gb:HUMLIS1A_2034075 Homo sapiens(clone 71)
           Miller-Dieker lissencephaly protein (LIS1) mRNA,
           complete cds.>gb:HUMLIS1B_2034076 Homo sapiens (clone
           47) Miller-Dieker lissencephaly protein (LIS1) mRNA,
           complete cds.
          Length = 410

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 38/125 (30%), Positives = 67/125 (53%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  +D ++ +W         TL GHT  V+ I+FD +  L+A+ S+   IKLWD + 
Sbjct: 122 VMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG 181

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
            + IRT+ GH    +++   P G+   S S D  +K+W+++   C+ T+ GH   +  +R
Sbjct: 182 FECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVR 241

Query: 644 FTPDG 658
              DG
Sbjct: 242 PNQDG 246



 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 39/114 (34%), Positives = 55/114 (48%)
 Frame = +2

Query: 329 IGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           I +P     LSGH SPV  + F     ++ + S    IK+WD E     RTL GH     
Sbjct: 95  IPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQ 154

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + F   G+  AS S D  +K+WD +   CI T  GH   +S++   P+G  +V
Sbjct: 155 DISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIV 208



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 26/99 (26%), Positives = 54/99 (54%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           L+G  D ++ +W +       TL GH + V  + F S    + + +    +++WD ++ +
Sbjct: 312 LSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKR 371

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            ++TL+ H  + T+L+FH    +  +GS+D  +K+W+ R
Sbjct: 372 CMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR 410



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 40/174 (22%), Positives = 72/174 (41%), Gaps = 20/174 (11%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           GY ++ F  H   V  +R   +   +  +  +D +V +W +      + L  H   VE I
Sbjct: 224 GYCVKTFTGHREWVRMVR-PNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECI 282

Query: 389 AFDSAEI--------------------LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           ++                          + +GS    IK+WD+     + TL GH ++  
Sbjct: 283 SWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVR 342

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + FH  G+F  S + D  L++WD + K C+ T   H   ++++ F     +VV
Sbjct: 343 GVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVV 396



 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 28/120 (23%), Positives = 53/120 (44%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D ++ LW         T+ GH   V S+A       + + S    IK+W+++    ++T 
Sbjct: 171 DMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTF 230

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
           +GHR +   +  +  G   AS S D  +++W +  K C    + H   +  I + P+  +
Sbjct: 231 TGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSY 290



 Score = 32.7 bits (73), Expect = 5.9
 Identities = 21/82 (25%), Positives = 32/82 (39%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L   V H   V  + F     +  L+  DD ++ +W         TL+ H   V S+
Sbjct: 328 GMCLMTLVGHDNWVRGVLFHSGG-KFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSL 386

Query: 389 AFDSAEILVAAGSSSGLIKLWD 454
            F      V  GS    +K+W+
Sbjct: 387 DFHKTAPYVVTGSVDQTVKVWE 408



>gb:AF208837_1890045 Homo sapiens isolate 3 Miller-Dieker
           lissencephaly protein (MDCR) mRNA, complete cds.
          Length = 410

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 38/125 (30%), Positives = 67/125 (53%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  +D ++ +W         TL GHT  V+ I+FD +  L+A+ S+   IKLWD + 
Sbjct: 122 VMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG 181

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
            + IRT+ GH    +++   P G+   S S D  +K+W+++   C+ T+ GH   +  +R
Sbjct: 182 FECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVR 241

Query: 644 FTPDG 658
              DG
Sbjct: 242 PNQDG 246



 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 39/114 (34%), Positives = 55/114 (48%)
 Frame = +2

Query: 329 IGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           I +P     LSGH SPV  + F     ++ + S    IK+WD E     RTL GH     
Sbjct: 95  IPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQ 154

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + F   G+  AS S D  +K+WD +   CI T  GH   +S++   P+G  +V
Sbjct: 155 DISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIV 208



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 26/99 (26%), Positives = 54/99 (54%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           L+G  D ++ +W +       TL GH + V  + F S    + + +    +++WD ++ +
Sbjct: 312 LSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKR 371

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            ++TL+ H  + T+L+FH    +  +GS+D  +K+W+ R
Sbjct: 372 CMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR 410



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 40/174 (22%), Positives = 72/174 (41%), Gaps = 20/174 (11%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           GY ++ F  H   V  +R   +   +  +  +D +V +W +      + L  H   VE I
Sbjct: 224 GYCVKTFTGHREWVRMVR-PNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECI 282

Query: 389 AFDSAEI--------------------LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           ++                          + +GS    IK+WD+     + TL GH ++  
Sbjct: 283 SWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVR 342

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + FH  G+F  S + D  L++WD + K C+ T   H   ++++ F     +VV
Sbjct: 343 GVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVV 396



 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 28/120 (23%), Positives = 53/120 (44%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D ++ LW         T+ GH   V S+A       + + S    IK+W+++    ++T 
Sbjct: 171 DMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTF 230

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
           +GHR +   +  +  G   AS S D  +++W +  K C    + H   +  I + P+  +
Sbjct: 231 TGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSY 290



 Score = 32.7 bits (73), Expect = 5.9
 Identities = 21/82 (25%), Positives = 32/82 (39%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L   V H   V  + F     +  L+  DD ++ +W         TL+ H   V S+
Sbjct: 328 GMCLMTLVGHDNWVRGVLFHSGG-KFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSL 386

Query: 389 AFDSAEILVAAGSSSGLIKLWD 454
            F      V  GS    +K+W+
Sbjct: 387 DFHKTAPYVVTGSVDQTVKVWE 408



>gb:AC092779_1735711 Oryza sativa chromosome 3 BAC OSJNBb0024N19
           genomic sequence, complete sequence.
          Length = 253

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 44/125 (35%), Positives = 66/125 (52%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +GG D    LW IG       L+GHT  V ++AF S   L+A+GS  G I +W+     +
Sbjct: 99  SGGKDDRGFLWKIGSAEDVLELAGHTDTVCTVAFSSDGNLLASGSFDGRINVWNTATRTL 158

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
             TL G  S    L++HP G    +GS D NL +W+      ++T+ GH+  ++   FTP
Sbjct: 159 QGTLEGSGSGFEWLKWHPRGHLIIAGSEDCNLWMWNADHNAILNTFAGHSSTVTCGDFTP 218

Query: 653 DGRWV 667
           DG+ +
Sbjct: 219 DGKLI 223



 Score = 65.9 bits (159), Expect = 6e-10
 Identities = 37/131 (28%), Positives = 60/131 (45%)
 Frame = +2

Query: 224 EFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSA 403
           E   H+  V  + F      +  +G  D  +N+W+    T   TL G  S  E + +   
Sbjct: 119 ELAGHTDTVCTVAFSSDG-NLLASGSFDGRINVWNTATRTLQGTLEGSGSGFEWLKWHPR 177

Query: 404 EILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
             L+ AGS    + +W+ +   ++ T +GH S  T  +F P G+   +GS D +L+IWD 
Sbjct: 178 GHLIIAGSEDCNLWMWNADHNAILNTFAGHSSTVTCGDFTPDGKLICTGSDDASLRIWDP 237

Query: 584 RKKGCIHTYKG 616
           R     H  +G
Sbjct: 238 RTAQSRHVVRG 248



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 22/87 (25%), Positives = 38/87 (43%)
 Frame = +2

Query: 410 LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRK 589
           LVA+G       LW +   + +  L+GH      + F   G   ASGS D  + +W+   
Sbjct: 96  LVASGGKDDRGFLWKIGSAEDVLELAGHTDTVCTVAFSSDGNLLASGSFDGRINVWNTAT 155

Query: 590 KGCIHTYKGHTRGISTIRFTPDGRWVV 670
           +    T +G   G   +++ P G  ++
Sbjct: 156 RTLQGTLEGSGSGFEWLKWHPRGHLII 182



 Score = 34.3 bits (77), Expect = 2.0
 Identities = 16/73 (21%), Positives = 32/73 (43%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + + G +D ++ +W+       +T +GH+S V    F     L+  GS    +++WD   
Sbjct: 180 LIIAGSEDCNLWMWNADHNAILNTFAGHSSTVTCGDFTPDGKLICTGSDDASLRIWDPRT 239

Query: 464 TKMIRTLSGHRSY 502
            +    + G   Y
Sbjct: 240 AQSRHVVRGKLPY 252



>gb:AC087851_1734183 Oryza sativa chromosome 3 BAC OSJNBb0072E24
           genomic sequence, complete sequence.
          Length = 361

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 44/125 (35%), Positives = 66/125 (52%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +GG D    LW IG       L+GHT  V ++AF S   L+A+GS  G I +W+     +
Sbjct: 49  SGGKDDRGFLWKIGSAEDVLELAGHTDTVCTVAFSSDGNLLASGSFDGRINVWNTATRTL 108

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
             TL G  S    L++HP G    +GS D NL +W+      ++T+ GH+  ++   FTP
Sbjct: 109 QGTLEGSGSGFEWLKWHPRGHLIIAGSEDCNLWMWNADHNAILNTFAGHSSTVTCGDFTP 168

Query: 653 DGRWV 667
           DG+ +
Sbjct: 169 DGKLI 173



 Score = 73.9 bits (180), Expect = 2e-12
 Identities = 43/152 (28%), Positives = 71/152 (46%), Gaps = 3/152 (1%)
 Frame = +2

Query: 224 EFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSA 403
           E   H+  V  + F      +  +G  D  +N+W+    T   TL G  S  E + +   
Sbjct: 69  ELAGHTDTVCTVAFSSDG-NLLASGSFDGRINVWNTATRTLQGTLEGSGSGFEWLKWHPR 127

Query: 404 EILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
             L+ AGS    + +W+ +   ++ T +GH S  T  +F P G+   +GS D +L+IWD 
Sbjct: 128 GHLIIAGSEDCNLWMWNADHNAILNTFAGHSSTVTCGDFTPDGKLICTGSDDASLRIWDP 187

Query: 584 RKKGCIHTYKG---HTRGISTIRFTPDGRWVV 670
           R     H  +G   HT G++ +  T D + +V
Sbjct: 188 RTAQSRHVVRGHGYHTDGLTCLSVTSDSQTIV 219



 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 39/145 (26%), Positives = 67/145 (46%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H+  + CL     + +  ++G  D+SV + +I       +L GHT  +E +    +   V
Sbjct: 202 HTDGLTCLSVTSDS-QTIVSGSKDNSVCVVNINSGQVVGSLDGHTGSIECVGISPSYNWV 260

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
           A GS    + +WDL   + IR    H    T+L +     F ASG +D  ++IWD     
Sbjct: 261 ATGSMDQKLIIWDL-GRQSIRCTCNHDEGVTSLAWLGPSRFVASGCIDGMVRIWDSLSGE 319

Query: 596 CIHTYKGHTRGISTIRFTPDGRWVV 670
           C+  + GH   + ++  + DG  +V
Sbjct: 320 CVRAFAGHGDVVQSLAVSADGNSIV 344



 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 30/131 (22%), Positives = 56/131 (42%), Gaps = 3/131 (2%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + + G +D ++ +W+       +T +GH+S V    F     L+  GS    +++WD   
Sbjct: 130 LIIAGSEDCNLWMWNADHNAILNTFAGHSSTVTCGDFTPDGKLICTGSDDASLRIWDPRT 189

Query: 464 TKMIRTLSGHRSYC---TALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
            +    + GH  +    T L      +   SGS D ++ + +I     + +  GHT  I 
Sbjct: 190 AQSRHVVRGHGYHTDGLTCLSVTSDSQTIVSGSKDNSVCVVNINSGQVVGSLDGHTGSIE 249

Query: 635 TIRFTPDGRWV 667
            +  +P   WV
Sbjct: 250 CVGISPSYNWV 260



 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 30/116 (25%), Positives = 54/116 (46%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H+G++ C+     +     TG  D  + +W +G+ +   T + H   V S+A+      V
Sbjct: 244 HTGSIECVGISP-SYNWVATGSMDQKLIIWDLGRQSIRCTCN-HDEGVTSLAWLGPSRFV 301

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
           A+G   G++++WD    + +R  +GH     +L     G    S S D +  I+DI
Sbjct: 302 ASGCIDGMVRIWDSLSGECVRAFAGHGDVVQSLAVSADGNSIVSVSTDGSALIFDI 357



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 22/87 (25%), Positives = 38/87 (43%)
 Frame = +2

Query: 410 LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRK 589
           LVA+G       LW +   + +  L+GH      + F   G   ASGS D  + +W+   
Sbjct: 46  LVASGGKDDRGFLWKIGSAEDVLELAGHTDTVCTVAFSSDGNLLASGSFDGRINVWNTAT 105

Query: 590 KGCIHTYKGHTRGISTIRFTPDGRWVV 670
           +    T +G   G   +++ P G  ++
Sbjct: 106 RTLQGTLEGSGSGFEWLKWHPRGHLII 132



>gb:CR382132_1666041 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 367

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 46/158 (29%), Positives = 80/158 (50%), Gaps = 1/158 (0%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A  G  +Q    H   +N + +   + +M  T  DD ++ +WS  +P+S   L GHT  V
Sbjct: 63  AATGDLIQTLRGHRAGINDISWSPDS-KMLATASDDRTIRIWSTHRPSSQRILVGHTHYV 121

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             + F+    LV +GS+   +++WD+   + I TL+ H    +A++F   G    SGS D
Sbjct: 122 TCVKFNYKGNLVVSGSADENVRVWDVLQGRCIMTLAAHSQPISAVDFSCEGTMIVSGSHD 181

Query: 560 TNLKIWDIRKKGCIHTYKG-HTRGISTIRFTPDGRWVV 670
             +++WD     C+ T  G  +  I   RFTP+ ++++
Sbjct: 182 GLIRMWDTATGQCLKTIVGEESSPIMFARFTPNSKFIL 219



 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 38/134 (28%), Positives = 68/134 (50%), Gaps = 1/134 (0%)
 Frame = +2

Query: 230 VAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEI 409
           V H+  V C++F  K   + ++G  D +V +W + +     TL+ H+ P+ ++ F     
Sbjct: 115 VGHTHYVTCVKFNYKG-NLVVSGSADENVRVWDVLQGRCIMTLAAHSQPISAVDFSCEGT 173

Query: 410 LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTAL-EFHPFGEFFASGSMDTNLKIWDIR 586
           ++ +GS  GLI++WD    + ++T+ G  S       F P  +F    +MD+  ++WD  
Sbjct: 174 MIVSGSHDGLIRMWDTATGQCLKTIVGEESSPIMFARFTPNSKFILVSNMDSTARLWDYM 233

Query: 587 KKGCIHTYKGHTRG 628
               + TYKGH  G
Sbjct: 234 NNKVVKTYKGHENG 247



 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 38/130 (29%), Positives = 62/130 (47%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
           +   T   D S+ LW         TL GH + +  I++     ++A  S    I++W   
Sbjct: 47  KQIATCSADASIKLWDAATGDLIQTLRGHRAGINDISWSPDSKMLATASDDRTIRIWSTH 106

Query: 461 DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
                R L GH  Y T ++F+  G    SGS D N+++WD+ +  CI T   H++ IS +
Sbjct: 107 RPSSQRILVGHTHYVTCVKFNYKGNLVVSGSADENVRVWDVLQGRCIMTLAAHSQPISAV 166

Query: 641 RFTPDGRWVV 670
            F+ +G  +V
Sbjct: 167 DFSCEGTMIV 176



 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 29/106 (27%), Positives = 49/106 (46%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           T+  H++P  +         +A  S+   IKLWD     +I+TL GHR+    + + P  
Sbjct: 29  TIDAHSAPCTTAKISPNGKQIATCSADASIKLWDAATGDLIQTLRGHRAGINDISWSPDS 88

Query: 533 EFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           +  A+ S D  ++IW   +        GHT  ++ ++F   G  VV
Sbjct: 89  KMLATASDDRTIRIWSTHRPSSQRILVGHTHYVTCVKFNYKGNLVV 134



>gb:CR382125_1658273 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 826

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 44/146 (30%), Positives = 66/146 (45%)
 Frame = +2

Query: 230 VAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEI 409
           V HSG V  + F     R  L+  +D +V LWS+   T      GH  PV  + F     
Sbjct: 550 VGHSGPVYSVAFSPDN-RYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGH 608

Query: 410 LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRK 589
                S     +LW  +    +R  SGH +      FHP G +  +GS D   ++WDI+ 
Sbjct: 609 YFITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQT 668

Query: 590 KGCIHTYKGHTRGISTIRFTPDGRWV 667
              +  + GHT  ++ +  +PDGRW+
Sbjct: 669 GDSVRLFLGHTSPVTALEVSPDGRWL 694



 Score = 73.2 bits (178), Expect = 4e-12
 Identities = 38/127 (29%), Positives = 63/127 (49%), Gaps = 1/127 (0%)
 Frame = +2

Query: 212  YKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIA 391
            Y L+ F  H  +V+C  F    C +F TG  D +  +W I    S     GHTSPV ++ 
Sbjct: 628  YPLRIFSGHLNDVDCSTFHPNGCYVF-TGSSDKTCRMWDIQTGDSVRLFLGHTSPVTALE 686

Query: 392  FDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGH-RSYCTALEFHPFGEFFASGSMDTNL 568
                   +  GS  G I +WD+   K I+ + GH ++   ++ F+  G    +G  D ++
Sbjct: 687  VSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSITFNKEGNCLVTGGADQSV 746

Query: 569  KIWDIRK 589
            ++WDI++
Sbjct: 747  RVWDIKR 753



 Score = 72.8 bits (177), Expect = 5e-12
 Identities = 42/129 (32%), Positives = 59/129 (45%), Gaps = 1/129 (0%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F+T   D +  LWS          SGH + V+   F      V  GSS    ++WD++  
Sbjct: 610 FITASHDQTARLWSCDHIYPLRIFSGHLNDVDCSTFHPNGCYVFTGSSDKTCRMWDIQTG 669

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRG-ISTIR 643
             +R   GH S  TALE  P G +  +GS D  + +WDI     I   KGH +  I +I 
Sbjct: 670 DSVRLFLGHTSPVTALEVSPDGRWLTTGSEDGTIIVWDIGTGKRIKQMKGHGKNPIYSIT 729

Query: 644 FTPDGRWVV 670
           F  +G  +V
Sbjct: 730 FNKEGNCLV 738



 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 28/108 (25%), Positives = 45/108 (41%), Gaps = 13/108 (12%)
 Frame = +2

Query: 386 IAFDSAEILVAAGSSSGLIKLWDLE-------------DTKMIRTLSGHRSYCTALEFHP 526
           + F     L AAG     IK+W L+             D     TL GH     ++ F P
Sbjct: 504 VEFSDDARLTAAGFQDSTIKVWYLDGSPLQSILPSKAKDQSNSATLVGHSGPVYSVAFSP 563

Query: 527 FGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
              +  S S D  +++W +    C+  YKGH   +  ++F+P G + +
Sbjct: 564 DNRYLLSASEDKTVRLWSLDTFTCLVCYKGHNHPVWYVKFSPLGHYFI 611



>gb:CR857638_1181860 Pongo pygmaeus mRNA; cDNA DKFZp469A0528 (from
           clone DKFZp469A0528).
          Length = 330

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 44/160 (27%), Positives = 78/160 (48%), Gaps = 4/160 (2%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           + G  L+    HS  V C  F   +  + ++G  D +V +W +       TLS H+ PV 
Sbjct: 113 RSGKCLKTLKGHSNYVFCCNFNPPS-NLIISGSFDETVKIWEVKTGKCLKTLSAHSDPVS 171

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL-SGHRSYCTALEFHPFGEFFASGSMD 559
           ++ F+ +  L+ +GS  GL ++WD    + ++TL        + ++F P G++  + ++D
Sbjct: 172 AVHFNCSGSLIVSGSYDGLCRIWDAASGQCLKTLVDDDNPPVSFVKFSPNGKYILTATLD 231

Query: 560 TNLKIWDIRKKGCIHTYKGHTRG---ISTIRFTPDGRWVV 670
             LK+WD  +  C+ TY GH      I        G+W+V
Sbjct: 232 NTLKLWDYSRGRCLKTYTGHKNEKYCIFANFSVTGGKWIV 271



 Score = 79.3 bits (194), Expect = 5e-14
 Identities = 39/147 (26%), Positives = 66/147 (44%)
 Frame = +2

Query: 230 VAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEI 409
           V H+  V+ ++F         +   D  + +W         TL GH   +  +A+ S   
Sbjct: 38  VGHTEAVSSVKFSPNG-EWLASSSADRLIIIWGAYDGKYERTLYGHNLEISDVAWSSDSS 96

Query: 410 LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRK 589
            + + S    +KLWD+   K ++TL GH +Y     F+P      SGS D  +KIW+++ 
Sbjct: 97  RLVSASDDKTLKLWDMRSGKCLKTLKGHSNYVFCCNFNPPSNLIISGSFDETVKIWEVKT 156

Query: 590 KGCIHTYKGHTRGISTIRFTPDGRWVV 670
             C+ T   H+  +S + F   G  +V
Sbjct: 157 GKCLKTLSAHSDPVSAVHFNCSGSLIV 183



 Score = 74.7 bits (182), Expect = 1e-12
 Identities = 38/146 (26%), Positives = 76/146 (52%), Gaps = 1/146 (0%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H+  ++ + +   + R+ ++  DD ++ LW +       TL GH++ V    F+    L+
Sbjct: 82  HNLEISDVAWSSDSSRL-VSASDDKTLKLWDMRSGKCLKTLKGHSNYVFCCNFNPPSNLI 140

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
            +GS    +K+W+++  K ++TLS H    +A+ F+  G    SGS D   +IWD     
Sbjct: 141 ISGSFDETVKIWEVKTGKCLKTLSAHSDPVSAVHFNCSGSLIVSGSYDGLCRIWDAASGQ 200

Query: 596 CIHT-YKGHTRGISTIRFTPDGRWVV 670
           C+ T        +S ++F+P+G++++
Sbjct: 201 CLKTLVDDDNPPVSFVKFSPNGKYIL 226



 Score = 65.5 bits (158), Expect = 8e-10
 Identities = 35/106 (33%), Positives = 50/106 (47%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           TL GHT  V S+ F      +A+ S+  LI +W   D K  RTL GH    + + +    
Sbjct: 36  TLVGHTEAVSSVKFSPNGEWLASSSADRLIIIWGAYDGKYERTLYGHNLEISDVAWSSDS 95

Query: 533 EFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
               S S D  LK+WD+R   C+ T KGH+  +    F P    ++
Sbjct: 96  SRLVSASDDKTLKLWDMRSGKCLKTLKGHSNYVFCCNFNPPSNLII 141



 Score = 45.4 bits (106), Expect = 9e-04
 Identities = 25/105 (23%), Positives = 49/105 (46%), Gaps = 6/105 (5%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEIL----VAAGSSSGLIKL 448
           +  LT   D+++ LW   +     T +GH +    I F +  +     + +GS   L+ +
Sbjct: 223 KYILTATLDNTLKLWDYSRGRCLKTYTGHKNEKYCI-FANFSVTGGKWIVSGSEDNLVYI 281

Query: 449 WDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM--DTNLKIW 577
           W+L+  ++++ L GH     +   HP     AS ++  D  +K+W
Sbjct: 282 WNLQTKEIVQKLQGHTDVVISAACHPTENLIASAALENDKTIKLW 326



>pir|S48052|S48052 platelet-activating factor acetylhydrolase 45K
           chain - bovine>gb:AY665240_1958545 Saimiri boliviensis
           platelet-activating factor acetylhydrolase isoform 1B
           alpha subunit mRNA, complete cds.>gb:AF016049_2050881
           Rattus norvegicus platelet-activating factor
           acetylhydrolase beta subunit (PAF-AH beta) mRNA,
           complete cds.>gb:AL607024_2071474 Mouse DNA sequence
           from clone RP23-194P5 on chromosome 11 Contains a novel
           gene, the Pafah1b1 gene for platelet-activating factor
           acetylhydrolase isoform 1b beta1 subunit, the 5' end of
           a novel gene and two CpG islands, complete
           sequence.>gb:AY189217_2078817 Mus musculus strain
           NOD/LtJ platelet-activating factor acetylhydrolase
           isoform 1b beta1 subunit (Pafah1b1) mRNA, complete
           cds.>gb:AY189218_2078818 Mus musculus strain C57BL/6
           platelet-activating factor acetylhydrolase isoform 1b
           beta1 subunit (Pafah1b1) mRNA, complete
           cds.>gb:BC014831_2092054 Mus musculus
           platelet-activating factor acetylhydrolase, isoform 1b,
           beta1 subunit, mRNA (cDNA clone MGC:25297
           IMAGE:4507474), complete cds.>gb:BC026141_2095267 Mus
           musculus platelet-activating factor acetylhydrolase,
           isoform 1b, beta1 subunit, mRNA (cDNA clone MGC:13913
           IMAGE:4017963), complete cds.>gb:BC072510_2106527 Rattus
           norvegicus platelet-activating factor acetylhydrolase,
           isoform Ib, alpha subunit 45kDa, mRNA (cDNA clone
           MGC:91446 IMAGE:7104733), complete
           cds.>gb:MMPAFALIS4_2116875 Mus musculus Pafaha/Lis1 exon
           4, Pafaha/Lis1 exon 5, Pafaha/Lis1 exon 6, Pafaha/Lis1
           exon 7, Pafaha/Lis1 exon 8, Pafaha/Lis1 exon 9,
           Pafaha/Lis1 exon 10, Pafaha/Lis1 exon 11, Pafaha/Lis1
           exon 11, and Pafaha/Lis1 exon 12, complete sequence; and
           platelet-activating factor acetylhydrolase 45kD subunit
           (Pafaha/Lis1) gene, alternative splice products,
           complete cds.>gb:MMU95116_2124130 Mus musculus
           lissencephaly-1 protein (LIS-1) mRNA, complete cds.
          Length = 410

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 38/125 (30%), Positives = 67/125 (53%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  +D ++ +W         TL GHT  V+ I+FD +  L+A+ S+   IKLWD + 
Sbjct: 122 VMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG 181

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
            + IRT+ GH    +++   P G+   S S D  +K+W+++   C+ T+ GH   +  +R
Sbjct: 182 FECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVR 241

Query: 644 FTPDG 658
              DG
Sbjct: 242 PNQDG 246



 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 39/114 (34%), Positives = 55/114 (48%)
 Frame = +2

Query: 329 IGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           I +P     LSGH SPV  + F     ++ + S    IK+WD E     RTL GH     
Sbjct: 95  IPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQ 154

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + F   G+  AS S D  +K+WD +   CI T  GH   +S++   P+G  +V
Sbjct: 155 DISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIV 208



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 26/99 (26%), Positives = 54/99 (54%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           L+G  D ++ +W +       TL GH + V  + F S    + + +    +++WD ++ +
Sbjct: 312 LSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKR 371

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            ++TL+ H  + T+L+FH    +  +GS+D  +K+W+ R
Sbjct: 372 CMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR 410



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 40/174 (22%), Positives = 72/174 (41%), Gaps = 20/174 (11%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           GY ++ F  H   V  +R   +   +  +  +D +V +W +      + L  H   VE I
Sbjct: 224 GYCVKTFTGHREWVRMVR-PNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECI 282

Query: 389 AFDSAEI--------------------LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           ++                          + +GS    IK+WD+     + TL GH ++  
Sbjct: 283 SWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVR 342

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + FH  G+F  S + D  L++WD + K C+ T   H   ++++ F     +VV
Sbjct: 343 GVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVV 396



 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 28/120 (23%), Positives = 53/120 (44%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D ++ LW         T+ GH   V S+A       + + S    IK+W+++    ++T 
Sbjct: 171 DMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTF 230

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
           +GHR +   +  +  G   AS S D  +++W +  K C    + H   +  I + P+  +
Sbjct: 231 TGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSY 290



 Score = 32.7 bits (73), Expect = 5.9
 Identities = 21/82 (25%), Positives = 32/82 (39%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L   V H   V  + F     +  L+  DD ++ +W         TL+ H   V S+
Sbjct: 328 GMCLMTLVGHDNWVRGVLFHSGG-KFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSL 386

Query: 389 AFDSAEILVAAGSSSGLIKLWD 454
            F      V  GS    +K+W+
Sbjct: 387 DFHKTAPYVVTGSVDQTVKVWE 408



>pir|S36113|S36113 LIS-1 protein - human
          Length = 409

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 38/125 (30%), Positives = 67/125 (53%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  +D ++ +W         TL GHT  V+ I+FD +  L+A+ S+   IKLWD + 
Sbjct: 121 VMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG 180

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
            + IRT+ GH    +++   P G+   S S D  +K+W+++   C+ T+ GH   +  +R
Sbjct: 181 FECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVR 240

Query: 644 FTPDG 658
              DG
Sbjct: 241 PNQDG 245



 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 39/114 (34%), Positives = 55/114 (48%)
 Frame = +2

Query: 329 IGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           I +P     LSGH SPV  + F     ++ + S    IK+WD E     RTL GH     
Sbjct: 94  IPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQ 153

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + F   G+  AS S D  +K+WD +   CI T  GH   +S++   P+G  +V
Sbjct: 154 DISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIV 207



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 26/99 (26%), Positives = 54/99 (54%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           L+G  D ++ +W +       TL GH + V  + F S    + + +    +++WD ++ +
Sbjct: 311 LSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKR 370

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            ++TL+ H  + T+L+FH    +  +GS+D  +K+W+ R
Sbjct: 371 CMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR 409



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 40/174 (22%), Positives = 72/174 (41%), Gaps = 20/174 (11%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           GY ++ F  H   V  +R   +   +  +  +D +V +W +      + L  H   VE I
Sbjct: 223 GYCVKTFTGHREWVRMVR-PNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECI 281

Query: 389 AFDSAEI--------------------LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           ++                          + +GS    IK+WD+     + TL GH ++  
Sbjct: 282 SWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVR 341

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + FH  G+F  S + D  L++WD + K C+ T   H   ++++ F     +VV
Sbjct: 342 GVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVV 395



 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 28/120 (23%), Positives = 53/120 (44%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D ++ LW         T+ GH   V S+A       + + S    IK+W+++    ++T 
Sbjct: 170 DMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTF 229

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
           +GHR +   +  +  G   AS S D  +++W +  K C    + H   +  I + P+  +
Sbjct: 230 TGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSY 289



 Score = 32.7 bits (73), Expect = 5.9
 Identities = 21/82 (25%), Positives = 32/82 (39%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L   V H   V  + F     +  L+  DD ++ +W         TL+ H   V S+
Sbjct: 327 GMCLMTLVGHDNWVRGVLFHSGG-KFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSL 385

Query: 389 AFDSAEILVAAGSSSGLIKLWD 454
            F      V  GS    +K+W+
Sbjct: 386 DFHKTAPYVVTGSVDQTVKVWE 407



>sp|P43035|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB
           alpha subunit (PAF acetylhydrolase 45 kDa subunit)
           (PAF-AH 45 kDa subunit) (PAF-AH alpha) (PAFAH alpha)
           (Lissencephaly-1 protein) (LIS-1).
          Length = 409

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 38/125 (30%), Positives = 67/125 (53%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  +D ++ +W         TL GHT  V+ I+FD +  L+A+ S+   IKLWD + 
Sbjct: 121 VMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG 180

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
            + IRT+ GH    +++   P G+   S S D  +K+W+++   C+ T+ GH   +  +R
Sbjct: 181 FECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVR 240

Query: 644 FTPDG 658
              DG
Sbjct: 241 PNQDG 245



 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 39/114 (34%), Positives = 55/114 (48%)
 Frame = +2

Query: 329 IGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           I +P     LSGH SPV  + F     ++ + S    IK+WD E     RTL GH     
Sbjct: 94  IPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQ 153

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + F   G+  AS S D  +K+WD +   CI T  GH   +S++   P+G  +V
Sbjct: 154 DISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIV 207



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 26/99 (26%), Positives = 54/99 (54%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           L+G  D ++ +W +       TL GH + V  + F S    + + +    +++WD ++ +
Sbjct: 311 LSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKR 370

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            ++TL+ H  + T+L+FH    +  +GS+D  +K+W+ R
Sbjct: 371 CMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR 409



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 40/174 (22%), Positives = 72/174 (41%), Gaps = 20/174 (11%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           GY ++ F  H   V  +R   +   +  +  +D +V +W +      + L  H   VE I
Sbjct: 223 GYCVKTFTGHREWVRMVR-PNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECI 281

Query: 389 AFDSAEI--------------------LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           ++                          + +GS    IK+WD+     + TL GH ++  
Sbjct: 282 SWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVR 341

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + FH  G+F  S + D  L++WD + K C+ T   H   ++++ F     +VV
Sbjct: 342 GVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVV 395



 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 28/120 (23%), Positives = 53/120 (44%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D ++ LW         T+ GH   V S+A       + + S    IK+W+++    ++T 
Sbjct: 170 DMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTF 229

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
           +GHR +   +  +  G   AS S D  +++W +  K C    + H   +  I + P+  +
Sbjct: 230 TGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSY 289



 Score = 32.7 bits (73), Expect = 5.9
 Identities = 21/82 (25%), Positives = 32/82 (39%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L   V H   V  + F     +  L+  DD ++ +W         TL+ H   V S+
Sbjct: 327 GMCLMTLVGHDNWVRGVLFHSGG-KFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSL 385

Query: 389 AFDSAEILVAAGSSSGLIKLWD 454
            F      V  GS    +K+W+
Sbjct: 386 DFHKTAPYVVTGSVDQTVKVWE 407



>sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB
           alpha subunit (PAF acetylhydrolase 45 kDa subunit)
           (PAF-AH 45 kDa subunit) (PAF-AH alpha) (PAFAH alpha)
           (Lissencephaly-1 protein) (LIS-1).
          Length = 409

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 38/125 (30%), Positives = 67/125 (53%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  +D ++ +W         TL GHT  V+ I+FD +  L+A+ S+   IKLWD + 
Sbjct: 121 VMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG 180

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
            + IRT+ GH    +++   P G+   S S D  +K+W+++   C+ T+ GH   +  +R
Sbjct: 181 FECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVR 240

Query: 644 FTPDG 658
              DG
Sbjct: 241 PNQDG 245



 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 39/114 (34%), Positives = 55/114 (48%)
 Frame = +2

Query: 329 IGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           I +P     LSGH SPV  + F     ++ + S    IK+WD E     RTL GH     
Sbjct: 94  IPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQ 153

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + F   G+  AS S D  +K+WD +   CI T  GH   +S++   P+G  +V
Sbjct: 154 DISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIV 207



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 26/99 (26%), Positives = 54/99 (54%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           L+G  D ++ +W +       TL GH + V  + F S    + + +    +++WD ++ +
Sbjct: 311 LSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKR 370

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            ++TL+ H  + T+L+FH    +  +GS+D  +K+W+ R
Sbjct: 371 CMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR 409



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 40/174 (22%), Positives = 72/174 (41%), Gaps = 20/174 (11%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           GY ++ F  H   V  +R   +   +  +  +D +V +W +      + L  H   VE I
Sbjct: 223 GYCVKTFTGHREWVRMVR-PNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECI 281

Query: 389 AFDSAEI--------------------LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           ++                          + +GS    IK+WD+     + TL GH ++  
Sbjct: 282 SWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVR 341

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + FH  G+F  S + D  L++WD + K C+ T   H   ++++ F     +VV
Sbjct: 342 GVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVV 395



 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 28/120 (23%), Positives = 53/120 (44%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D ++ LW         T+ GH   V S+A       + + S    IK+W+++    ++T 
Sbjct: 170 DMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTF 229

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
           +GHR +   +  +  G   AS S D  +++W +  K C    + H   +  I + P+  +
Sbjct: 230 TGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSY 289



 Score = 32.7 bits (73), Expect = 5.9
 Identities = 21/82 (25%), Positives = 32/82 (39%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L   V H   V  + F     +  L+  DD ++ +W         TL+ H   V S+
Sbjct: 327 GMCLMTLVGHDNWVRGVLFHSGG-KFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSL 385

Query: 389 AFDSAEILVAAGSSSGLIKLWD 454
            F      V  GS    +K+W+
Sbjct: 386 DFHKTAPYVVTGSVDQTVKVWE 407



>gb:BC059759_2552703 Xenopus tropicalis hypothetical protein
           MGC75826, mRNA (cDNA clone MGC:75826 IMAGE:5382477),
           complete cds.
          Length = 305

 Score = 83.6 bits (205), Expect = 3e-15
 Identities = 37/126 (29%), Positives = 65/126 (51%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +G  D  +N++ I       TL GH  P+ S+ F     L+   S  G IK+++++   +
Sbjct: 165 SGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYEVQHASL 224

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
             TLSGH S+   + F P    F S S D ++K+WD+  + C+HT+  H   +  +++  
Sbjct: 225 AATLSGHGSWVLNVAFSPDDTHFVSSSSDKSVKVWDVSARTCVHTFLDHQDQVWGVKYNK 284

Query: 653 DGRWVV 670
           +G  +V
Sbjct: 285 NGSKIV 290



 Score = 59.3 bits (142), Expect = 6e-08
 Identities = 31/122 (25%), Positives = 58/122 (47%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D  + LW +        +        S+AF      +A GS  G + ++ +E  K   +L
Sbjct: 85  DAHIRLWDLESGKQIRAIDAGPVDAWSVAFSPDSQHLATGSHVGKVNIFGVETGKKEYSL 144

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
                +  ++ + P G++ ASG++D  + I+DI     +HT +GH   I ++ F+PD + 
Sbjct: 145 DTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQL 204

Query: 665 VV 670
           +V
Sbjct: 205 LV 206



 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 31/121 (25%), Positives = 57/121 (47%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           TG     VN++ +       +L      + SIA+      +A+G+  G+I ++D+   K+
Sbjct: 123 TGSHVGKVNIFGVETGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKL 182

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           + TL GH     +L F P  +   + S D  +KI++++      T  GH   +  + F+P
Sbjct: 183 LHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYEVQHASLAATLSGHGSWVLNVAFSP 242

Query: 653 D 655
           D
Sbjct: 243 D 243



 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 28/124 (22%), Positives = 57/124 (45%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L     H+  +  L F   + ++ +T  DD  + ++ +   +  +TLSGH S V ++
Sbjct: 180 GKLLHTLEGHAMPIRSLTFSPDS-QLLVTASDDGYIKIYEVQHASLAATLSGHGSWVLNV 238

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           AF   +    + SS   +K+WD+     + T   H+     ++++  G    S + D  +
Sbjct: 239 AFSPDDTHFVSSSSDKSVKVWDVSARTCVHTFLDHQDQVWGVKYNKNGSKIVSVADDQEI 298

Query: 569 KIWD 580
            ++D
Sbjct: 299 HVYD 302



>gb:BC044530_2548832 Danio rerio platelet-activating factor
           acetylhydrolase, isoform Ib, alpha subunit b, mRNA (cDNA
           clone MGC:55898 IMAGE:3818837), complete cds.
          Length = 410

 Score = 83.6 bits (205), Expect = 3e-15
 Identities = 38/125 (30%), Positives = 65/125 (52%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  +D ++ +W         TL GHT  V+ I+FD    L+A+ S+   IKLWD + 
Sbjct: 122 LMVSASEDATIKVWDYEAGDFERTLKGHTDSVQDISFDQTGKLLASCSADMTIKLWDFQG 181

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
            + IRT+ GH    +++   P G+   S S D  +K+W++    C+ T+ GH   +  +R
Sbjct: 182 FECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTMKMWEVATGYCVKTFTGHREWVRMVR 241

Query: 644 FTPDG 658
              DG
Sbjct: 242 PNQDG 246



 Score = 79.3 bits (194), Expect = 5e-14
 Identities = 40/114 (35%), Positives = 55/114 (48%)
 Frame = +2

Query: 329 IGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           I +P     LSGH SPV  + F     L+ + S    IK+WD E     RTL GH     
Sbjct: 95  IPRPPEKYALSGHRSPVTRVIFHPVFSLMVSASEDATIKVWDYEAGDFERTLKGHTDSVQ 154

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + F   G+  AS S D  +K+WD +   CI T  GH   +S++   P+G  +V
Sbjct: 155 DISFDQTGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIV 208



 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 28/99 (28%), Positives = 53/99 (53%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           L+G  D ++ +W I       TL GH + V  + F      V + +    +++WD ++ +
Sbjct: 312 LSGSRDKTIKMWDISTGMCLMTLVGHDNWVRGVLFHPGGRFVVSCADDKTLRIWDYKNKR 371

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            ++TLS H  + T+L+FH    +  +GS+D  +K+W+ R
Sbjct: 372 CMKTLSAHEHFVTSLDFHKASPYVVTGSVDQTVKVWECR 410



 Score = 66.6 bits (161), Expect = 4e-10
 Identities = 44/174 (25%), Positives = 76/174 (43%), Gaps = 20/174 (11%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           GY ++ F  H   V  +R   +   +  +  +D +V +W +      + L  H   VE I
Sbjct: 224 GYCVKTFTGHREWVRMVR-PNQDGTLLASCSNDQTVRVWVVATKECKAELREHEHVVECI 282

Query: 389 AF--DSAEILVA------------------AGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           ++  +SA   ++                  +GS    IK+WD+     + TL GH ++  
Sbjct: 283 SWAPESAHPTISEATGSENKKSGKPGPFLLSGSRDKTIKMWDISTGMCLMTLVGHDNWVR 342

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + FHP G F  S + D  L+IWD + K C+ T   H   ++++ F     +VV
Sbjct: 343 GVLFHPGGRFVVSCADDKTLRIWDYKNKRCMKTLSAHEHFVTSLDFHKASPYVV 396



 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 31/140 (22%), Positives = 62/140 (44%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H+ +V  + F + T ++  +   D ++ LW         T+ GH   V S+A       +
Sbjct: 149 HTDSVQDISFDQ-TGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHI 207

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
            + S    +K+W++     ++T +GHR +   +  +  G   AS S D  +++W +  K 
Sbjct: 208 VSASRDKTMKMWEVATGYCVKTFTGHREWVRMVRPNQDGTLLASCSNDQTVRVWVVATKE 267

Query: 596 CIHTYKGHTRGISTIRFTPD 655
           C    + H   +  I + P+
Sbjct: 268 CKAELREHEHVVECISWAPE 287



 Score = 35.4 bits (80), Expect = 0.91
 Identities = 17/58 (29%), Positives = 26/58 (44%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           R  ++  DD ++ +W         TLS H   V S+ F  A   V  GS    +K+W+
Sbjct: 351 RFVVSCADDKTLRIWDYKNKRCMKTLSAHEHFVTSLDFHKASPYVVTGSVDQTVKVWE 408



>gb:AF113946_2474699 Gallus gallus LIS1 (LIS1) mRNA, complete cds.
          Length = 410

 Score = 83.6 bits (205), Expect = 3e-15
 Identities = 38/125 (30%), Positives = 66/125 (52%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  +D ++ +W         TL GHT  V+ I+FD    L+A+ S+   IKLWD + 
Sbjct: 122 VMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHTGKLLASCSADMTIKLWDFQG 181

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
            + IRT+ GH    +++   P G+   S S D  +K+W+++   C+ T+ GH   +  +R
Sbjct: 182 FECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVR 241

Query: 644 FTPDG 658
              DG
Sbjct: 242 PNQDG 246



 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 39/114 (34%), Positives = 55/114 (48%)
 Frame = +2

Query: 329 IGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           I +P     LSGH SPV  + F     ++ + S    IK+WD E     RTL GH     
Sbjct: 95  IPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQ 154

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + F   G+  AS S D  +K+WD +   CI T  GH   +S++   P+G  +V
Sbjct: 155 DISFDHTGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIV 208



 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 27/99 (27%), Positives = 54/99 (54%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           L+G  D ++ +W I       TL GH + V  + F S    + + +    +++WD ++ +
Sbjct: 312 LSGSRDKTIKMWDISTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDFKNKR 371

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            ++TL+ H  + T+L+FH    +  +GS+D  +K+W+ R
Sbjct: 372 CMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR 410



 Score = 62.8 bits (151), Expect = 5e-09
 Identities = 41/174 (23%), Positives = 76/174 (43%), Gaps = 20/174 (11%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           GY ++ F  H   V  +R   +   +  +  +D +V +W +      + L  H   VE I
Sbjct: 224 GYCVKTFTGHREWVRMVR-PNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECI 282

Query: 389 AF--DSAEILVA------------------AGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           ++  +S+   ++                  +GS    IK+WD+     + TL GH ++  
Sbjct: 283 SWAPESSYSTISEATGSETKKSGKPGPFLLSGSRDKTIKMWDISTGMCLMTLVGHDNWVR 342

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + FH  G+F  S + D  L++WD + K C+ T   H   ++++ F     +VV
Sbjct: 343 GVLFHSGGKFILSCADDKTLRVWDFKNKRCMKTLNAHEHFVTSLDFHKTAPYVV 396



 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 32/143 (22%), Positives = 63/143 (44%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H+ +V  + F   T ++  +   D ++ LW         T+ GH   V S+A       +
Sbjct: 149 HTDSVQDISFDH-TGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHI 207

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
            + S    IK+W+++    ++T +GHR +   +  +  G   AS S D  +++W +  K 
Sbjct: 208 VSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKE 267

Query: 596 CIHTYKGHTRGISTIRFTPDGRW 664
           C    + H   +  I + P+  +
Sbjct: 268 CKAELREHEHVVECISWAPESSY 290



 Score = 33.1 bits (74), Expect = 4.5
 Identities = 21/82 (25%), Positives = 32/82 (39%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L   V H   V  + F     +  L+  DD ++ +W         TL+ H   V S+
Sbjct: 328 GMCLMTLVGHDNWVRGVLFHSGG-KFILSCADDKTLRVWDFKNKRCMKTLNAHEHFVTSL 386

Query: 389 AFDSAEILVAAGSSSGLIKLWD 454
            F      V  GS    +K+W+
Sbjct: 387 DFHKTAPYVVTGSVDQTVKVWE 408



>gb:HUMLIS1C_2034077 Homo sapiens (clone 6-1) Miller-Dieker
           lissencephaly protein (LIS1) mRNA, complete cds.
          Length = 288

 Score = 83.6 bits (205), Expect = 3e-15
 Identities = 38/123 (30%), Positives = 66/123 (53%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           ++  +D ++ +W         TL GHT  V+ I+FD +  L+A+ S+   IKLWD +  +
Sbjct: 2   VSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQGFE 61

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFT 649
            IRT+ GH    +++   P G+   S S D  +K+W+++   C+ T+ GH   +  +R  
Sbjct: 62  CIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVRPN 121

Query: 650 PDG 658
            DG
Sbjct: 122 QDG 124



 Score = 65.9 bits (159), Expect = 6e-10
 Identities = 25/99 (25%), Positives = 53/99 (53%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           L+G  D ++ +W +       T  GH + V  + F S    + + +    +++WD ++ +
Sbjct: 190 LSGSRDKTIKMWDVSTGMCLMTXVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKR 249

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            ++TL+ H  + T+L+FH    +  +GS+D  +K+W+ R
Sbjct: 250 CMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR 288



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 29/86 (33%), Positives = 42/86 (48%)
 Frame = +2

Query: 413 VAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKK 592
           + + S    IK+WD E     RTL GH      + F   G+  AS S D  +K+WD +  
Sbjct: 1   MVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQGF 60

Query: 593 GCIHTYKGHTRGISTIRFTPDGRWVV 670
            CI T  GH   +S++   P+G  +V
Sbjct: 61  ECIRTMHGHDHNVSSVAIMPNGDHIV 86



 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 39/174 (22%), Positives = 71/174 (40%), Gaps = 20/174 (11%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           GY ++ F  H   V  +R   +   +  +  +D +V +W +      + L  H   VE I
Sbjct: 102 GYCVKTFTGHREWVRMVR-PNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECI 160

Query: 389 AFDSAEI--------------------LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           ++                          + +GS    IK+WD+     + T  GH ++  
Sbjct: 161 SWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTXVGHDNWVR 220

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + FH  G+F  S + D  L++WD + K C+ T   H   ++++ F     +VV
Sbjct: 221 GVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVV 274



 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 28/120 (23%), Positives = 53/120 (44%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D ++ LW         T+ GH   V S+A       + + S    IK+W+++    ++T 
Sbjct: 49  DMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTF 108

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
           +GHR +   +  +  G   AS S D  +++W +  K C    + H   +  I + P+  +
Sbjct: 109 TGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSY 168



 Score = 32.3 bits (72), Expect = 7.7
 Identities = 15/58 (25%), Positives = 25/58 (43%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           +  L+  DD ++ +W         TL+ H   V S+ F      V  GS    +K+W+
Sbjct: 229 KFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWE 286



>gb:CR457333_1993540 Homo sapiens full open reading frame cDNA clone
           RZPDo834H0413D for gene REC14, recombination protein
           REC14; complete cds, incl. stopcodon.
          Length = 305

 Score = 83.6 bits (205), Expect = 3e-15
 Identities = 38/126 (30%), Positives = 64/126 (50%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +G  D  +N++ I       TL GH  P+ S+ F     L+   S  G IK++D++   +
Sbjct: 165 SGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANL 224

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
             TL GH S+   + F P    F S S D N+K+WD+  + C+HT+  H   +  +++  
Sbjct: 225 AGTLGGHASWVLNVAFCPDDTHFVSSSSDKNVKVWDVGTRTCVHTFFDHQDQVWGVKYNG 284

Query: 653 DGRWVV 670
           +G  +V
Sbjct: 285 NGSKIV 290



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 29/122 (23%), Positives = 59/122 (48%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D  + LW +       ++        ++AF      +A G+  G + ++ +E  K   +L
Sbjct: 85  DAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKKEYSL 144

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
                +  ++ + P G++ ASG++D  + I+DI     +HT +GH   I ++ F+PD + 
Sbjct: 145 DTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQL 204

Query: 665 VV 670
           +V
Sbjct: 205 LV 206



 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 32/121 (26%), Positives = 56/121 (46%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           TG     VN++ +       +L      + SIA+      +A+G+  G+I ++D+   K+
Sbjct: 123 TGTHVGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKL 182

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           + TL GH     +L F P  +   + S D  +KI+D++      T  GH   +  + F P
Sbjct: 183 LHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLGGHASWVLNVAFCP 242

Query: 653 D 655
           D
Sbjct: 243 D 243



 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 28/124 (22%), Positives = 53/124 (42%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L     H+  +  L F   + ++ +T  DD  + ++ +       TL GH S V ++
Sbjct: 180 GKLLHTLEGHAMPIRSLTFSPDS-QLLVTASDDGYIKIYDVQHANLAGTLGGHASWVLNV 238

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           AF   +    + SS   +K+WD+     + T   H+     ++++  G    S   D  +
Sbjct: 239 AFCPDDTHFVSSSSDKNVKVWDVGTRTCVHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEI 298

Query: 569 KIWD 580
            I+D
Sbjct: 299 HIYD 302



>gb:BC007417_1970712 Homo sapiens WD repeat domain 51A, mRNA (cDNA
           clone MGC:2887 IMAGE:2989835), complete cds.
          Length = 364

 Score = 83.6 bits (205), Expect = 3e-15
 Identities = 40/148 (27%), Positives = 72/148 (48%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           F AH+  V  + F     + F+T  DD +V +W+  +     +LS H + V    F    
Sbjct: 56  FRAHTATVRSVHFCSDG-QSFVTASDDKTVKVWATHRQKFLFSLSQHINWVRCAKFSPDG 114

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            L+ + S    +KLWD    + + +   H  + T ++FHP G   A+  MD  +K+WD+R
Sbjct: 115 RLIVSASDDKTVKLWDKSSRECVHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDVR 174

Query: 587 KKGCIHTYKGHTRGISTIRFTPDGRWVV 670
               +  Y+ H+  ++ + F P G +++
Sbjct: 175 THRLLQHYQLHSAAVNGLSFHPSGNYLI 202



 Score = 72.8 bits (177), Expect = 5e-12
 Identities = 38/144 (26%), Positives = 62/144 (43%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           F  H   V C+ F      +  +G  D +V +W       ++    HT+ V S+ F S  
Sbjct: 14  FTGHKDAVTCVNFSPSG-HLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDG 72

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
                 S    +K+W     K + +LS H ++    +F P G    S S D  +K+WD  
Sbjct: 73  QSFVTASDDKTVKVWATHRQKFLFSLSQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKS 132

Query: 587 KKGCIHTYKGHTRGISTIRFTPDG 658
            + C+H+Y  H   ++ + F P G
Sbjct: 133 SRECVHSYCEHGGFVTYVDFHPSG 156



 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 36/143 (25%), Positives = 64/143 (44%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H   V C +F     R+ ++  DD +V LW         +   H   V  + F  +   +
Sbjct: 101 HINWVRCAKFSPDG-RLIVSASDDKTVKLWDKSSRECVHSYCEHGGFVTYVDFHPSGTCI 159

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
           AA      +K+WD+   ++++    H +    L FHP G +  + S D+ LKI D+ +  
Sbjct: 160 AAAGMDNTVKVWDVRTHRLLQHYQLHSAAVNGLSFHPSGNYLITASSDSTLKILDLMEGR 219

Query: 596 CIHTYKGHTRGISTIRFTPDGRW 664
            ++T  GH    +T+ F+  G +
Sbjct: 220 LLYTLHGHQGPATTVAFSRTGEY 242



 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 32/121 (26%), Positives = 56/121 (46%), Gaps = 1/121 (0%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKK-TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAF 394
           +  +  H G V  + F    TC      G D++V +W +           H++ V  ++F
Sbjct: 137 VHSYCEHGGFVTYVDFHPSGTC--IAAAGMDNTVKVWDVRTHRLLQHYQLHSAAVNGLSF 194

Query: 395 DSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI 574
             +   +   SS   +K+ DL + +++ TL GH+   T + F   GE+FASG  D  + +
Sbjct: 195 HPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMV 254

Query: 575 W 577
           W
Sbjct: 255 W 255



 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 25/117 (21%), Positives = 51/117 (43%)
 Frame = +2

Query: 320 LWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRS 499
           +W +   +     +GH   V  + F  +  L+A+GS    +++W             H +
Sbjct: 2   VWHMKPQSRAYRFTGHKDAVTCVNFSPSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTA 61

Query: 500 YCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
              ++ F   G+ F + S D  +K+W   ++  + +   H   +   +F+PDGR +V
Sbjct: 62  TVRSVHFCSDGQSFVTASDDKTVKVWATHRQKFLFSLSQHINWVRCAKFSPDGRLIV 118



>gb:AY461709_1329432 Bombyx mori will die slowly mRNA, complete cds.
          Length = 346

 Score = 83.6 bits (205), Expect = 3e-15
 Identities = 36/122 (29%), Positives = 60/122 (49%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D  + +W         T+SGH   +  +A+ S   L+ + S    +K+W+L   K ++TL
Sbjct: 78  DKLIKIWGAYDGKFEKTISGHKMGISDVAWSSDSRLIVSASDDKTLKVWELSSGKCLKTL 137

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
            GH +Y     F+P      SGS D +++IWD+R   C+     H+  +S + F  DG  
Sbjct: 138 KGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKPLPAHSDPVSAVHFNRDGSL 197

Query: 665 VV 670
           +V
Sbjct: 198 IV 199



 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 42/158 (26%), Positives = 74/158 (46%), Gaps = 4/158 (2%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L+    HS  V C  F  ++  + ++G  D SV +W +        L  H+ PV ++
Sbjct: 131 GKCLKTLKGHSNYVFCCNFNPQS-NLIVSGSFDESVRIWDVRTGKCLKPLPAHSDPVSAV 189

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL-SGHRSYCTALEFHPFGEFFASGSMDTN 565
            F+    L+ + S  GL ++WD    + ++TL        + ++F P G++  + ++D  
Sbjct: 190 HFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNT 249

Query: 566 LKIWDIRKKGCIHTYKGHTRG---ISTIRFTPDGRWVV 670
           LK+WD  +  C+ TY GH      I        G+W+V
Sbjct: 250 LKLWDYSRGKCLKTYTGHKNEKYCIFANFSVTGGKWIV 287



 Score = 70.5 bits (171), Expect = 3e-11
 Identities = 33/131 (25%), Positives = 65/131 (49%), Gaps = 1/131 (0%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
           R+ ++  DD ++ +W +       TL GH++ V    F+    L+ +GS    +++WD+ 
Sbjct: 112 RLIVSASDDKTLKVWELSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVR 171

Query: 461 DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHT-YKGHTRGIST 637
             K ++ L  H    +A+ F+  G    S S D   +IWD     C+ T        +S 
Sbjct: 172 TGKCLKPLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSF 231

Query: 638 IRFTPDGRWVV 670
           ++F+P+G++++
Sbjct: 232 VKFSPNGKYIL 242



 Score = 70.1 bits (170), Expect = 3e-11
 Identities = 39/123 (31%), Positives = 60/123 (48%), Gaps = 2/123 (1%)
 Frame = +2

Query: 308 HSVNLWSIGKPTSTS--TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRT 481
           HS N  S+  P  T   TL+GHT    S+ F  +   +A+ S+  LIK+W   D K  +T
Sbjct: 36  HSNNS-SLANPNYTLKFTLAGHTKAATSVKFSPSGKWLASSSADKLIKIWGAYDGKFEKT 94

Query: 482 LSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
           +SGH+   + + +        S S D  LK+W++    C+ T KGH+  +    F P   
Sbjct: 95  ISGHKMGISDVAWSSDSRLIVSASDDKTLKVWELSSGKCLKTLKGHSNYVFCCNFNPQSN 154

Query: 662 WVV 670
            +V
Sbjct: 155 LIV 157



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 24/97 (24%), Positives = 46/97 (47%), Gaps = 6/97 (6%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEIL----VAAGSSSGLIKLWDLEDTKM 472
           D+++ LW   +     T +GH +    I F +  +     + +GS   L+ +W+L+  ++
Sbjct: 247 DNTLKLWDYSRGKCLKTYTGHKNEKYCI-FANFSVTGGKWIVSGSEDNLVYIWNLQSKEI 305

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSM--DTNLKIW 577
           ++ LSGH         HP     AS ++  D  +K+W
Sbjct: 306 VQRLSGHTDTVLCTACHPTENIIASAALENDKTIKLW 342



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 4/86 (4%)
 Frame = +2

Query: 206 RGYKLQEFVAHSGNVNCL--RFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           RG  L+ +  H     C+   F     +  ++G +D+ V +W++        LSGHT  V
Sbjct: 257 RGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQSKEIVQRLSGHTDTV 316

Query: 380 ESIAFDSAEILVAAGS--SSGLIKLW 451
              A    E ++A+ +  +   IKLW
Sbjct: 317 LCTACHPTENIIASAALENDKTIKLW 342



>gb:AK013114_1157333 Mus musculus 10, 11 days embryo whole body
           cDNA, RIKEN full-length enriched library,
           clone:2810418I05 product:MEIOTIC RECOMBINATION PROTEIN
           REC14 (2810418I05RIK PROTEIN) homolog [Mus musculus],
           full insert sequence.>gb:AF309554_2062388 Mus musculus
           meiotic recombination protein REC14 mRNA, complete
           cds.>gb:BC023026_2093979 Mus musculus RIKEN cDNA
           2700038L12 gene, mRNA (cDNA clone MGC:35791
           IMAGE:5374890), complete cds.
          Length = 305

 Score = 83.6 bits (205), Expect = 3e-15
 Identities = 39/126 (30%), Positives = 65/126 (51%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +G  D  +N++ I       TL GH  P+ S+ F     L+   S  G IK++D++   +
Sbjct: 165 SGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANL 224

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
             TLSGH S+   + F P    F S S D ++K+WD+  + CIHT+  H   +  +++  
Sbjct: 225 AGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCIHTFFDHQDQVWGVKYNG 284

Query: 653 DGRWVV 670
           +G  +V
Sbjct: 285 NGSKIV 290



 Score = 58.9 bits (141), Expect = 8e-08
 Identities = 32/121 (26%), Positives = 56/121 (46%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           TG     VN++ +       +L      + SIA+      +A+G+  G+I ++D+   K+
Sbjct: 123 TGTHMGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKL 182

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           + TL GH     +L F P  +   + S D  +KI+D++      T  GH   +  + F P
Sbjct: 183 LHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAFCP 242

Query: 653 D 655
           D
Sbjct: 243 D 243



 Score = 58.9 bits (141), Expect = 8e-08
 Identities = 29/122 (23%), Positives = 59/122 (48%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D  + LW +       ++        ++AF      +A G+  G + ++ +E  K   +L
Sbjct: 85  DAHIRLWDLENGKQMKSIDAGPVDAWTLAFSPDSQYLATGTHMGKVNIFGVESGKKEYSL 144

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
                +  ++ + P G++ ASG++D  + I+DI     +HT +GH   I ++ F+PD + 
Sbjct: 145 DTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQL 204

Query: 665 VV 670
           +V
Sbjct: 205 LV 206



 Score = 48.9 bits (115), Expect = 8e-05
 Identities = 29/124 (23%), Positives = 54/124 (43%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L     H+  +  L F   + ++ +T  DD  + ++ +       TLSGH S V ++
Sbjct: 180 GKLLHTLEGHAMPIRSLTFSPDS-QLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNV 238

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           AF   +    + SS   +K+WD+     I T   H+     ++++  G    S   D  +
Sbjct: 239 AFCPDDTHFVSSSSDKSVKVWDVGTRTCIHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEI 298

Query: 569 KIWD 580
            ++D
Sbjct: 299 HVYD 302



>gb:AK010283_1155647 Mus musculus ES cells cDNA, RIKEN full-length
           enriched library, clone:2400004K09 product:MEIOTIC
           RECOMBINATION PROTEIN REC14 (2810418I05RIK PROTEIN)
           homolog [Mus musculus], full insert sequence.
          Length = 207

 Score = 83.6 bits (205), Expect = 3e-15
 Identities = 39/126 (30%), Positives = 65/126 (51%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +G  D  +N++ I       TL GH  P+ S+ F     L+   S  G IK++D++   +
Sbjct: 67  SGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANL 126

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
             TLSGH S+   + F P    F S S D ++K+WD+  + CIHT+  H   +  +++  
Sbjct: 127 AGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCIHTFFDHQDQVWGVKYNG 186

Query: 653 DGRWVV 670
           +G  +V
Sbjct: 187 NGSKIV 192



 Score = 58.9 bits (141), Expect = 8e-08
 Identities = 32/121 (26%), Positives = 56/121 (46%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           TG     VN++ +       +L      + SIA+      +A+G+  G+I ++D+   K+
Sbjct: 25  TGTHMGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKL 84

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           + TL GH     +L F P  +   + S D  +KI+D++      T  GH   +  + F P
Sbjct: 85  LHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAFCP 144

Query: 653 D 655
           D
Sbjct: 145 D 145



 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 26/96 (27%), Positives = 52/96 (54%)
 Frame = +2

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
           ++AF      +A G+  G + ++ +E  K   +L     +  ++ + P G++ ASG++D 
Sbjct: 13  TLAFSPDSQYLATGTHMGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDG 72

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + I+DI     +HT +GH   I ++ F+PD + +V
Sbjct: 73  IINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLV 108



 Score = 48.9 bits (115), Expect = 8e-05
 Identities = 29/124 (23%), Positives = 54/124 (43%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L     H+  +  L F   + ++ +T  DD  + ++ +       TLSGH S V ++
Sbjct: 82  GKLLHTLEGHAMPIRSLTFSPDS-QLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNV 140

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           AF   +    + SS   +K+WD+     I T   H+     ++++  G    S   D  +
Sbjct: 141 AFCPDDTHFVSSSSDKSVKVWDVGTRTCIHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEI 200

Query: 569 KIWD 580
            ++D
Sbjct: 201 HVYD 204



>gb:AK009247_1155025 Mus musculus adult male tongue cDNA, RIKEN
           full-length enriched library, clone:2310009C03
           product:hypothetical Trp-Asp repeat (WD-repeat)
           structure containing protein, full insert
           sequence.>gb:BC064045_2105298 Mus musculus WD repeat
           domain 5B, mRNA (cDNA clone MGC:73550 IMAGE:1245342),
           complete cds.
          Length = 328

 Score = 83.6 bits (205), Expect = 3e-15
 Identities = 47/160 (29%), Positives = 81/160 (50%), Gaps = 4/160 (2%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           + G  L+    HS  V C  F   +  + ++G  D SV +W +       TLS H+ P+ 
Sbjct: 111 RSGKCLKTLKGHSDFVFCCDFNPPS-NLIVSGSFDESVKIWEVKTGKCLKTLSAHSDPIS 169

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTA-LEFHPFGEFFASGSMD 559
           ++ F+    L+ +GS  GL ++WD    + +RTL+   +   + ++F P G++  + ++D
Sbjct: 170 AVNFNCNGSLIVSGSYDGLCRIWDAASGQCLRTLADEGNPPVSFVKFSPNGKYILTATLD 229

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTI--RFTPDGR-WVV 670
             LK+WD  +  C+ TY GH      +   F+  GR WVV
Sbjct: 230 NTLKLWDYSRGRCLKTYTGHKNEKYCLFASFSVTGRKWVV 269



 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 41/157 (26%), Positives = 74/157 (47%), Gaps = 1/157 (0%)
 Frame = +2

Query: 203 KRGYKLQEFVA-HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           K  Y L+  +A HS  ++ ++F         +   D  + +W         TL GH+  +
Sbjct: 26  KPNYALRLTLAGHSAAISSVKFSPNG-EWLASSAADALIIIWGAYDGNCKKTLYGHSLEI 84

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             +A+ S    + + S    +K+WD+   K ++TL GH  +    +F+P      SGS D
Sbjct: 85  SDVAWSSDSSRLVSASDDKTLKVWDMRSGKCLKTLKGHSDFVFCCDFNPPSNLIVSGSFD 144

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            ++KIW+++   C+ T   H+  IS + F  +G  +V
Sbjct: 145 ESVKIWEVKTGKCLKTLSAHSDPISAVNFNCNGSLIV 181



 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 38/146 (26%), Positives = 75/146 (51%), Gaps = 1/146 (0%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           HS  ++ + +   + R+ ++  DD ++ +W +       TL GH+  V    F+    L+
Sbjct: 80  HSLEISDVAWSSDSSRL-VSASDDKTLKVWDMRSGKCLKTLKGHSDFVFCCDFNPPSNLI 138

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
            +GS    +K+W+++  K ++TLS H    +A+ F+  G    SGS D   +IWD     
Sbjct: 139 VSGSFDESVKIWEVKTGKCLKTLSAHSDPISAVNFNCNGSLIVSGSYDGLCRIWDAASGQ 198

Query: 596 CIHTYKGH-TRGISTIRFTPDGRWVV 670
           C+ T        +S ++F+P+G++++
Sbjct: 199 CLRTLADEGNPPVSFVKFSPNGKYIL 224



 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 25/105 (23%), Positives = 49/105 (46%), Gaps = 6/105 (5%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEIL----VAAGSSSGLIKL 448
           +  LT   D+++ LW   +     T +GH +    + F S  +     V +GS   ++ +
Sbjct: 221 KYILTATLDNTLKLWDYSRGRCLKTYTGHKNEKYCL-FASFSVTGRKWVVSGSEDNMVYI 279

Query: 449 WDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM--DTNLKIW 577
           W+L+  ++++ L GH     +   HP     AS ++  D  +K+W
Sbjct: 280 WNLQTKEIVQRLQGHTDVVISAACHPTKNIIASAALENDKTIKVW 324



>sp|O13282|TAF5_SCHPO Transcription initiation factor TFIID subunit
           5 (Transcription initiation factor TFIID 72 kDa subunit)
           (TAFII-72).>pir|T41454|T41454 transcription initiation
           factor TFIID chain taf72 - fission yeast
           (Schizosaccharomyces pombe)>gb:AB001372_1508461
           Schizosaccharomyces pombe DNA for TFIID subunit taf72p,
           complete cds.>gb:SPCC5E4_1721457 S.pombe chromosome III
           cosmid c5E4.
          Length = 643

 Score = 83.6 bits (205), Expect = 3e-15
 Identities = 41/143 (28%), Positives = 66/143 (46%)
 Frame = +2

Query: 230 VAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEI 409
           ++HSG V    F     +  L+  +D S  LWS+   T+     GHT PV  +AF     
Sbjct: 376 LSHSGPVYGTTFSPDN-KYLLSCSEDASARLWSVDTKTALVAYKGHTGPVWDVAFGPFGH 434

Query: 410 LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRK 589
             A  S     +LW  +    +R  +GH S    + FHP   +  +GS D   ++WD+ +
Sbjct: 435 YFATASHDQTAQLWSCDHIYPLRVFAGHLSDVDCVTFHPNSAYVLTGSSDKTCRLWDVHR 494

Query: 590 KGCIHTYKGHTRGISTIRFTPDG 658
              +  + GHT+ ++ +   PDG
Sbjct: 495 GHSVRVFNGHTQPVTAVAIAPDG 517



 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 41/126 (32%), Positives = 63/126 (50%)
 Frame = +2

Query: 212 YKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIA 391
           Y L+ F  H  +V+C+ F   +  + LTG  D +  LW + +  S    +GHT PV ++A
Sbjct: 454 YPLRVFAGHLSDVDCVTFHPNSAYV-LTGSSDKTCRLWDVHRGHSVRVFNGHTQPVTAVA 512

Query: 392 FDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLK 571
                  +A+  S GLI LWD+   + I+T+ GHR    +L F        SG  D  ++
Sbjct: 513 IAPDGHTMASADSEGLIHLWDIGTGRRIKTMRGHRGNIYSLSFSRESTVLVSGGSDCTVR 572

Query: 572 IWDIRK 589
            WD+ K
Sbjct: 573 AWDVFK 578



 Score = 69.3 bits (168), Expect = 6e-11
 Identities = 43/151 (28%), Positives = 64/151 (42%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           L  +  H+G V  + FG      F T   D +  LWS          +GH S V+ + F 
Sbjct: 414 LVAYKGHTGPVWDVAFGPFG-HYFATASHDQTAQLWSCDHIYPLRVFAGHLSDVDCVTFH 472

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                V  GSS    +LWD+     +R  +GH    TA+   P G   AS   +  + +W
Sbjct: 473 PNSAYVLTGSSDKTCRLWDVHRGHSVRVFNGHTQPVTAVAIAPDGHTMASADSEGLIHLW 532

Query: 578 DIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           DI     I T +GH   I ++ F+ +   +V
Sbjct: 533 DIGTGRRIKTMRGHRGNIYSLSFSRESTVLV 563



 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 38/157 (24%), Positives = 62/157 (39%), Gaps = 13/157 (8%)
 Frame = +2

Query: 239 SGNVNCLRFGKKTCRMFLTGGDDHSVNLWSI-----GKPTSTST--------LSGHTSPV 379
           + N+NC  F   +  M   G  +  + LWSI       P STS         L  H+ PV
Sbjct: 324 NNNMNCAEFSPDST-MIACGFQESYIRLWSIKADKKSLPKSTSVEDSDGSVRLLSHSGPV 382

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
               F      + + S     +LW ++    +    GH      + F PFG +FA+ S D
Sbjct: 383 YGTTFSPDNKYLLSCSEDASARLWSVDTKTALVAYKGHTGPVWDVAFGPFGHYFATASHD 442

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
              ++W       +  + GH   +  + F P+  +V+
Sbjct: 443 QTAQLWSCDHIYPLRVFAGHLSDVDCVTFHPNSAYVL 479



 Score = 39.3 bits (90), Expect = 0.063
 Identities = 20/87 (22%), Positives = 39/87 (44%)
 Frame = +2

Query: 206 RGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVES 385
           RG+ ++ F  H+  V  +        M  +   +  ++LW IG      T+ GH   + S
Sbjct: 494 RGHSVRVFNGHTQPVTAVAIAPDGHTM-ASADSEGLIHLWDIGTGRRIKTMRGHRGNIYS 552

Query: 386 IAFDSAEILVAAGSSSGLIKLWDLEDT 466
           ++F     ++ +G S   ++ WD+  T
Sbjct: 553 LSFSRESTVLVSGGSDCTVRAWDVFKT 579



>gb:BC085620_2564502 Danio rerio cDNA clone MGC:86603 IMAGE:6891938,
           complete cds.
          Length = 511

 Score = 83.2 bits (204), Expect = 4e-15
 Identities = 38/119 (31%), Positives = 61/119 (51%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F+TG  D ++ +W +       +L+GH S V  +A  +    + +      +K WDLE  
Sbjct: 216 FVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVAVSNRSPYLFSCGEDKQVKCWDLEYN 275

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
           K+IR   GH S    L+ HP  +   + S D   ++WDIR K  +HT  GHT  ++T++
Sbjct: 276 KVIRHYHGHLSAVYDLDLHPTIDVLVTCSRDATARVWDIRTKANVHTLSGHTNTVATVK 334



 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 47/128 (36%), Positives = 61/128 (47%)
 Frame = +2

Query: 275 TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           T  + +T   D +  +W I    +  TLSGHT+ V ++   SAE  V  GS    I+LWD
Sbjct: 296 TIDVLVTCSRDATARVWDIRTKANVHTLSGHTNTVATVKCQSAEPQVVTGSHDTTIRLWD 355

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
           L   K   TL+ H+    AL  HP    FASGS D N+K W       I    GH   I+
Sbjct: 356 LVAGKTRATLTNHKKSVRALVLHPRQYTFASGSPD-NIKQWKFPDGNFIQNLSGHNAIIN 414

Query: 635 TIRFTPDG 658
           T+    DG
Sbjct: 415 TLAVNSDG 422



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 20/59 (33%), Positives = 32/59 (54%)
 Frame = +2

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
           K+ R +SGH  +  ++   P  ++F +GS D  +KIWD+       +  GH   IST+R
Sbjct: 192 KLYRVISGHLGWVRSIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGH---ISTVR 247



>gb:BC045888_2549405 Danio rerio zgc:56055, mRNA (cDNA clone
           MGC:56055 IMAGE:3820440), complete cds.
          Length = 416

 Score = 83.2 bits (204), Expect = 4e-15
 Identities = 43/144 (29%), Positives = 69/144 (47%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           F AH+G+V  + F     +  LT  DD S+ LWS+ +     TL  H + V    F    
Sbjct: 98  FRAHTGSVRSVCFSADG-QSLLTASDDQSIKLWSVHRQKIICTLREHNNWVRCARFSPDG 156

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            L+ + S    +KLWD    ++I T      Y + ++FHP     A+ S D  +++WDIR
Sbjct: 157 QLMVSVSDDRTVKLWDASSRQLIHTFCEPGGYSSYVDFHPSSTCIATASSDNTVRVWDIR 216

Query: 587 KKGCIHTYKGHTRGISTIRFTPDG 658
               +  Y+ H+  ++ + F P G
Sbjct: 217 THTLLQHYQVHSAAVNALSFHPSG 240



 Score = 67.4 bits (163), Expect = 2e-10
 Identities = 39/130 (30%), Positives = 58/130 (44%), Gaps = 2/130 (1%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAF--DS 400
           F  H   V C++F   +  +  +   D +V LW       +     HT  V S+ F  D 
Sbjct: 56  FTGHKDAVTCVQFSP-SAHLLASSSRDKTVRLWVPSVKGESVLFRAHTGSVRSVCFSADG 114

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
             +L A+   S  IKLW +   K+I TL  H ++     F P G+   S S D  +K+WD
Sbjct: 115 QSLLTASDDQS--IKLWSVHRQKIICTLREHNNWVRCARFSPDGQLMVSVSDDRTVKLWD 172

Query: 581 IRKKGCIHTY 610
              +  IHT+
Sbjct: 173 ASSRQLIHTF 182



 Score = 66.6 bits (161), Expect = 4e-10
 Identities = 39/144 (27%), Positives = 66/144 (45%), Gaps = 3/144 (2%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTL---SGHTSPVESIAFDSAE 406
           H+  V C RF     ++ ++  DD +V LW         T     G++S V+   F  + 
Sbjct: 143 HNNWVRCARFSPDG-QLMVSVSDDRTVKLWDASSRQLIHTFCEPGGYSSYVD---FHPSS 198

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
             +A  SS   +++WD+    +++    H +   AL FHP G    + S D+ LKI D+ 
Sbjct: 199 TCIATASSDNTVRVWDIRTHTLLQHYQVHSAAVNALSFHPSGNHLLTASSDSTLKILDLL 258

Query: 587 KKGCIHTYKGHTRGISTIRFTPDG 658
           +   ++T  GH    S + F+  G
Sbjct: 259 EGRLLYTLHGHQGSASCVSFSRSG 282



 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 27/112 (24%), Positives = 53/112 (47%)
 Frame = +2

Query: 326 SIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYC 505
           ++  PT      GH   + S+ F  +   +A+GS    + +W+++        +GH+   
Sbjct: 4   ALDDPTLERNFKGHRDAITSLDFSPSGKQIASGSVDASVMVWNMKPQSRAYRFTGHKDAV 63

Query: 506 TALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
           T ++F P     AS S D  +++W    KG    ++ HT  + ++ F+ DG+
Sbjct: 64  TCVQFSPSAHLLASSSRDKTVRLWVPSVKGESVLFRAHTGSVRSVCFSADGQ 115



 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 38/154 (24%), Positives = 70/154 (45%), Gaps = 4/154 (2%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           + F  H   +  L F     +   +G  D SV +W++   +     +GH   V  + F  
Sbjct: 12  RNFKGHRDAITSLDFSPSG-KQIASGSVDASVMVWNMKPQSRAYRFTGHKDAVTCVQFSP 70

Query: 401 AEILVAAGSSSGLIKLWDLE---DTKMIRTLSGH-RSYCTALEFHPFGEFFASGSMDTNL 568
           +  L+A+ S    ++LW      ++ + R  +G  RS C    F   G+   + S D ++
Sbjct: 71  SAHLLASSSRDKTVRLWVPSVKGESVLFRAHTGSVRSVC----FSADGQSLLTASDDQSI 126

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           K+W + ++  I T + H   +   RF+PDG+ +V
Sbjct: 127 KLWSVHRQKIICTLREHNNWVRCARFSPDGQLMV 160



 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 25/95 (26%), Positives = 47/95 (49%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           T   D++V +W I   T       H++ V +++F  +   +   SS   +K+ DL + ++
Sbjct: 203 TASSDNTVRVWDIRTHTLLQHYQVHSAAVNALSFHPSGNHLLTASSDSTLKILDLLEGRL 262

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
           + TL GH+   + + F   G+ FAS   D  + +W
Sbjct: 263 LYTLHGHQGSASCVSFSRSGDQFASAGSDQQVMVW 297



>gb:AY648817_2541645 Danio rerio pleiotropic regulator 1 mRNA,
           complete cds.
          Length = 511

 Score = 83.2 bits (204), Expect = 4e-15
 Identities = 38/119 (31%), Positives = 61/119 (51%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F+TG  D ++ +W +       +L+GH S V  +A  +    + +      +K WDLE  
Sbjct: 216 FVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVAVSNRSPYLFSCGEDKQVKCWDLEYN 275

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
           K+IR   GH S    L+ HP  +   + S D   ++WDIR K  +HT  GHT  ++T++
Sbjct: 276 KVIRHYHGHLSAVYDLDLHPTIDVLVTCSRDATARVWDIRTKANVHTLSGHTNTVATVK 334



 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 47/128 (36%), Positives = 61/128 (47%)
 Frame = +2

Query: 275 TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           T  + +T   D +  +W I    +  TLSGHT+ V ++   SAE  V  GS    I+LWD
Sbjct: 296 TIDVLVTCSRDATARVWDIRTKANVHTLSGHTNTVATVKCQSAEPQVVTGSHDTTIRLWD 355

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
           L   K   TL+ H+    AL  HP    FASGS D N+K W       I    GH   I+
Sbjct: 356 LVAGKTRATLTNHKKSVRALVLHPRQYTFASGSPD-NIKQWKFPDGNFIQNLSGHNAIIN 414

Query: 635 TIRFTPDG 658
           T+    DG
Sbjct: 415 TLAVNSDG 422



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 20/59 (33%), Positives = 32/59 (54%)
 Frame = +2

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
           K+ R +SGH  +  ++   P  ++F +GS D  +KIWD+       +  GH   IST+R
Sbjct: 192 KLYRVISGHLGWVRSIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGH---ISTVR 247



>gb:AJ720488_2502675 Gallus gallus mRNA for hypothetical protein,
           clone 18o16.
          Length = 334

 Score = 83.2 bits (204), Expect = 4e-15
 Identities = 42/157 (26%), Positives = 74/157 (47%), Gaps = 1/157 (0%)
 Frame = +2

Query: 203 KRGYKLQEFVA-HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           K  Y L+  +A H+  V+ ++F         +   D  + +W         T+SGH   +
Sbjct: 32  KPNYALKFTLAGHTKAVSSVKFSPNG-EWLASSSADKLIKIWGAYDGKFEKTISGHKLGI 90

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             +A+ S   L+ + S    +K+WD+   K ++ L GH +Y     F+P      SGS D
Sbjct: 91  SDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKALKGHSNYVFCCNFNPQSNLIVSGSFD 150

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            +++IWD++   C+ T   H+  +S + F  DG  +V
Sbjct: 151 ESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIV 187



 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 44/158 (27%), Positives = 75/158 (47%), Gaps = 4/158 (2%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L+    HS  V C  F  ++  + ++G  D SV +W +       TL  H+ PV ++
Sbjct: 119 GKCLKALKGHSNYVFCCNFNPQS-NLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAV 177

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL-SGHRSYCTALEFHPFGEFFASGSMDTN 565
            F+    L+ + S  GL ++WD    + ++TL        + ++F P G++  + ++D  
Sbjct: 178 HFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNT 237

Query: 566 LKIWDIRKKGCIHTYKGHTRG---ISTIRFTPDGRWVV 670
           LK+WD  K  C+ TY GH      I        G+W+V
Sbjct: 238 LKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIV 275



 Score = 70.1 bits (170), Expect = 3e-11
 Identities = 32/130 (24%), Positives = 65/130 (50%), Gaps = 1/130 (0%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  DD ++ +W +        L GH++ V    F+    L+ +GS    +++WD++ 
Sbjct: 101 LLVSASDDKTLKIWDVSSGKCLKALKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKT 160

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHT-YKGHTRGISTI 640
            K ++TL  H    +A+ F+  G    S S D   +IWD     C+ T        +S +
Sbjct: 161 GKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFV 220

Query: 641 RFTPDGRWVV 670
           +F+P+G++++
Sbjct: 221 KFSPNGKYIL 230



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 24/97 (24%), Positives = 46/97 (47%), Gaps = 6/97 (6%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEIL----VAAGSSSGLIKLWDLEDTKM 472
           D+++ LW   K     T +GH +    I F +  +     + +GS   L+ +W+L+  ++
Sbjct: 235 DNTLKLWDYSKGKCLKTYTGHKNEKYCI-FANFSVTGGKWIVSGSEDNLVYIWNLQTKEI 293

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSM--DTNLKIW 577
           ++ L GH     +   HP     AS ++  D  +K+W
Sbjct: 294 VQKLQGHTDVVISTACHPTENIIASAALENDKTIKLW 330



 Score = 36.6 bits (83), Expect = 0.41
 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 4/86 (4%)
 Frame = +2

Query: 206 RGYKLQEFVAHSGNVNCL--RFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           +G  L+ +  H     C+   F     +  ++G +D+ V +W++        L GHT  V
Sbjct: 245 KGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVV 304

Query: 380 ESIAFDSAEILVAAGS--SSGLIKLW 451
            S A    E ++A+ +  +   IKLW
Sbjct: 305 ISTACHPTENIIASAALENDKTIKLW 330



>gb:HSU75309_2025968 Human TBP-associated factor (hTAFII100) mRNA,
           partial cds.
          Length = 801

 Score = 83.2 bits (204), Expect = 4e-15
 Identities = 42/124 (33%), Positives = 60/124 (48%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           L+ F  H  +VNC RF   +     TG  D +V LW +         +GH  P+ S+ F 
Sbjct: 621 LRIFAGHLADVNCTRFHPNS-NYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFS 679

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                +A G++ G + LWD+    M+  L GH     +L F   GE  ASGSMD  +++W
Sbjct: 680 PNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLW 739

Query: 578 DIRK 589
           D  K
Sbjct: 740 DAIK 743



 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 42/155 (27%), Positives = 70/155 (45%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           K   +L+    HSG V    F        L+  +D +V LWS+   T      GH  PV 
Sbjct: 532 KTASELKILYGHSGPVYGASFSPDR-NYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVW 590

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
              F        +G    + +LW  +  + +R  +GH +      FHP   + A+GS D 
Sbjct: 591 DTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADR 650

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            +++WD+    C+  + GH   I ++ F+P+GR++
Sbjct: 651 TVRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFL 685



 Score = 79.7 bits (195), Expect = 4e-14
 Identities = 39/124 (31%), Positives = 62/124 (50%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F++GG D    LW+          +GH + V    F      VA GS+   ++LWD+ + 
Sbjct: 601 FVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNG 660

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
             +R  +GH+    +L F P G F A+G+ D  + +WDI     +   KGHT  + ++RF
Sbjct: 661 NCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRF 720

Query: 647 TPDG 658
           + DG
Sbjct: 721 SRDG 724



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 29/125 (23%), Positives = 51/125 (40%)
 Frame = +2

Query: 296 GGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMI 475
           G  D +V +WS+               + S+   S   L+   S   L ++ D +    +
Sbjct: 489 GFADSTVRVWSVTP-----------KKLRSVKQASDLSLIDKESDDVLERIMDEKTASEL 537

Query: 476 RTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
           + L GH        F P   +  S S D  +++W ++   C+  YKGH   +   +F+P 
Sbjct: 538 KILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPY 597

Query: 656 GRWVV 670
           G + V
Sbjct: 598 GYYFV 602



>gb:HSTAFII10_2020620 H.sapiens mRNA for TAFII100 protein.
          Length = 799

 Score = 83.2 bits (204), Expect = 4e-15
 Identities = 42/124 (33%), Positives = 60/124 (48%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           L+ F  H  +VNC RF   +     TG  D +V LW +         +GH  P+ S+ F 
Sbjct: 620 LRIFAGHLADVNCTRFHPNS-NYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFS 678

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                +A G++ G + LWD+    M+  L GH     +L F   GE  ASGSMD  +++W
Sbjct: 679 PNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLW 738

Query: 578 DIRK 589
           D  K
Sbjct: 739 DAIK 742



 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 42/155 (27%), Positives = 70/155 (45%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           K   +L+    HSG V    F        L+  +D +V LWS+   T      GH  PV 
Sbjct: 531 KTASELKILYGHSGPVYGASFSPDR-NYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVW 589

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
              F        +G    + +LW  +  + +R  +GH +      FHP   + A+GS D 
Sbjct: 590 DTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADR 649

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            +++WD+    C+  + GH   I ++ F+P+GR++
Sbjct: 650 TVRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFL 684



 Score = 79.7 bits (195), Expect = 4e-14
 Identities = 39/124 (31%), Positives = 62/124 (50%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F++GG D    LW+          +GH + V    F      VA GS+   ++LWD+ + 
Sbjct: 600 FVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNG 659

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
             +R  +GH+    +L F P G F A+G+ D  + +WDI     +   KGHT  + ++RF
Sbjct: 660 NCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRF 719

Query: 647 TPDG 658
           + DG
Sbjct: 720 SRDG 723



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 29/125 (23%), Positives = 51/125 (40%)
 Frame = +2

Query: 296 GGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMI 475
           G  D +V +WS+               + S+   S   L+   S   L ++ D +    +
Sbjct: 488 GFADSTVRVWSVTP-----------KKLRSVKQASDLSLIDKESDDVLERIMDEKTASEL 536

Query: 476 RTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
           + L GH        F P   +  S S D  +++W ++   C+  YKGH   +   +F+P 
Sbjct: 537 KILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPY 596

Query: 656 GRWVV 670
           G + V
Sbjct: 597 GYYFV 601



>gb:BC052268_1984779 Homo sapiens TAF5 RNA polymerase II, TATA box
           binding protein (TBP)-associated factor, 100kDa, mRNA
           (cDNA clone IMAGE:6575596), partial cds.
          Length = 805

 Score = 83.2 bits (204), Expect = 4e-15
 Identities = 42/124 (33%), Positives = 60/124 (48%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           L+ F  H  +VNC RF   +     TG  D +V LW +         +GH  P+ S+ F 
Sbjct: 625 LRIFAGHLADVNCTRFHPNS-NYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFS 683

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                +A G++ G + LWD+    M+  L GH     +L F   GE  ASGSMD  +++W
Sbjct: 684 PNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLW 743

Query: 578 DIRK 589
           D  K
Sbjct: 744 DAIK 747



 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 42/155 (27%), Positives = 70/155 (45%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           K   +L+    HSG V    F        L+  +D +V LWS+   T      GH  PV 
Sbjct: 536 KTASELKILYGHSGPVYGASFSPDR-NYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVW 594

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
              F        +G    + +LW  +  + +R  +GH +      FHP   + A+GS D 
Sbjct: 595 DTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADR 654

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            +++WD+    C+  + GH   I ++ F+P+GR++
Sbjct: 655 TVRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFL 689



 Score = 79.7 bits (195), Expect = 4e-14
 Identities = 39/124 (31%), Positives = 62/124 (50%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F++GG D    LW+          +GH + V    F      VA GS+   ++LWD+ + 
Sbjct: 605 FVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNG 664

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
             +R  +GH+    +L F P G F A+G+ D  + +WDI     +   KGHT  + ++RF
Sbjct: 665 NCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRF 724

Query: 647 TPDG 658
           + DG
Sbjct: 725 SRDG 728



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 29/125 (23%), Positives = 51/125 (40%)
 Frame = +2

Query: 296 GGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMI 475
           G  D +V +WS+               + S+   S   L+   S   L ++ D +    +
Sbjct: 493 GFADSTVRVWSVTP-----------KKLRSVKQASDLSLIDKESDDVLERIMDEKTASEL 541

Query: 476 RTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
           + L GH        F P   +  S S D  +++W ++   C+  YKGH   +   +F+P 
Sbjct: 542 KILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPY 601

Query: 656 GRWVV 670
           G + V
Sbjct: 602 GYYFV 606



>gb:AL591408_1930058 Human DNA sequence from clone RP11-792D24 on
           chromosome 10 Contains the INA gene for internexin
           neuronal intermediate filament protein alpha, the RNF134
           gene for ring finger protein 134, the TAF5D gene for 100
           kD TAF5 RNA polymerase II TATA box binding protein
           (TBP)-associated factor, a novel gene, the 5' end of the
           PDCD11 gene for programmed cell death 11 and four CpG
           islands, complete sequence.
          Length = 800

 Score = 83.2 bits (204), Expect = 4e-15
 Identities = 42/124 (33%), Positives = 60/124 (48%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           L+ F  H  +VNC RF   +     TG  D +V LW +         +GH  P+ S+ F 
Sbjct: 620 LRIFAGHLADVNCTRFHPNS-NYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFS 678

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                +A G++ G + LWD+    M+  L GH     +L F   GE  ASGSMD  +++W
Sbjct: 679 PNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLW 738

Query: 578 DIRK 589
           D  K
Sbjct: 739 DAIK 742



 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 42/155 (27%), Positives = 70/155 (45%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           K   +L+    HSG V    F        L+  +D +V LWS+   T      GH  PV 
Sbjct: 531 KTASELKILYGHSGPVYGASFSPDR-NYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVW 589

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
              F        +G    + +LW  +  + +R  +GH +      FHP   + A+GS D 
Sbjct: 590 DTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADR 649

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            +++WD+    C+  + GH   I ++ F+P+GR++
Sbjct: 650 TVRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFL 684



 Score = 79.7 bits (195), Expect = 4e-14
 Identities = 39/124 (31%), Positives = 62/124 (50%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F++GG D    LW+          +GH + V    F      VA GS+   ++LWD+ + 
Sbjct: 600 FVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNG 659

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
             +R  +GH+    +L F P G F A+G+ D  + +WDI     +   KGHT  + ++RF
Sbjct: 660 NCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRF 719

Query: 647 TPDG 658
           + DG
Sbjct: 720 SRDG 723



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 29/125 (23%), Positives = 51/125 (40%)
 Frame = +2

Query: 296 GGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMI 475
           G  D +V +WS+               + S+   S   L+   S   L ++ D +    +
Sbjct: 488 GFADSTVRVWSVTP-----------KKLRSVKQASDLSLIDKESDDVLERIMDEKTASEL 536

Query: 476 RTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
           + L GH        F P   +  S S D  +++W ++   C+  YKGH   +   +F+P 
Sbjct: 537 KILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPY 596

Query: 656 GRWVV 670
           G + V
Sbjct: 597 GYYFV 601



>gb:AF100786_1883061 Homo sapiens G protein beta subunit-like
           protein mRNA, complete cds.>gb:AF309553_1896146 Homo
           sapiens meiotic recombination protein REC14 mRNA,
           complete cds.>gb:AK024754_1910142 Homo sapiens cDNA:
           FLJ21101 fis, clone CAS04682.>gb:BC010080_1972470 Homo
           sapiens recombination protein REC14, mRNA (cDNA clone
           MGC:19469 IMAGE:4329599), complete cds.
          Length = 305

 Score = 83.2 bits (204), Expect = 4e-15
 Identities = 38/126 (30%), Positives = 65/126 (51%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +G  D  +N++ I       TL GH  P+ S+ F     L+   S  G IK++D++   +
Sbjct: 165 SGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANL 224

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
             TLSGH S+   + F P    F S S D ++K+WD+  + C+HT+  H   +  +++  
Sbjct: 225 AGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGVKYNG 284

Query: 653 DGRWVV 670
           +G  +V
Sbjct: 285 NGSKIV 290



 Score = 58.9 bits (141), Expect = 8e-08
 Identities = 32/121 (26%), Positives = 56/121 (46%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           TG     VN++ +       +L      + SIA+      +A+G+  G+I ++D+   K+
Sbjct: 123 TGTHVGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKL 182

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           + TL GH     +L F P  +   + S D  +KI+D++      T  GH   +  + F P
Sbjct: 183 LHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAFCP 242

Query: 653 D 655
           D
Sbjct: 243 D 243



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 29/122 (23%), Positives = 59/122 (48%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D  + LW +       ++        ++AF      +A G+  G + ++ +E  K   +L
Sbjct: 85  DAHIRLWDLENGKQIKSIDAGPVDAWTLAFSPDSQYLATGTHVGKVNIFGVESGKKEYSL 144

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
                +  ++ + P G++ ASG++D  + I+DI     +HT +GH   I ++ F+PD + 
Sbjct: 145 DTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQL 204

Query: 665 VV 670
           +V
Sbjct: 205 LV 206



 Score = 48.9 bits (115), Expect = 8e-05
 Identities = 29/124 (23%), Positives = 54/124 (43%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L     H+  +  L F   + ++ +T  DD  + ++ +       TLSGH S V ++
Sbjct: 180 GKLLHTLEGHAMPIRSLTFSPDS-QLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNV 238

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           AF   +    + SS   +K+WD+     + T   H+     ++++  G    S   D  +
Sbjct: 239 AFCPDDTHFVSSSSDKSVKVWDVGTRTCVHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEI 298

Query: 569 KIWD 580
            I+D
Sbjct: 299 HIYD 302



>gb:CR382131_1664617 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 452

 Score = 83.2 bits (204), Expect = 4e-15
 Identities = 41/125 (32%), Positives = 68/125 (54%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           T   D++  LW I   T   +  GH+  V S+AF     LVA+     + ++WD+   + 
Sbjct: 272 TASYDYTWALWDIESGTKLLSQEGHSKGVHSVAFHPDGALVASAGLDAVGRVWDMRSGRS 331

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           I+TL GH     +L +   G + ASGS D +++IWD+R + C HT   HT+ +S+++F  
Sbjct: 332 IQTLEGHIREIYSLGWSGNGFYLASGSADGSVRIWDLRAQKCSHTIPAHTKIVSSVQFDK 391

Query: 653 DGRWV 667
            G ++
Sbjct: 392 SGSFL 396



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 34/124 (27%), Positives = 56/124 (45%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G KL     HS  V+ + F      +  + G D    +W +    S  TL GH   + S+
Sbjct: 287 GTKLLSQEGHSKGVHSVAFHPDGA-LVASAGLDAVGRVWDMRSGRSIQTLEGHIREIYSL 345

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            +      +A+GS+ G +++WDL   K   T+  H    ++++F   G F AS   D + 
Sbjct: 346 GWSGNGFYLASGSADGSVRIWDLRAQKCSHTIPAHTKIVSSVQFDKSGSFLASTGYDGDF 405

Query: 569 KIWD 580
            IW+
Sbjct: 406 NIWN 409



 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 32/123 (26%), Positives = 59/123 (47%), Gaps = 5/123 (4%)
 Frame = +2

Query: 314 VNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE----DTKMIRT 481
           + L  +    + + L GH   V ++ +  A  ++ +G   G +  WD      +    RT
Sbjct: 192 IKLMDVPNLNTKAVLRGHVDKVSALKW--ARNILLSGCGEGKLLFWDSSTEGNEHTAYRT 249

Query: 482 LS-GHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           +S  H+     L+ HP G++ A+ S D    +WDI     + + +GH++G+ ++ F PDG
Sbjct: 250 VSEAHKGRIAGLDVHPSGQWAATASYDYTWALWDIESGTKLLSQEGHSKGVHSVAFHPDG 309

Query: 659 RWV 667
             V
Sbjct: 310 ALV 312



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 22/95 (23%), Positives = 43/95 (45%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +G  D SV +W +     + T+  HT  V S+ FD +   +A+    G   +W+ +   +
Sbjct: 356 SGSADGSVRIWDLRAQKCSHTIPAHTKIVSSVQFDKSGSFLASTGYDGDFNIWNADSWTL 415

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
            +     +     ++  P  E+FA+   D  +K+W
Sbjct: 416 AKRWK-TQDRIMGMDLGPGNEYFATCGWDRTVKLW 449



>gb:CQ783423_1452458 Sequence 3563 from Patent
           EP1396543.>gb:AK075289_1913011 Homo sapiens cDNA
           FLJ90808 fis, clone Y79AA1000777, weakly similar to
           VEGETATIBLE INCOMPATIBILITY PROTEIN HET-E-1.
          Length = 407

 Score = 83.2 bits (204), Expect = 4e-15
 Identities = 40/148 (27%), Positives = 72/148 (48%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           F AH+  V  + F     + F+T  DD +V +W+  +     +LS H + V    F    
Sbjct: 99  FRAHTATVRSVHFCSDG-QSFVTASDDKTVKVWATHRQKFLFSLSQHINWVRCAKFSPDG 157

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            L+ + S    +KLWD    + + +   H  + T ++FHP G   A+  MD  +K+WD+R
Sbjct: 158 RLIVSASDDKTVKLWDKSSRECVHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDVR 217

Query: 587 KKGCIHTYKGHTRGISTIRFTPDGRWVV 670
               +  Y+ H+  ++ + F P G +++
Sbjct: 218 TYRLLQHYQLHSAAVNGLSFHPSGNYLI 245



 Score = 72.8 bits (177), Expect = 5e-12
 Identities = 38/144 (26%), Positives = 62/144 (43%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           F  H   V C+ F      +  +G  D +V +W       ++    HT+ V S+ F S  
Sbjct: 57  FTGHKDAVTCVNFSPSG-HLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDG 115

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
                 S    +K+W     K + +LS H ++    +F P G    S S D  +K+WD  
Sbjct: 116 QSFVTASDDKTVKVWATHRQKFLFSLSQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKS 175

Query: 587 KKGCIHTYKGHTRGISTIRFTPDG 658
            + C+H+Y  H   ++ + F P G
Sbjct: 176 SRECVHSYCEHGGFVTYVDFHPSG 199



 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 36/143 (25%), Positives = 64/143 (44%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H   V C +F     R+ ++  DD +V LW         +   H   V  + F  +   +
Sbjct: 144 HINWVRCAKFSPDG-RLIVSASDDKTVKLWDKSSRECVHSYCEHGGFVTYVDFHPSGTCI 202

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
           AA      +K+WD+   ++++    H +    L FHP G +  + S D+ LKI D+ +  
Sbjct: 203 AAAGMDNTVKVWDVRTYRLLQHYQLHSAAVNGLSFHPSGNYLITASSDSTLKILDLMEGR 262

Query: 596 CIHTYKGHTRGISTIRFTPDGRW 664
            ++T  GH    +T+ F+  G +
Sbjct: 263 LLYTLHGHQGPATTVAFSRTGEY 285



 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 33/150 (22%), Positives = 64/150 (42%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           + F  H   V C+ F   T +   +G  D  + +W +   +     +GH   V  + F  
Sbjct: 13  RHFKGHRDAVTCVDFSINT-KQLASGSMDSCLMVWHMKPQSRAYRFTGHKDAVTCVNFSP 71

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
           +  L+A+GS    +++W             H +   ++ F   G+ F + S D  +K+W 
Sbjct: 72  SGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDGQSFVTASDDKTVKVWA 131

Query: 581 IRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
             ++  + +   H   +   +F+PDGR +V
Sbjct: 132 THRQKFLFSLSQHINWVRCAKFSPDGRLIV 161



 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 29/108 (26%), Positives = 48/108 (44%)
 Frame = +2

Query: 338 PTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALE 517
           P+      GH   V  + F      +A+GS    + +W ++        +GH+   T + 
Sbjct: 9   PSLERHFKGHRDAVTCVDFSINTKQLASGSMDSCLMVWHMKPQSRAYRFTGHKDAVTCVN 68

Query: 518 FHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
           F P G   ASGS D  ++IW    KG    ++ HT  + ++ F  DG+
Sbjct: 69  FSPSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDGQ 116



 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 32/121 (26%), Positives = 56/121 (46%), Gaps = 1/121 (0%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKK-TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAF 394
           +  +  H G V  + F    TC      G D++V +W +           H++ V  ++F
Sbjct: 180 VHSYCEHGGFVTYVDFHPSGTC--IAAAGMDNTVKVWDVRTYRLLQHYQLHSAAVNGLSF 237

Query: 395 DSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI 574
             +   +   SS   +K+ DL + +++ TL GH+   T + F   GE+FASG  D  + +
Sbjct: 238 HPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMV 297

Query: 575 W 577
           W
Sbjct: 298 W 298



 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 21/67 (31%), Positives = 36/67 (53%)
 Frame = +2

Query: 458 EDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIST 637
           ED  + R   GHR   T ++F    +  ASGSMD+ L +W ++ +   + + GH   ++ 
Sbjct: 7   EDPSLERHFKGHRDAVTCVDFSINTKQLASGSMDSCLMVWHMKPQSRAYRFTGHKDAVTC 66

Query: 638 IRFTPDG 658
           + F+P G
Sbjct: 67  VNFSPSG 73



>gb:PFMAL3P8_1394642 Plasmodium falciparum MAL3P8, complete
           sequence.
          Length = 600

 Score = 83.2 bits (204), Expect = 4e-15
 Identities = 45/144 (31%), Positives = 65/144 (45%), Gaps = 1/144 (0%)
 Frame = +2

Query: 212 YKLQEFV-AHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           YKL   +  HSG VNC+         F TG +D  + +W +       TL+GH + +  I
Sbjct: 276 YKLYRVILGHSGWVNCVDVDISN-EWFATGSNDRLIKIWDLASCKLKLTLTGHINSIRDI 334

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
                   + +      +K WDLE  K+IR   GH S    L  HP  +   SG  D  +
Sbjct: 335 KISKKNPYLFSCGEDNRVKCWDLEYNKVIRDYHGHLSGVYCLSLHPSLDLLMSGGRDAVV 394

Query: 569 KIWDIRKKGCIHTYKGHTRGISTI 640
           ++WDIR K  +    GHT  + +I
Sbjct: 395 RVWDIRTKSSVFVLSGHTGTVMSI 418



 Score = 74.7 bits (182), Expect = 1e-12
 Identities = 42/120 (35%), Positives = 62/120 (51%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           ++++  H   V CL     +  + ++GG D  V +W I   +S   LSGHT  V SI   
Sbjct: 363 IRDYHGHLSGVYCLSL-HPSLDLLMSGGRDAVVRVWDIRTKSSVFVLSGHTGTVMSICSQ 421

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
           S E  V +GS   +I+LWDL + K   +L+ H+    +L  HPF   F S   D N+K+W
Sbjct: 422 SVEPQVVSGSQDKMIRLWDLNNGKCRISLTHHKKSIRSLSIHPFEYSFCSCGTD-NVKVW 480



 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 29/97 (29%), Positives = 44/97 (45%)
 Frame = +2

Query: 362 GHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFF 541
           GH+  V  +  D +    A GS+  LIK+WDL   K+  TL+GH +    ++      + 
Sbjct: 284 GHSGWVNCVDVDISNEWFATGSNDRLIKIWDLASCKLKLTLTGHINSIRDIKISKKNPYL 343

Query: 542 ASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
            S   D  +K WD+     I  Y GH  G+  +   P
Sbjct: 344 FSCGEDNRVKCWDLEYNKVIRDYHGHLSGVYCLSLHP 380



 Score = 39.3 bits (90), Expect = 0.063
 Identities = 19/61 (31%), Positives = 30/61 (49%)
 Frame = +2

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
           K+ R + GH  +   ++     E+FA+GS D  +KIWD+       T  GH   I  I+ 
Sbjct: 277 KLYRVILGHSGWVNCVDVDISNEWFATGSNDRLIKIWDLASCKLKLTLTGHINSIRDIKI 336

Query: 647 T 649
           +
Sbjct: 337 S 337



>gb:AK088953_1175721 Mus musculus 2 days neonate thymus thymic cells
           cDNA, RIKEN full-length enriched library,
           clone:E430033I22 product:TRANSCRIPTION INITIATION FACTOR
           TFIID 100 KDA SUBUNIT (TAFII-100) (TAFII100) homolog
           [Homo sapiens], full insert sequence.
          Length = 801

 Score = 83.2 bits (204), Expect = 4e-15
 Identities = 42/124 (33%), Positives = 60/124 (48%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           L+ F  H  +VNC RF   +     TG  D +V LW +         +GH  P+ S+ F 
Sbjct: 621 LRIFAGHLADVNCTRFHPNS-NYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFS 679

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                +A G++ G + LWD+    M+  L GH     +L F   GE  ASGSMD  +++W
Sbjct: 680 PNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLW 739

Query: 578 DIRK 589
           D  K
Sbjct: 740 DAVK 743



 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 42/155 (27%), Positives = 70/155 (45%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           K   +L+    HSG V    F        L+  +D +V LWS+   T      GH  PV 
Sbjct: 532 KTASELKILYGHSGPVYGASFSPDR-NYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVW 590

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
              F        +G    + +LW  +  + +R  +GH +      FHP   + A+GS D 
Sbjct: 591 DTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADR 650

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            +++WD+    C+  + GH   I ++ F+P+GR++
Sbjct: 651 TVRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFL 685



 Score = 79.7 bits (195), Expect = 4e-14
 Identities = 39/124 (31%), Positives = 62/124 (50%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F++GG D    LW+          +GH + V    F      VA GS+   ++LWD+ + 
Sbjct: 601 FVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNG 660

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
             +R  +GH+    +L F P G F A+G+ D  + +WDI     +   KGHT  + ++RF
Sbjct: 661 NCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRF 720

Query: 647 TPDG 658
           + DG
Sbjct: 721 SRDG 724



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 29/125 (23%), Positives = 51/125 (40%)
 Frame = +2

Query: 296 GGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMI 475
           G  D +V +WS+               + S+   S   L+   S   L ++ D +    +
Sbjct: 489 GFADSTVRVWSVTP-----------KKLRSVKQASDLSLIDKESDDVLERIMDEKTASEL 537

Query: 476 RTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
           + L GH        F P   +  S S D  +++W ++   C+  YKGH   +   +F+P 
Sbjct: 538 KILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPY 597

Query: 656 GRWVV 670
           G + V
Sbjct: 598 GYYFV 602



>sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit
           5 (Transcription initiation factor TFIID 100 kDa
           subunit) (TAF(II)100) (TAFII-100)
           (TAFII100).>gb:HSU80191_2026400 Human TFIID subunit
           TAFII100 mRNA, complete cds.
          Length = 800

 Score = 83.2 bits (204), Expect = 4e-15
 Identities = 42/124 (33%), Positives = 60/124 (48%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           L+ F  H  +VNC RF   +     TG  D +V LW +         +GH  P+ S+ F 
Sbjct: 620 LRIFAGHLADVNCTRFHPNS-NYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFS 678

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                +A G++ G + LWD+    M+  L GH     +L F   GE  ASGSMD  +++W
Sbjct: 679 PNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLW 738

Query: 578 DIRK 589
           D  K
Sbjct: 739 DAIK 742



 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 42/155 (27%), Positives = 70/155 (45%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           K   +L+    HSG V    F        L+  +D +V LWS+   T      GH  PV 
Sbjct: 531 KTASELKILYGHSGPVYGASFSPDR-NYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVW 589

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
              F        +G    + +LW  +  + +R  +GH +      FHP   + A+GS D 
Sbjct: 590 DTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADR 649

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            +++WD+    C+  + GH   I ++ F+P+GR++
Sbjct: 650 TVRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFL 684



 Score = 79.7 bits (195), Expect = 4e-14
 Identities = 39/124 (31%), Positives = 62/124 (50%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F++GG D    LW+          +GH + V    F      VA GS+   ++LWD+ + 
Sbjct: 600 FVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRFHPNSNYVATGSADRTVRLWDVLNG 659

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
             +R  +GH+    +L F P G F A+G+ D  + +WDI     +   KGHT  + ++RF
Sbjct: 660 NCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRF 719

Query: 647 TPDG 658
           + DG
Sbjct: 720 SRDG 723



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 29/125 (23%), Positives = 51/125 (40%)
 Frame = +2

Query: 296 GGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMI 475
           G  D +V +WS+               + S+   S   L+   S   L ++ D +    +
Sbjct: 488 GFADSTVRVWSVTP-----------KKLRSVKQASDLSLIDKESDDVLERIMDEKTASEL 536

Query: 476 RTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
           + L GH        F P   +  S S D  +++W ++   C+  YKGH   +   +F+P 
Sbjct: 537 KILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPY 596

Query: 656 GRWVV 670
           G + V
Sbjct: 597 GYYFV 601



>gb:BC089247_2566129 Xenopus laevis cDNA clone MGC:85213
           IMAGE:3378142, complete cds.
          Length = 415

 Score = 82.8 bits (203), Expect = 5e-15
 Identities = 46/149 (30%), Positives = 68/149 (45%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +L     H   V  ++F         TG  D +  LWS        T  GHT+ +  +
Sbjct: 124 GEELHTLEGHRNVVYAIQFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCL 183

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            F+    L+A GS     KLWD++  +   TLSGH +   +L F+  G+   +GS D  +
Sbjct: 184 VFNPQSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFNTTGDRLITGSFDHTV 243

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
            +W+I     IHT  GH   IS+ +F  D
Sbjct: 244 SVWEIPSGRRIHTLIGHRGEISSAQFNWD 272



 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 44/156 (28%), Positives = 74/156 (47%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A+ G     F  H+  + CL F  ++  +  TG  D +  LW I       TLSGH + +
Sbjct: 164 AETGKCYHTFRGHTAEIVCLVFNPQST-LIATGSMDTTAKLWDIQSGEEALTLSGHAAEI 222

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
            S++F++    +  GS    + +W++   + I TL GHR   ++ +F+      A+ SMD
Sbjct: 223 ISLSFNTTGDRLITGSFDHTVSVWEIPSGRRIHTLIGHRGEISSAQFNWDCSLIATASMD 282

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            + K+WD     C+ T  GH   +  + F   G+ V
Sbjct: 283 KSCKLWDSLNGKCVATLTGHDDEVLDVTFDSTGQLV 318



 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 41/154 (26%), Positives = 67/154 (43%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G ++   + H G ++  +F    C +  T   D S  LW        +TL+GH   V  +
Sbjct: 251 GRRIHTLIGHRGEISSAQFNWD-CSLIATASMDKSCKLWDSLNGKCVATLTGHDDEVLDV 309

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            FDS   LVA  S+ G  +++     K +  L GH    + + F+  G    + S D   
Sbjct: 310 TFDSTGQLVATASADGTARVYSASSRKCLAKLEGHEGEISKICFNAQGNRIVTASSDKTS 369

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           ++WD     C+   KGHT  I +  F  +G  ++
Sbjct: 370 RLWDPHTGECLQVLKGHTDEIFSCAFNYEGNTII 403



 Score = 74.7 bits (182), Expect = 1e-12
 Identities = 43/130 (33%), Positives = 59/130 (45%), Gaps = 1/130 (0%)
 Frame = +2

Query: 272 KTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE-ILVAAGSSSGLIKL 448
           K+   F+TG  D +  +W         TL GH + V +I F++     +A GS     KL
Sbjct: 102 KSGSSFITGSYDRTCKVWDTASGEELHTLEGHRNVVYAIQFNNPYGDKIATGSFDKTCKL 161

Query: 449 WDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRG 628
           W  E  K   T  GH +    L F+P     A+GSMDT  K+WDI+      T  GH   
Sbjct: 162 WSAETGKCYHTFRGHTAEIVCLVFNPQSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAE 221

Query: 629 ISTIRFTPDG 658
           I ++ F   G
Sbjct: 222 IISLSFNTTG 231



 Score = 73.6 bits (179), Expect = 3e-12
 Identities = 43/145 (29%), Positives = 66/145 (45%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H+  +  L F     R+ +TG  DH+V++W I       TL GH   + S  F+    L+
Sbjct: 218 HAAEIISLSFNTTGDRL-ITGSFDHTVSVWEIPSGRRIHTLIGHRGEISSAQFNWDCSLI 276

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
           A  S     KLWD  + K + TL+GH      + F   G+  A+ S D   +++    + 
Sbjct: 277 ATASMDKSCKLWDSLNGKCVATLTGHDDEVLDVTFDSTGQLVATASADGTARVYSASSRK 336

Query: 596 CIHTYKGHTRGISTIRFTPDGRWVV 670
           C+   +GH   IS I F   G  +V
Sbjct: 337 CLAKLEGHEGEISKICFNAQGNRIV 361



 Score = 72.4 bits (176), Expect = 7e-12
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 1/100 (1%)
 Frame = +2

Query: 356 LSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEF-HPFG 532
           L  H  P+ ++AF+ +      GS     K+WD    + + TL GHR+   A++F +P+G
Sbjct: 88  LRAHILPLTNVAFNKSGSSFITGSYDRTCKVWDTASGEELHTLEGHRNVVYAIQFNNPYG 147

Query: 533 EFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           +  A+GS D   K+W      C HT++GHT  I  + F P
Sbjct: 148 DKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLVFNP 187



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 18/59 (30%), Positives = 28/59 (47%)
 Frame = +2

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
           + + L  H    T + F+  G  F +GS D   K+WD      +HT +GH   +  I+F
Sbjct: 84  LFKVLRAHILPLTNVAFNKSGSSFITGSYDRTCKVWDTASGEELHTLEGHRNVVYAIQF 142



>gb:BC084093_2563499 Xenopus laevis hypothetical LOC495006, mRNA
           (cDNA clone MGC:82751 IMAGE:5156321), complete cds.
          Length = 517

 Score = 82.8 bits (203), Expect = 5e-15
 Identities = 37/119 (31%), Positives = 60/119 (50%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F+TG  D ++ +W +       +L+GH S V  +        + +      +K WDLE  
Sbjct: 222 FVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSGRSPYLFSCGEDKQVKCWDLEYN 281

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
           K+IR   GH S    L+ HP  +   + S D+  +IWD+R K  +HT  GHT  ++T++
Sbjct: 282 KVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKASVHTLVGHTNAVATVK 340



 Score = 72.4 bits (176), Expect = 7e-12
 Identities = 42/128 (32%), Positives = 60/128 (46%)
 Frame = +2

Query: 275 TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           T  + +T   D +  +W +    S  TL GHT+ V ++   +AE  +  GS    I+LWD
Sbjct: 302 TIDVLVTCSRDSTARIWDVRTKASVHTLVGHTNAVATVKCQAAEPQIITGSHDTTIRLWD 361

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
           +   K   TL+ H+    A+  HP    FASGS D N+K W       I    GH   I+
Sbjct: 362 MVGGKTRVTLTNHKKSVRAVVLHPRQYTFASGSPD-NVKQWKFPDGNFIQNLSGHNAIIN 420

Query: 635 TIRFTPDG 658
           T+    DG
Sbjct: 421 TLAVNSDG 428



 Score = 42.4 bits (98), Expect = 0.007
 Identities = 21/59 (35%), Positives = 32/59 (54%)
 Frame = +2

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
           K+ R +SGH  +  +L   P  ++F +GS D  +KIWD+       +  GH   IST+R
Sbjct: 198 KLYRVISGHLGWVRSLAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGH---ISTVR 253



>gb:BC056099_2551681 Xenopus laevis hypothetical protein MGC69111,
           mRNA (cDNA clone MGC:69111 IMAGE:5047563), complete cds.
          Length = 399

 Score = 82.8 bits (203), Expect = 5e-15
 Identities = 40/148 (27%), Positives = 74/148 (50%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           F AH+G V  + F     +  +T  DD ++ +W++ +     +L+ H + V    F    
Sbjct: 56  FKAHTGTVRSVSFSGDG-QSLVTASDDKTIKVWTVHRQKFLFSLNQHINWVRCAKFSPDG 114

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            L+ + S    IKLWD    + I++   H  +   ++FHP G   A+ + D  +K+WDIR
Sbjct: 115 RLIVSASDDKTIKLWDKTSRECIQSFCEHGGFVNFVDFHPSGTCIAAAATDNTVKVWDIR 174

Query: 587 KKGCIHTYKGHTRGISTIRFTPDGRWVV 670
               I  Y+ H+  ++++ F P G +++
Sbjct: 175 MNKLIQHYQVHSGVVNSLSFHPSGNYLI 202



 Score = 73.2 bits (178), Expect = 4e-12
 Identities = 35/141 (24%), Positives = 67/141 (47%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H   V C +F     R+ ++  DD ++ LW         +   H   V  + F  +   +
Sbjct: 101 HINWVRCAKFSPDG-RLIVSASDDKTIKLWDKTSRECIQSFCEHGGFVNFVDFHPSGTCI 159

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
           AA ++   +K+WD+   K+I+    H     +L FHP G +  + S D+ LK+ D+ +  
Sbjct: 160 AAAATDNTVKVWDIRMNKLIQHYQVHSGVVNSLSFHPSGNYLITASNDSTLKVLDLLEGR 219

Query: 596 CIHTYKGHTRGISTIRFTPDG 658
            ++T  GH   ++ ++F+ +G
Sbjct: 220 LLYTLHGHQGPVTCVKFSREG 240



 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 36/152 (23%), Positives = 63/152 (41%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           K   +   FV H   +  + F      +  +   D +V LW       ++    HT  V 
Sbjct: 6   KTQMRAYRFVGHKDAILSVDFSPSG-HLIASASRDKTVRLWVPSVKGESTAFKAHTGTVR 64

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
           S++F      +   S    IK+W +   K + +L+ H ++    +F P G    S S D 
Sbjct: 65  SVSFSGDGQSLVTASDDKTIKVWTVHRQKFLFSLNQHINWVRCAKFSPDGRLIVSASDDK 124

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
            +K+WD   + CI ++  H   ++ + F P G
Sbjct: 125 TIKLWDKTSRECIQSFCEHGGFVNFVDFHPSG 156



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 35/121 (28%), Positives = 58/121 (47%), Gaps = 1/121 (0%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKK-TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAF 394
           +Q F  H G VN + F    TC        D++V +W I           H+  V S++F
Sbjct: 137 IQSFCEHGGFVNFVDFHPSGTC--IAAAATDNTVKVWDIRMNKLIQHYQVHSGVVNSLSF 194

Query: 395 DSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI 574
             +   +   S+   +K+ DL + +++ TL GH+   T ++F   G+FFASG  D  + +
Sbjct: 195 HPSGNYLITASNDSTLKVLDLLEGRLLYTLHGHQGPVTCVKFSREGDFFASGGSDEQVMV 254

Query: 575 W 577
           W
Sbjct: 255 W 255



 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 24/117 (20%), Positives = 49/117 (41%)
 Frame = +2

Query: 320 LWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRS 499
           +W++          GH   + S+ F  +  L+A+ S    ++LW             H  
Sbjct: 2   VWNMKTQMRAYRFVGHKDAILSVDFSPSGHLIASASRDKTVRLWVPSVKGESTAFKAHTG 61

Query: 500 YCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
              ++ F   G+   + S D  +K+W + ++  + +   H   +   +F+PDGR +V
Sbjct: 62  TVRSVSFSGDGQSLVTASDDKTIKVWTVHRQKFLFSLNQHINWVRCAKFSPDGRLIV 118



>gb:AY422998_2532084 Danio rerio TUWD12 (TUWD12) mRNA, complete cds.
          Length = 490

 Score = 82.8 bits (203), Expect = 5e-15
 Identities = 43/148 (29%), Positives = 71/148 (47%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           F AH+ +V  + F +   R+ +T  DD SV +W + +     +L+ HT+ V    F    
Sbjct: 98  FKAHTASVRSVNFSRDGQRL-VTASDDKSVKVWGVERKKFLYSLNRHTNWVRCARFSPDG 156

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            L+A+      ++LWD    + I   + +    T ++F+  G   AS   D  +KIWDIR
Sbjct: 157 RLIASCGDDRTVRLWDTSSHQCINIFTDYGGSATFVDFNSSGTCIASSGADNTIKIWDIR 216

Query: 587 KKGCIHTYKGHTRGISTIRFTPDGRWVV 670
               I  YK H  G++   F P G +++
Sbjct: 217 TNKLIQHYKVHNAGVNCFSFHPSGNYLI 244



 Score = 82.4 bits (202), Expect = 6e-15
 Identities = 41/141 (29%), Positives = 68/141 (48%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H+  V C RF     R+  + GDD +V LW        +  + +      + F+S+   +
Sbjct: 143 HTNWVRCARFSPDG-RLIASCGDDRTVRLWDTSSHQCINIFTDYGGSATFVDFNSSGTCI 201

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
           A+  +   IK+WD+   K+I+    H +      FHP G +  SGS D+ +KI D+ +  
Sbjct: 202 ASSGADNTIKIWDIRTNKLIQHYKVHNAGVNCFSFHPSGNYLISGSSDSTIKILDLLEGR 261

Query: 596 CIHTYKGHTRGISTIRFTPDG 658
            I+T  GH   + T+ F+ DG
Sbjct: 262 LIYTLHGHKGPVLTVTFSRDG 282



 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 35/149 (23%), Positives = 65/149 (43%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           + F  H   ++C  F     +   TG  D S+ +W++          GHT  +  + F  
Sbjct: 12  RHFKGHKDVISCADFNPNN-KQLATGSCDKSLMIWNLAPKARAFRFVGHTDVITGVNFAP 70

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
           +  LVA+ S    ++LW             H +   ++ F   G+   + S D ++K+W 
Sbjct: 71  SGSLVASSSRDQTVRLWTPSIKGESTVFKAHTASVRSVNFSRDGQRLVTASDDKSVKVWG 130

Query: 581 IRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           + +K  +++   HT  +   RF+PDGR +
Sbjct: 131 VERKKFLYSLNRHTNWVRCARFSPDGRLI 159



 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 32/144 (22%), Positives = 60/144 (41%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           FV H+  +  + F      +  +   D +V LW+      ++    HT+ V S+ F    
Sbjct: 56  FVGHTDVITGVNFAPSGS-LVASSSRDQTVRLWTPSIKGESTVFKAHTASVRSVNFSRDG 114

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
             +   S    +K+W +E  K + +L+ H ++     F P G   AS   D  +++WD  
Sbjct: 115 QRLVTASDDKSVKVWGVERKKFLYSLNRHTNWVRCARFSPDGRLIASCGDDRTVRLWDTS 174

Query: 587 KKGCIHTYKGHTRGISTIRFTPDG 658
              CI+ +  +    + + F   G
Sbjct: 175 SHQCINIFTDYGGSATFVDFNSSG 198



 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 30/111 (27%), Positives = 47/111 (42%)
 Frame = +2

Query: 338 PTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALE 517
           PT      GH   +    F+     +A GS    + +W+L          GH    T + 
Sbjct: 8   PTLERHFKGHKDVISCADFNPNNKQLATGSCDKSLMIWNLAPKARAFRFVGHTDVITGVN 67

Query: 518 FHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           F P G   AS S D  +++W    KG    +K HT  + ++ F+ DG+ +V
Sbjct: 68  FAPSGSLVASSSRDQTVRLWTPSIKGESTVFKAHTASVRSVNFSRDGQRLV 118



 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 32/118 (27%), Positives = 55/118 (46%), Gaps = 1/118 (0%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKK-TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSA 403
           F  + G+   + F    TC    + G D+++ +W I           H + V   +F  +
Sbjct: 182 FTDYGGSATFVDFNSSGTC--IASSGADNTIKIWDIRTNKLIQHYKVHNAGVNCFSFHPS 239

Query: 404 EILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
              + +GSS   IK+ DL + ++I TL GH+     + F   G+ FASG  D+ + +W
Sbjct: 240 GNYLISGSSDSTIKILDLLEGRLIYTLHGHKGPVLTVTFSRDGDLFASGGADSQVLMW 297



 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 23/71 (32%), Positives = 37/71 (52%)
 Frame = +2

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
           +ED  + R   GH+   +  +F+P  +  A+GS D +L IW++  K     + GHT  I+
Sbjct: 5   MEDPTLERHFKGHKDVISCADFNPNNKQLATGSCDKSLMIWNLAPKARAFRFVGHTDVIT 64

Query: 635 TIRFTPDGRWV 667
            + F P G  V
Sbjct: 65  GVNFAPSGSLV 75



>gb:AY391450_2531586 Danio rerio pleiotropic regulator 1 (PLRG1)
           mRNA, complete cds.
          Length = 510

 Score = 82.8 bits (203), Expect = 5e-15
 Identities = 38/119 (31%), Positives = 60/119 (50%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F+TG  D ++ +W +       +L+GH S V  +A  +    + +      +K WDLE  
Sbjct: 216 FVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVAVSNRSPYLFSCGEDKQVKCWDLEYN 275

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
           K IR   GH S    L+ HP  +   + S D   ++WDIR K  +HT  GHT  ++T++
Sbjct: 276 KFIRHYHGHLSAVYDLDLHPTIDVLVTCSRDATARVWDIRTKANVHTLSGHTNTVATVK 334



 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 45/122 (36%), Positives = 59/122 (48%)
 Frame = +2

Query: 275 TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           T  + +T   D +  +W I    +  TLSGHT+ V ++   SAE  V  GS    I+LWD
Sbjct: 296 TIDVLVTCSRDATARVWDIRTKANVHTLSGHTNTVATVKCQSAEPQVVTGSHDTTIRLWD 355

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
           L   K   TL+ H+    AL  HP    FASGS D N+K W       I    GH   I+
Sbjct: 356 LVAGKTRATLTNHKKSVRALVLHPRQYTFASGSPD-NIKQWKFPDGNFIQNLSGHNAIIN 414

Query: 635 TI 640
           T+
Sbjct: 415 TL 416



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 20/59 (33%), Positives = 32/59 (54%)
 Frame = +2

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
           K+ R +SGH  +  ++   P  ++F +GS D  +KIWD+       +  GH   IST+R
Sbjct: 192 KLYRVISGHLGWVRSIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGH---ISTVR 247



>gb:CR380956_1652130 Candida glabrata strain CBS138 chromosome J
           complete sequence.
          Length = 517

 Score = 82.8 bits (203), Expect = 5e-15
 Identities = 44/149 (29%), Positives = 72/149 (48%), Gaps = 8/149 (5%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H   + C  F   T    +TGG D++  +W     T   TL+GH + V  +++ +   ++
Sbjct: 144 HGATILCSAFAPHTSSRVVTGGGDNTARIWDCDTQTPKVTLNGHRNWVLCVSWSADGEVI 203

Query: 416 AAGSSSGLIKLWDLEDTKMI-RTLSGHRSYCTALEFHPF-------GEFFASGSMDTNLK 571
           A GS    I+LWD E  K +   L GH  + T+L + P            AS S D  ++
Sbjct: 204 ATGSMDNTIRLWDAESGKPLGDALRGHSKWITSLTWEPIHLVEPGSKPRLASASKDGTIR 263

Query: 572 IWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           IWD  ++ C+ T  GHT  +S +++  +G
Sbjct: 264 IWDSSRRVCLMTLGGHTNSVSCVKWGGEG 292



 Score = 62.0 bits (149), Expect = 9e-09
 Identities = 36/129 (27%), Positives = 61/129 (47%), Gaps = 1/129 (0%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTST-STLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
           + +T  DD ++ LW+  K T   S ++GH   V  +AF      + + S    IKLWD +
Sbjct: 375 LMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWDGK 434

Query: 461 DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
           +   + T  GH +    + +        S S DT LK+WD++ +       GH   + T+
Sbjct: 435 EGTFLSTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTV 494

Query: 641 RFTPDGRWV 667
            ++ DG+ V
Sbjct: 495 DWSVDGKRV 503



 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 26/90 (28%), Positives = 49/90 (54%), Gaps = 1/90 (1%)
 Frame = +2

Query: 404 EILVAAGSSSGLIKLWD-LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
           E L+   S    + LW+ L+ TK I  ++GH+     + F P G++  S S D ++K+WD
Sbjct: 373 EELMVTASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSPDGKYIVSASFDNSIKLWD 432

Query: 581 IRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            ++   + T++GH   +  + ++ D R +V
Sbjct: 433 GKEGTFLSTFRGHVASVYQVAWSSDCRLLV 462



 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 30/120 (25%), Positives = 56/120 (46%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           +     H   VN + F     +  ++   D+S+ LW   + T  ST  GH + V  +A+ 
Sbjct: 397 ISRMTGHQKLVNHVAFSPDG-KYIVSASFDNSIKLWDGKEGTFLSTFRGHVASVYQVAWS 455

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
           S   L+ + S    +K+WD++  K+   L GH+     +++   G+   SG  D  +++W
Sbjct: 456 SDCRLLVSCSKDTTLKVWDVKTRKLSVDLPGHQDEVYTVDWSVDGKRVCSGGKDKMMRLW 515



 Score = 37.7 bits (86), Expect = 0.18
 Identities = 33/163 (20%), Positives = 61/163 (37%), Gaps = 41/163 (25%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDL-EDTKMIRT 481
           D ++ +W   +     TL GHT+ V  + +    IL  +GS    ++ WD+ ++ K I  
Sbjct: 259 DGTIRIWDSSRRVCLMTLGGHTNSVSCVKWGGEGILY-SGSHDKTVRAWDMKQNGKCINI 317

Query: 482 LSGHRSYCT--------ALEFHPFG-------------------------------EFFA 544
           L  H  +          AL    F                                E   
Sbjct: 318 LKSHAHWVNHLSLSTDYALRVGAFDYTGVKPANAKEARDKALQNYEKVARKNGKHEELMV 377

Query: 545 SGSMDTNLKIWD-IRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           + S D  + +W+ ++    I    GH + ++ + F+PDG+++V
Sbjct: 378 TASDDFTMFLWNPLKGTKPISRMTGHQKLVNHVAFSPDGKYIV 420



>gb:AF319658_1418326 Sus scrofa platelet-activating factor
           acetylhydrolase Ib-alpha subunit mRNA, complete cds.
          Length = 410

 Score = 82.8 bits (203), Expect = 5e-15
 Identities = 37/125 (29%), Positives = 67/125 (53%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  +D ++ +W         TL GHT  V+ I+FD +  L+A+ S+   IKLWD + 
Sbjct: 122 VMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQG 181

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
            + IRT+ GH    +++   P G+   S + D  +K+W+++   C+ T+ GH   +  +R
Sbjct: 182 FECIRTMHGHDHNVSSVAIMPNGDHIVSAARDKTIKMWEVQTGYCVKTFTGHREWVRMVR 241

Query: 644 FTPDG 658
              DG
Sbjct: 242 PNQDG 246



 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 39/114 (34%), Positives = 55/114 (48%)
 Frame = +2

Query: 329 IGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           I +P     LSGH SPV  + F     ++ + S    IK+WD E     RTL GH     
Sbjct: 95  IPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQ 154

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + F   G+  AS S D  +K+WD +   CI T  GH   +S++   P+G  +V
Sbjct: 155 DISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIV 208



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 26/99 (26%), Positives = 54/99 (54%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           L+G  D ++ +W +       TL GH + V  + F S    + + +    +++WD ++ +
Sbjct: 312 LSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKR 371

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            ++TL+ H  + T+L+FH    +  +GS+D  +K+W+ R
Sbjct: 372 CMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR 410



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 40/174 (22%), Positives = 72/174 (41%), Gaps = 20/174 (11%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           GY ++ F  H   V  +R   +   +  +  +D +V +W +      + L  H   VE I
Sbjct: 224 GYCVKTFTGHREWVRMVR-PNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECI 282

Query: 389 AFDSAEI--------------------LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           ++                          + +GS    IK+WD+     + TL GH ++  
Sbjct: 283 SWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVR 342

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + FH  G+F  S + D  L++WD + K C+ T   H   ++++ F     +VV
Sbjct: 343 GVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVV 396



 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 27/120 (22%), Positives = 53/120 (44%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D ++ LW         T+ GH   V S+A       + + +    IK+W+++    ++T 
Sbjct: 171 DMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSAARDKTIKMWEVQTGYCVKTF 230

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
           +GHR +   +  +  G   AS S D  +++W +  K C    + H   +  I + P+  +
Sbjct: 231 TGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSY 290



 Score = 32.7 bits (73), Expect = 5.9
 Identities = 21/82 (25%), Positives = 32/82 (39%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L   V H   V  + F     +  L+  DD ++ +W         TL+ H   V S+
Sbjct: 328 GMCLMTLVGHDNWVRGVLFHSGG-KFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSL 386

Query: 389 AFDSAEILVAAGSSSGLIKLWD 454
            F      V  GS    +K+W+
Sbjct: 387 DFHKTAPYVVTGSVDQTVKVWE 408



>gb:DDI512336_1376967 Dictyostelium discoideum mRNA for LIS1
           protein.>gb:DDI512794_1376968 Dictyostelium discoideum
           mRNA for LIS1 protein.
          Length = 419

 Score = 82.8 bits (203), Expect = 5e-15
 Identities = 37/111 (33%), Positives = 58/111 (52%)
 Frame = +2

Query: 326 SIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYC 505
           ++ +P     L+GH + + S+ F  +  L+ + S    IK+WD E  +  RTL GH +  
Sbjct: 92  ALPRPPEKHILTGHRNCINSVKFHPSFSLMVSASEDATIKVWDFESGEFERTLKGHTNAV 151

Query: 506 TALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
             ++F   G   AS S D  +K+WD +   C+ T  GH   +S +RFTP G
Sbjct: 152 QDIDFDKTGNLLASCSADLTIKLWDFQTYDCVKTLHGHDHNVSCVRFTPSG 202



 Score = 82.0 bits (201), Expect = 8e-15
 Identities = 43/142 (30%), Positives = 70/142 (49%), Gaps = 2/142 (1%)
 Frame = +2

Query: 239 SGNVNCLRFGK--KTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEIL 412
           +G+ NC+   K   +  + ++  +D ++ +W         TL GHT+ V+ I FD    L
Sbjct: 103 TGHRNCINSVKFHPSFSLMVSASEDATIKVWDFESGEFERTLKGHTNAVQDIDFDKTGNL 162

Query: 413 VAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKK 592
           +A+ S+   IKLWD +    ++TL GH    + + F P G+   S S D  +K+W+    
Sbjct: 163 LASCSADLTIKLWDFQTYDCVKTLHGHDHNVSCVRFTPSGDQLISSSRDKTIKVWEAATG 222

Query: 593 GCIHTYKGHTRGISTIRFTPDG 658
            CI T  GH   +  I  + DG
Sbjct: 223 YCIKTLVGHEDWVRKITVSEDG 244



 Score = 69.3 bits (168), Expect = 6e-11
 Identities = 48/181 (26%), Positives = 78/181 (43%), Gaps = 32/181 (17%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKK-TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSP 376
           A  GY ++  V H   V  +   +  +C    +  +D ++  W+I K    +T   H+  
Sbjct: 219 AATGYCIKTLVGHEDWVRKITVSEDGSC--IASCSNDQTIKTWNIVKGECLATYREHSHV 276

Query: 377 VESIAFDSAEIL------------------------------VAAGSSSGLIKLWDLEDT 466
           VE +AF +A I+                              +A GS    IK+W+L   
Sbjct: 277 VECLAFSTANIIDIPGSLLSTPEGKSKVKQGPGGNLVGQCGYLATGSRDKTIKIWELATG 336

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTY-KGHTRGISTIR 643
           + + T  GH ++  A+ FHP G+F  S   D  +++WDI +  CI T  + HT  IS + 
Sbjct: 337 RCLATYIGHDNWVRAVRFHPCGKFLLSVGDDKTIRVWDIAQGRCIKTINEAHTHFISCLD 396

Query: 644 F 646
           F
Sbjct: 397 F 397



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 41/175 (23%), Positives = 70/175 (40%), Gaps = 30/175 (17%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H  NV+C+RF     ++ ++   D ++ +W         TL GH   V  I        +
Sbjct: 189 HDHNVSCVRFTPSGDQL-ISSSRDKTIKVWEAATGYCIKTLVGHEDWVRKITVSEDGSCI 247

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFH--------------PFGE------ 535
           A+ S+   IK W++   + + T   H      L F               P G+      
Sbjct: 248 ASCSNDQTIKTWNIVKGECLATYREHSHVVECLAFSTANIIDIPGSLLSTPEGKSKVKQG 307

Query: 536 ----------FFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
                     + A+GS D  +KIW++    C+ TY GH   +  +RF P G++++
Sbjct: 308 PGGNLVGQCGYLATGSRDKTIKIWELATGRCLATYIGHDNWVRAVRFHPCGKFLL 362



 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 23/104 (22%), Positives = 49/104 (47%), Gaps = 1/104 (0%)
 Frame = +2

Query: 278 CRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDL 457
           C    TG  D ++ +W +      +T  GH + V ++ F      + +      I++WD+
Sbjct: 316 CGYLATGSRDKTIKIWELATGRCLATYIGHDNWVRAVRFHPCGKFLLSVGDDKTIRVWDI 375

Query: 458 EDTKMIRTLS-GHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
              + I+T++  H  + + L+F       A+G +D  +K+W ++
Sbjct: 376 AQGRCIKTINEAHTHFISCLDFCLHNPHIATGGVDDVIKVWKLQ 419



>gb:CR857562_1181788 Pongo pygmaeus mRNA; cDNA DKFZp469J1511 (from
           clone DKFZp469J1511).
          Length = 410

 Score = 82.8 bits (203), Expect = 5e-15
 Identities = 37/125 (29%), Positives = 66/125 (52%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  +D ++ +W         TL GHT  ++ I FD +  L+A+ S+   IKLWD + 
Sbjct: 122 VMVSASEDATIKVWDYETGDFERTLKGHTDSIQDIPFDHSGKLLASCSADMTIKLWDFQG 181

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
            + IRT+ GH    +++   P G+   S S D  +K+W+++   C+ T+ GH   +  +R
Sbjct: 182 FECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVR 241

Query: 644 FTPDG 658
              DG
Sbjct: 242 PNQDG 246



 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 39/114 (34%), Positives = 55/114 (48%)
 Frame = +2

Query: 329 IGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           I +P     LSGH SPV  + F     ++ + S    IK+WD E     RTL GH     
Sbjct: 95  IPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSIQ 154

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + F   G+  AS S D  +K+WD +   CI T  GH   +S++   P+G  +V
Sbjct: 155 DIPFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIV 208



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 26/99 (26%), Positives = 54/99 (54%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           L+G  D ++ +W +       TL GH + V  + F S    + + +    +++WD ++ +
Sbjct: 312 LSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKR 371

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            ++TL+ H  + T+L+FH    +  +GS+D  +K+W+ R
Sbjct: 372 CMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR 410



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 40/174 (22%), Positives = 72/174 (41%), Gaps = 20/174 (11%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           GY ++ F  H   V  +R   +   +  +  +D +V +W +      + L  H   VE I
Sbjct: 224 GYCVKTFTGHREWVRMVR-PNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECI 282

Query: 389 AFDSAEI--------------------LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           ++                          + +GS    IK+WD+     + TL GH ++  
Sbjct: 283 SWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVR 342

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + FH  G+F  S + D  L++WD + K C+ T   H   ++++ F     +VV
Sbjct: 343 GVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVV 396



 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 28/120 (23%), Positives = 53/120 (44%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D ++ LW         T+ GH   V S+A       + + S    IK+W+++    ++T 
Sbjct: 171 DMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTF 230

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
           +GHR +   +  +  G   AS S D  +++W +  K C    + H   +  I + P+  +
Sbjct: 231 TGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSY 290



 Score = 32.7 bits (73), Expect = 5.9
 Identities = 21/82 (25%), Positives = 32/82 (39%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L   V H   V  + F     +  L+  DD ++ +W         TL+ H   V S+
Sbjct: 328 GMCLMTLVGHDNWVRGVLFHSGG-KFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSL 386

Query: 389 AFDSAEILVAAGSSSGLIKLWD 454
            F      V  GS    +K+W+
Sbjct: 387 DFHKTAPYVVTGSVDQTVKVWE 408



>gb:AK007246_1153889 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:1700123D08
           product:hypothetical protein, full insert
           sequence.>gb:AK077027_1171624 Mus musculus adult male
           testis cDNA, RIKEN full-length enriched library,
           clone:4932415P20 product:hypothetical protein, full
           insert sequence.
          Length = 303

 Score = 82.8 bits (203), Expect = 5e-15
 Identities = 45/139 (32%), Positives = 64/139 (46%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H G VNC  F     R  LT  DD  V +W          L+GH  PV+S  F     L+
Sbjct: 25  HHGEVNCSAFSPDG-RTLLTASDDGCVYVWGTKSGRLLWRLAGHRGPVKSCCFSPDGRLI 83

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
           A+ SS   I+LWD+  +K +  L GH+     + F P  +  ASG  D    +W+++   
Sbjct: 84  ASSSSDHSIRLWDVARSKCLHVLKGHQRSVETVSFSPDSKQLASGGWDKRAIVWEVQSGR 143

Query: 596 CIHTYKGHTRGISTIRFTP 652
            +H   GH   I +  F+P
Sbjct: 144 RVHLLVGHCDSIQSSDFSP 162



 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 42/155 (27%), Positives = 70/155 (45%), Gaps = 3/155 (1%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           K G  L     H G V    F     R+  +   DHS+ LW + +      L GH   VE
Sbjct: 56  KSGRLLWRLAGHRGPVKSCCFSPDG-RLIASSSSDHSIRLWDVARSKCLHVLKGHQRSVE 114

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
           +++F      +A+G       +W+++  + +  L GH     + +F P  +  A+GS D+
Sbjct: 115 TVSFSPDSKQLASGGWDKRAIVWEVQSGRRVHLLVGHCDSIQSSDFSPTSDSLATGSWDS 174

Query: 563 NLKIWDIRKKGCI---HTYKGHTRGISTIRFTPDG 658
            + IWD+R    +   H  +GHT  IS + ++  G
Sbjct: 175 TVHIWDLRASTPVVSYHNLEGHTGNISCLCYSASG 209



 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 30/99 (30%), Positives = 50/99 (50%)
 Frame = +2

Query: 365 HTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFA 544
           H   V   AF      +   S  G + +W  +  +++  L+GHR    +  F P G   A
Sbjct: 25  HHGEVNCSAFSPDGRTLLTASDDGCVYVWGTKSGRLLWRLAGHRGPVKSCCFSPDGRLIA 84

Query: 545 SGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
           S S D ++++WD+ +  C+H  KGH R + T+ F+PD +
Sbjct: 85  SSSSDHSIRLWDVARSKCLHVLKGHQRSVETVSFSPDSK 123



 Score = 64.7 bits (156), Expect = 1e-09
 Identities = 45/157 (28%), Positives = 67/157 (42%), Gaps = 3/157 (1%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPT---STSTLSGHTSPV 379
           G ++   V H  ++    F   T     TG  D +V++W +   T   S   L GHT  +
Sbjct: 142 GRRVHLLVGHCDSIQSSDFSP-TSDSLATGSWDSTVHIWDLRASTPVVSYHNLEGHTGNI 200

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             + + SA  L+A+GS    I +W      +   L GH  +  +L F P     AS    
Sbjct: 201 SCLCY-SASGLLASGSWDKTICVWKPTTNNLPLQLKGHTIWVNSLAFSPDELKLASAGYS 259

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
             +K+WD     C+ T KG         FTPDG+ +V
Sbjct: 260 RTVKVWDCLTGKCLETLKGMLDVAHACIFTPDGKLLV 296



 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 36/112 (32%), Positives = 56/112 (50%), Gaps = 3/112 (2%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTST---LSGHTSPVESIAFDSAE 406
           H+GN++CL +      +  +G  D ++ +W   KPT+ +    L GHT  V S+AF   E
Sbjct: 196 HTGNISCLCYSASG--LLASGSWDKTICVW---KPTTNNLPLQLKGHTIWVNSLAFSPDE 250

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
           + +A+   S  +K+WD    K + TL G      A  F P G+   SG+  T
Sbjct: 251 LKLASAGYSRTVKVWDCLTGKCLETLKGMLDVAHACIFTPDGKLLVSGAAVT 302



>gb:AB083321_1871858 Macaca fascicularis pafah1b1 mRNA for platelet
           activating factor acetylhydrolase Ib-alpha subunit,
           complete cds.
          Length = 410

 Score = 82.4 bits (202), Expect = 6e-15
 Identities = 37/125 (29%), Positives = 66/125 (52%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  +D ++ +W         TL GHT  V+ I+FD +  L+ + S+   IKLWD + 
Sbjct: 122 VMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLTSCSADMTIKLWDFQG 181

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
            + IRT+ GH    +++   P G+   S S D  +K+W+++   C+ T+ GH   +  +R
Sbjct: 182 FECIRTMHGHDHNVSSVAIMPNGDHLVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMVR 241

Query: 644 FTPDG 658
              DG
Sbjct: 242 PNQDG 246



 Score = 75.9 bits (185), Expect = 6e-13
 Identities = 38/114 (33%), Positives = 54/114 (47%)
 Frame = +2

Query: 329 IGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           I +P     LSGH SPV  + F     ++ + S    IK+WD E     RTL GH     
Sbjct: 95  IPRPPEKYALSGHRSPVTRVIFHPVFSVMVSASEDATIKVWDYETGDFERTLKGHTDSVQ 154

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + F   G+   S S D  +K+WD +   CI T  GH   +S++   P+G  +V
Sbjct: 155 DISFDHSGKLLTSCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHLV 208



 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 26/99 (26%), Positives = 54/99 (54%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           L+G  D ++ +W +       TL GH + V  + F S    + + +    +++WD ++ +
Sbjct: 312 LSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKR 371

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            ++TL+ H  + T+L+FH    +  +GS+D  +K+W+ R
Sbjct: 372 CMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR 410



 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 40/174 (22%), Positives = 72/174 (41%), Gaps = 20/174 (11%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           GY ++ F  H   V  +R   +   +  +  +D +V +W +      + L  H   VE I
Sbjct: 224 GYCVKTFTGHREWVRMVR-PNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECI 282

Query: 389 AFDSAEI--------------------LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           ++                          + +GS    IK+WD+     + TL GH ++  
Sbjct: 283 SWAPESSYSSISEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVR 342

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + FH  G+F  S + D  L++WD + K C+ T   H   ++++ F     +VV
Sbjct: 343 GVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVV 396



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 28/120 (23%), Positives = 53/120 (44%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D ++ LW         T+ GH   V S+A       + + S    IK+W+++    ++T 
Sbjct: 171 DMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHLVSASRDKTIKMWEVQTGYCVKTF 230

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
           +GHR +   +  +  G   AS S D  +++W +  K C    + H   +  I + P+  +
Sbjct: 231 TGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSY 290



 Score = 32.7 bits (73), Expect = 5.9
 Identities = 21/82 (25%), Positives = 32/82 (39%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L   V H   V  + F     +  L+  DD ++ +W         TL+ H   V S+
Sbjct: 328 GMCLMTLVGHDNWVRGVLFHSGG-KFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSL 386

Query: 389 AFDSAEILVAAGSSSGLIKLWD 454
            F      V  GS    +K+W+
Sbjct: 387 DFHKTAPYVVTGSVDQTVKVWE 408



>gb:AF323581_1786291 Podospora anserina beta transducin-like protein
            HET-E4s (het-e) gene, het-e4s allele, complete cds.
          Length = 1065

 Score = 82.4 bits (202), Expect = 6e-15
 Identities = 45/129 (34%), Positives = 61/129 (47%)
 Frame = +2

Query: 221  QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
            Q    H  +V  + F     R+  +G  D ++ +W     T T TL GH   V S+AF  
Sbjct: 835  QTLEGHGSSVLSVAFSPDGQRV-ASGSGDKTIKIWDTASGTGTQTLEGHGGSVWSVAFSP 893

Query: 401  AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
                VA+GS  G IK+WD       +TL GH  +  ++ F P G+  ASGS D  +KIWD
Sbjct: 894  DGQRVASGSIDGTIKIWDAASGTCTQTLEGHGGWVHSVAFSPDGQRVASGSSDNTIKIWD 953

Query: 581  IRKKGCIHT 607
                 C  T
Sbjct: 954  TASGTCTQT 962



 Score = 82.4 bits (202), Expect = 6e-15
 Identities = 43/107 (40%), Positives = 58/107 (54%)
 Frame = +2

Query: 347  TSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHP 526
            T TL GH S V S+AF      VA+GS    IK+WD       +TL GH     ++ F P
Sbjct: 834  TQTLEGHGSSVLSVAFSPDGQRVASGSGDKTIKIWDTASGTGTQTLEGHGGSVWSVAFSP 893

Query: 527  FGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
             G+  ASGS+D  +KIWD     C  T +GH   + ++ F+PDG+ V
Sbjct: 894  DGQRVASGSIDGTIKIWDAASGTCTQTLEGHGGWVHSVAFSPDGQRV 940



 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 33/105 (31%), Positives = 49/105 (46%), Gaps = 1/105 (0%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G   Q    H G+V  + F     R+  +G  D ++ +W     T T TL GH   V S+
Sbjct: 873  GTGTQTLEGHGGSVWSVAFSPDGQRV-ASGSIDGTIKIWDAASGTCTQTLEGHGGWVHSV 931

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLS-GHRSYCTALEF 520
            AF      VA+GSS   IK+WD       +TL+ G  + C + ++
Sbjct: 932  AFSPDGQRVASGSSDNTIKIWDTASGTCTQTLNVGSTATCLSFDY 976



 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 27/76 (35%), Positives = 40/76 (52%)
 Frame = +2

Query: 440  IKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGH 619
            I + + E     +TL GH S   ++ F P G+  ASGS D  +KIWD        T +GH
Sbjct: 823  ISVVEAEWNACTQTLEGHGSSVLSVAFSPDGQRVASGSGDKTIKIWDTASGTGTQTLEGH 882

Query: 620  TRGISTIRFTPDGRWV 667
               + ++ F+PDG+ V
Sbjct: 883  GGSVWSVAFSPDGQRV 898



>gb:AE017344_1756510 Cryptococcus neoformans var. neoformans JEC21
           chromosome 4, complete sequence.
          Length = 511

 Score = 82.4 bits (202), Expect = 6e-15
 Identities = 44/124 (35%), Positives = 60/124 (48%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F TGG +  V LWS+      STLSGHTS V  +AF  +   +A+    G  +LWD+E +
Sbjct: 239 FATGGGEGDVKLWSLSGEKPLSTLSGHTSRVGRLAFHPSGAYLASAGFDGTWRLWDVESS 298

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
           K +    GH     AL     G   ASG  D   ++WD+R         GH + I  + F
Sbjct: 299 KELMIQEGHSKEVYALGCQDDGALIASGGFDAIGRVWDLRTGRTAMVLDGHVKEILAMDF 358

Query: 647 TPDG 658
            P+G
Sbjct: 359 APNG 362



 Score = 68.9 bits (167), Expect = 7e-11
 Identities = 40/145 (27%), Positives = 61/145 (42%), Gaps = 8/145 (5%)
 Frame = +2

Query: 248 VNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTS--------PVESIAFDSA 403
           ++ +RF   + +  LT        LW +      ST  GHT         P  ++     
Sbjct: 177 LSTIRFSPSS-QYVLTTSWTGDTKLWDLPNLNPISTKRGHTEKVGGAAWHPFATVGASEE 235

Query: 404 EILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
            +  A G   G +KLW L   K + TLSGH S    L FHP G + AS   D   ++WD+
Sbjct: 236 AVNFATGGGEGDVKLWSLSGEKPLSTLSGHTSRVGRLAFHPSGAYLASAGFDGTWRLWDV 295

Query: 584 RKKGCIHTYKGHTRGISTIRFTPDG 658
                +   +GH++ +  +    DG
Sbjct: 296 ESSKELMIQEGHSKEVYALGCQDDG 320



 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 31/110 (28%), Positives = 49/110 (44%), Gaps = 8/110 (7%)
 Frame = +2

Query: 362 GHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEF- 538
           G   P+ +I F  +   V   S +G  KLWDL +   I T  GH        +HPF    
Sbjct: 172 GDDRPLSTIRFSPSSQYVLTTSWTGDTKLWDLPNLNPISTKRGHTEKVGGAAWHPFATVG 231

Query: 539 -------FASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
                  FA+G  + ++K+W +  +  + T  GHT  +  + F P G ++
Sbjct: 232 ASEEAVNFATGGGEGDVKLWSLSGEKPLSTLSGHTSRVGRLAFHPSGAYL 281



>gb:AE016816_1746827 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome III, complete sequence.
          Length = 425

 Score = 82.4 bits (202), Expect = 6e-15
 Identities = 40/139 (28%), Positives = 65/139 (46%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H+G V C+         F TG +D ++ +W +       TL GH   V  I   +    +
Sbjct: 112 HTGWVRCVCVDPVDNAWFATGSNDSTIRVWDLATGKLKVTLQGHIMTVRDICISARHPYM 171

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
            + S   L+K WDLE   ++R   G  S   +++ HP  +   S   D+ +++WDIR + 
Sbjct: 172 FSASQDKLVKCWDLERNTVVRDFHGTLSGVHSVDLHPSLDLIVSAGRDSVVRVWDIRSRS 231

Query: 596 CIHTYKGHTRGISTIRFTP 652
           C+ T  GH   I+ +R  P
Sbjct: 232 CVLTLAGHRGPINKVRCLP 250



 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 33/126 (26%), Positives = 59/126 (46%), Gaps = 1/126 (0%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++ G D  V +W I   +   TL+GH  P+  +     +  + + S+   +KLWDL  
Sbjct: 212 LIVSAGRDSVVRVWDIRSRSCVLTLAGHRGPINKVRCLPVDPQIVSCSTDATVKLWDLVA 271

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGI-STI 640
            K ++TL+ H+     L F+P    FAS   D +++ W +     +  +     GI +T+
Sbjct: 272 GKPMKTLTHHKRNVRDLAFNPTEFSFASACTD-DIRSWKLVDGQLLTNFNSEALGIVNTL 330

Query: 641 RFTPDG 658
               DG
Sbjct: 331 ACNQDG 336



 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 32/121 (26%), Positives = 54/121 (44%), Gaps = 1/121 (0%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD-SAEILVAAGSSSGLIKLWDLEDTK 469
           +   D  V  W + + T      G  S V S+    S +++V+AG  S ++++WD+    
Sbjct: 173 SASQDKLVKCWDLERNTVVRDFHGTLSGVHSVDLHPSLDLIVSAGRDS-VVRVWDIRSRS 231

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFT 649
            + TL+GHR     +   P      S S D  +K+WD+     + T   H R +  + F 
Sbjct: 232 CVLTLAGHRGPINKVRCLPVDPQIVSCSTDATVKLWDLVAGKPMKTLTHHKRNVRDLAFN 291

Query: 650 P 652
           P
Sbjct: 292 P 292



>gb:AY003872_1285908 Plasmodium vivax YAC 1H14, complete sequence.
          Length = 602

 Score = 82.4 bits (202), Expect = 6e-15
 Identities = 45/144 (31%), Positives = 65/144 (45%), Gaps = 1/144 (0%)
 Frame = +2

Query: 212 YKLQEFV-AHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           YKL   +  HSG VNC+         F TG +D  + +W +       TL+GH + +  I
Sbjct: 271 YKLYRVILGHSGWVNCVDVDISN-EWFATGANDRLIKIWDLATCKLKLTLTGHINSIRDI 329

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
                   + +      +K WDLE  K+IR   GH S    L  HP  +   SG  D  +
Sbjct: 330 KISKKNPYLFSCGEDNRVKCWDLEYNKVIRDYHGHLSGVYCLSLHPSLDILMSGGRDAVV 389

Query: 569 KIWDIRKKGCIHTYKGHTRGISTI 640
           ++WDIR K  I    GHT  + ++
Sbjct: 390 RVWDIRTKSSIFVLSGHTGTVMSL 413



 Score = 72.8 bits (177), Expect = 5e-12
 Identities = 41/120 (34%), Positives = 61/120 (50%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           ++++  H   V CL     +  + ++GG D  V +W I   +S   LSGHT  V S+   
Sbjct: 358 IRDYHGHLSGVYCLSL-HPSLDILMSGGRDAVVRVWDIRTKSSIFVLSGHTGTVMSLCSQ 416

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
           S E  V +GS   +I+LWDL + K    L+ H+    +L  HPF   F S   D N+K+W
Sbjct: 417 SVEPQVVSGSQDKMIRLWDLNNGKCRIALTHHKKSIRSLSIHPFEYSFCSCGTD-NVKVW 475



 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 28/97 (28%), Positives = 44/97 (45%)
 Frame = +2

Query: 362 GHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFF 541
           GH+  V  +  D +    A G++  LIK+WDL   K+  TL+GH +    ++      + 
Sbjct: 279 GHSGWVNCVDVDISNEWFATGANDRLIKIWDLATCKLKLTLTGHINSIRDIKISKKNPYL 338

Query: 542 ASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
            S   D  +K WD+     I  Y GH  G+  +   P
Sbjct: 339 FSCGEDNRVKCWDLEYNKVIRDYHGHLSGVYCLSLHP 375



 Score = 37.7 bits (86), Expect = 0.18
 Identities = 18/61 (29%), Positives = 30/61 (49%)
 Frame = +2

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
           K+ R + GH  +   ++     E+FA+G+ D  +KIWD+       T  GH   I  I+ 
Sbjct: 272 KLYRVILGHSGWVNCVDVDISNEWFATGANDRLIKIWDLATCKLKLTLTGHINSIRDIKI 331

Query: 647 T 649
           +
Sbjct: 332 S 332



>gb:AK016201_1158645 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4930563E19
           product:hypothetical G-protein beta WD-40 repeats
           containing protein, full insert sequence.
          Length = 304

 Score = 82.4 bits (202), Expect = 6e-15
 Identities = 43/157 (27%), Positives = 70/157 (44%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A  G K+   + H   ++   F    C + LTG  D +  LW        +TL+GH   +
Sbjct: 137 ASTGRKVHTLIGHCAEISSALFNWD-CSLILTGSMDKTCMLWDATSGKYVATLTGHDDEI 195

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
               FD    L+A  S+ G  ++++    K +  L GH    + + F+P G    +GS D
Sbjct: 196 LDSCFDYTGKLIATASADGTARVYNATTRKCVTKLEGHEGEISKISFNPQGNRLLTGSSD 255

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
              +IWD++   C+   +GHT  I +  F   G  V+
Sbjct: 256 KTARIWDVQTGQCLQVLEGHTDEIFSCAFNYKGNIVI 292



 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 44/149 (29%), Positives = 67/149 (44%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +L     H   V  + F         TG  D +  LWS        T  GHT+ +  +
Sbjct: 13  GEELHTLEGHKNVVYAIAFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCL 72

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           +F+    +VA GS     KLWD+++ + + TL+GH +   +L F   G+   +GS D  +
Sbjct: 73  SFNPQSTVVATGSMDTTAKLWDIQNGEEVVTLTGHLAEIISLSFDTSGDRIITGSFDHTV 132

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
            +WD      +HT  GH   IS+  F  D
Sbjct: 133 VVWDASTGRKVHTLIGHCAEISSALFNWD 161



 Score = 70.5 bits (171), Expect = 3e-11
 Identities = 42/152 (27%), Positives = 65/152 (42%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           + G ++     H   +  L F     R+ +TG  DH+V +W         TL GH + + 
Sbjct: 96  QNGEEVVTLTGHLAEIISLSFDTSGDRI-ITGSFDHTVVVWDASTGRKVHTLIGHCAEIS 154

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
           S  F+    L+  GS      LWD    K + TL+GH        F   G+  A+ S D 
Sbjct: 155 SALFNWDCSLILTGSMDKTCMLWDATSGKYVATLTGHDDEILDSCFDYTGKLIATASADG 214

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
             ++++   + C+   +GH   IS I F P G
Sbjct: 215 TARVYNATTRKCVTKLEGHEGEISKISFNPQG 246



 Score = 68.9 bits (167), Expect = 7e-11
 Identities = 41/156 (26%), Positives = 69/156 (44%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A+ G     F  H+  + CL F  ++  +  TG  D +  LW I       TL+GH + +
Sbjct: 53  AETGKCYHTFRGHTAEIVCLSFNPQST-VVATGSMDTTAKLWDIQNGEEVVTLTGHLAEI 111

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
            S++FD++   +  GS    + +WD    + + TL GH +  ++  F+       +GSMD
Sbjct: 112 ISLSFDTSGDRIITGSFDHTVVVWDASTGRKVHTLIGHCAEISSALFNWDCSLILTGSMD 171

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
               +WD      + T  GH   I    F   G+ +
Sbjct: 172 KTCMLWDATSGKYVATLTGHDDEILDSCFDYTGKLI 207



 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 39/117 (33%), Positives = 54/117 (46%), Gaps = 1/117 (0%)
 Frame = +2

Query: 323 WSIGKPTSTSTLSGHTSPVESIAFDSAE-ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRS 499
           W         TL GH + V +IAF++     +A GS     KLW  E  K   T  GH +
Sbjct: 8   WDTASGEELHTLEGHKNVVYAIAFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTA 67

Query: 500 YCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
               L F+P     A+GSMDT  K+WDI+    + T  GH   I ++ F   G  ++
Sbjct: 68  EIVCLSFNPQSTVVATGSMDTTAKLWDIQNGEEVVTLTGHLAEIISLSFDTSGDRII 124



 Score = 58.9 bits (141), Expect = 8e-08
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 1/74 (1%)
 Frame = +2

Query: 434 GLIKLWDLEDTKMIRTLSGHRSYCTALEF-HPFGEFFASGSMDTNLKIWDIRKKGCIHTY 610
           G  + WD    + + TL GH++   A+ F +P+G+  A+GS D   K+W      C HT+
Sbjct: 3   GPARSWDTASGEELHTLEGHKNVVYAIAFNNPYGDKIATGSFDKTCKLWSAETGKCYHTF 62

Query: 611 KGHTRGISTIRFTP 652
           +GHT  I  + F P
Sbjct: 63  RGHTAEIVCLSFNP 76



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 23/101 (22%), Positives = 46/101 (45%)
 Frame = +2

Query: 275 TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           T ++  T   D +  +++       + L GH   +  I+F+     +  GSS    ++WD
Sbjct: 203 TGKLIATASADGTARVYNATTRKCVTKLEGHEGEISKISFNPQGNRLLTGSSDKTARIWD 262

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
           ++  + ++ L GH     +  F+  G    +GS D + +IW
Sbjct: 263 VQTGQCLQVLEGHTDEIFSCAFNYKGNIVITGSKDNSCRIW 303



>gb:BC053205_2550597 Danio rerio platelet-activating factor
           acetylhydrolase, isoform Ib, alpha subunit a, mRNA (cDNA
           clone MGC:64021 IMAGE:6793127), complete cds.
          Length = 410

 Score = 82.0 bits (201), Expect = 8e-15
 Identities = 38/125 (30%), Positives = 65/125 (52%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  +D ++ +W         TL GHT  V+ I+FD    L+A+ S+   IKLWD + 
Sbjct: 122 VIVSASEDATIKVWDHETGDFERTLKGHTDSVQDISFDHTGKLLASCSADMTIKLWDFQG 181

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
            + IRT+ GH    +++   P G+   S S D  +K+W++    C+ T+ GH   +  +R
Sbjct: 182 FECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVATGYCVKTFTGHREWVRMVR 241

Query: 644 FTPDG 658
              DG
Sbjct: 242 PNQDG 246



 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 39/114 (34%), Positives = 55/114 (48%)
 Frame = +2

Query: 329 IGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           I +P     LSGH SPV  + F     ++ + S    IK+WD E     RTL GH     
Sbjct: 95  IPRPPEKYALSGHRSPVTRVIFHPVFSVIVSASEDATIKVWDHETGDFERTLKGHTDSVQ 154

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            + F   G+  AS S D  +K+WD +   CI T  GH   +S++   P+G  +V
Sbjct: 155 DISFDHTGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHIV 208



 Score = 63.2 bits (152), Expect = 4e-09
 Identities = 25/99 (25%), Positives = 51/99 (51%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           L+G  D ++ +W +       TL GH + V  +        + + +    +++WD ++ +
Sbjct: 312 LSGSRDKTIKMWDVSIGMCLMTLVGHDNWVRGVLVHPGGKYIVSCADDKTLRIWDYKNKR 371

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
             +TLS H  + T+L+FH    +  +GS+D  +K+W+ R
Sbjct: 372 CTKTLSAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR 410



 Score = 63.2 bits (152), Expect = 4e-09
 Identities = 45/174 (25%), Positives = 76/174 (43%), Gaps = 20/174 (11%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           GY ++ F  H   V  +R   +   +  +  +D +V +W +      + L  H   VE I
Sbjct: 224 GYCVKTFTGHREWVRMVR-PNQDGTLIASSSNDQTVRVWVVATKECKAELREHEHVVECI 282

Query: 389 AF--DSAE--ILVAAGSSSG----------------LIKLWDLEDTKMIRTLSGHRSYCT 508
           ++  +SA   IL A GS +                  IK+WD+     + TL GH ++  
Sbjct: 283 SWAPESAHPTILEATGSETKKSGKPGPFLLSGSRDKTIKMWDVSIGMCLMTLVGHDNWVR 342

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            +  HP G++  S + D  L+IWD + K C  T   H   ++++ F     +VV
Sbjct: 343 GVLVHPGGKYIVSCADDKTLRIWDYKNKRCTKTLSAHEHFVTSLDFHKTAPYVV 396



 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 32/140 (22%), Positives = 61/140 (43%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H+ +V  + F   T ++  +   D ++ LW         T+ GH   V S+A       +
Sbjct: 149 HTDSVQDISFDH-TGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVAIMPNGDHI 207

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
            + S    IK+W++     ++T +GHR +   +  +  G   AS S D  +++W +  K 
Sbjct: 208 VSASRDKTIKMWEVATGYCVKTFTGHREWVRMVRPNQDGTLIASSSNDQTVRVWVVATKE 267

Query: 596 CIHTYKGHTRGISTIRFTPD 655
           C    + H   +  I + P+
Sbjct: 268 CKAELREHEHVVECISWAPE 287



>gb:BC071846_1988821 Homo sapiens APG16 autophagy 16-like (S.
           cerevisiae), mRNA (cDNA clone IMAGE:6651664), partial
           cds.
          Length = 475

 Score = 82.0 bits (201), Expect = 8e-15
 Identities = 47/129 (36%), Positives = 68/129 (52%), Gaps = 2/129 (1%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSI--GKPTSTSTLSGHTSPVESIAFDS 400
           F AH G VN ++F   + R+  TGG D  V LW +   K     +LSG  + + SI FDS
Sbjct: 186 FDAHDGEVNAVQFSPGS-RLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDS 244

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
           A   + A S+    ++W ++D ++  TL+GH     + +F        SGS D  LK+WD
Sbjct: 245 AGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWD 304

Query: 581 IRKKGCIHT 607
           +R K CI T
Sbjct: 305 LRSKVCIKT 313



 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 29/112 (25%), Positives = 50/112 (44%), Gaps = 2/112 (1%)
 Frame = +2

Query: 341 TSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDL--EDTKMIRTLSGHRSYCTAL 514
           T+      H   V ++ F     L+A G     +KLW++  E  +   +LSG  +  T++
Sbjct: 181 TALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSI 240

Query: 515 EFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           EF   G +  + S D   +IW +      HT  GH+  + + +F  D   +V
Sbjct: 241 EFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIV 292



 Score = 37.0 bits (84), Expect = 0.31
 Identities = 30/133 (22%), Positives = 57/133 (42%), Gaps = 6/133 (4%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           ++G  D  +  W I   +    +      + ++  +     + + S   L+K+ DL    
Sbjct: 331 MSGHFDKKIRFWDIRSESIVREME-LLGKITALDLNPERTELLSCSRDDLLKVIDLRTNA 389

Query: 470 MIRTLSGHRSYC----TALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTY--KGHTRGI 631
           + +T S     C    T + F P G + A+GS + +L IW +   G +     K H+  I
Sbjct: 390 IKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSV-LTGKVEKVLSKQHSSSI 448

Query: 632 STIRFTPDGRWVV 670
           + + ++P G  VV
Sbjct: 449 NAVAWSPSGSHVV 461



>gb:BC037320_1982178 Homo sapiens F-box and WD-40 domain protein 7
           (archipelago homolog, Drosophila), mRNA (cDNA clone
           IMAGE:5260084), partial cds.
          Length = 621

 Score = 82.0 bits (201), Expect = 8e-15
 Identities = 49/149 (32%), Positives = 75/149 (50%), Gaps = 3/149 (2%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L   + H   V C+R+     R  ++G  D  V +W     T   TL GHT+ V S+
Sbjct: 405 GQCLHVLMGHVAAVRCVRYDG---RRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSL 461

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            FD   I V +GS    I++WD+E    I TL+GH+S  + +E         SG+ D+ +
Sbjct: 462 QFDG--IHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTV 517

Query: 569 KIWDIRKKGCIHTYKG---HTRGISTIRF 646
           KIWDI+   C+ T +G   H   ++ ++F
Sbjct: 518 KIWDIKTGQCLQTLQGPNKHQSAVTCLQF 546



 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 40/140 (28%), Positives = 70/140 (50%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A+ G  +     H+  V C+   +K     ++G  D ++ +W I        L GH + V
Sbjct: 362 AETGECIHTLYGHTSTVRCMHLHEKRV---VSGSRDATLRVWDIETGQCLHVLMGHVAAV 418

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             + +D   ++  +G+   ++K+WD E    + TL GH +   +L+F   G    SGS+D
Sbjct: 419 RCVRYDGRRVV--SGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFD--GIHVVSGSLD 474

Query: 560 TNLKIWDIRKKGCIHTYKGH 619
           T++++WD+    CIHT  GH
Sbjct: 475 TSIRVWDVETGNCIHTLTGH 494



 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 46/142 (32%), Positives = 71/142 (50%), Gaps = 1/142 (0%)
 Frame = +2

Query: 248 VNCLRFGKKTC-RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAG 424
           + CL+F    C    ++G DD+++ +WS        TL GHT  V S      + ++ +G
Sbjct: 298 ITCLQF----CGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS--SQMRDNIIISG 351

Query: 425 SSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIH 604
           S+   +K+W+ E  + I TL GH S    +  H   +   SGS D  L++WDI    C+H
Sbjct: 352 STDRTLKVWNAETGECIHTLYGHTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQCLH 409

Query: 605 TYKGHTRGISTIRFTPDGRWVV 670
              GH   +  +R+  DGR VV
Sbjct: 410 VLMGHVAAVRCVRY--DGRRVV 429



 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 45/157 (28%), Positives = 76/157 (48%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A  G  L+  V H+G V   +       + ++G  D ++ +W+        TL GHTS V
Sbjct: 322 AVTGKCLRTLVGHTGGVWSSQMRDN---IIISGSTDRTLKVWNAETGECIHTLYGHTSTV 378

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             +     E  V +GS    +++WD+E  + +  L GH +    + +   G    SG+ D
Sbjct: 379 RCMHLH--EKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVRYD--GRRVVSGAYD 434

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
             +K+WD   + C+HT +GHT  + +++F  DG  VV
Sbjct: 435 FMVKVWDPETETCLHTLQGHTNRVYSLQF--DGIHVV 469



 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 35/107 (32%), Positives = 48/107 (44%)
 Frame = +2

Query: 323 WSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSY 502
           W  G+  S   L+GH   V +        +V+ GS    +K+W     K +RTL GH   
Sbjct: 279 WRRGELKSPKVLNGHDDHVITCLQFCGNRIVS-GSDDNTLKVWSAVTGKCLRTLVGHTGG 337

Query: 503 CTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
             + +         SGS D  LK+W+     CIHT  GHT   ST+R
Sbjct: 338 VWSSQMR--DNIIISGSTDRTLKVWNAETGECIHTLYGHT---STVR 379



 Score = 38.9 bits (89), Expect = 0.082
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 3/70 (4%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSG---HTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           + ++G  D +V +W I       TL G   H S V  + F+   ++ +  S  G +KLWD
Sbjct: 507 ILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITS--SDDGTVKLWD 564

Query: 455 LEDTKMIRTL 484
           L+  + IR L
Sbjct: 565 LKTGEFIRNL 574



>gb:AY398617_1949793 Homo sapiens APG16L beta mRNA, complete cds.
          Length = 607

 Score = 82.0 bits (201), Expect = 8e-15
 Identities = 47/129 (36%), Positives = 68/129 (52%), Gaps = 2/129 (1%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSI--GKPTSTSTLSGHTSPVESIAFDS 400
           F AH G VN ++F   + R+  TGG D  V LW +   K     +LSG  + + SI FDS
Sbjct: 318 FDAHDGEVNAVQFSPGS-RLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDS 376

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
           A   + A S+    ++W ++D ++  TL+GH     + +F        SGS D  LK+WD
Sbjct: 377 AGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWD 436

Query: 581 IRKKGCIHT 607
           +R K CI T
Sbjct: 437 LRSKVCIKT 445



 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 29/112 (25%), Positives = 50/112 (44%), Gaps = 2/112 (1%)
 Frame = +2

Query: 341 TSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDL--EDTKMIRTLSGHRSYCTAL 514
           T+      H   V ++ F     L+A G     +KLW++  E  +   +LSG  +  T++
Sbjct: 313 TALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSI 372

Query: 515 EFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           EF   G +  + S D   +IW +      HT  GH+  + + +F  D   +V
Sbjct: 373 EFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIV 424



 Score = 37.0 bits (84), Expect = 0.31
 Identities = 30/133 (22%), Positives = 57/133 (42%), Gaps = 6/133 (4%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           ++G  D  +  W I   +    +      + ++  +     + + S   L+K+ DL    
Sbjct: 463 MSGHFDKKIRFWDIRSESIVREME-LLGKITALDLNPERTELLSCSRDDLLKVIDLRTNA 521

Query: 470 MIRTLSGHRSYC----TALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTY--KGHTRGI 631
           + +T S     C    T + F P G + A+GS + +L IW +   G +     K H+  I
Sbjct: 522 IKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSV-LTGKVEKVLSKQHSSSI 580

Query: 632 STIRFTPDGRWVV 670
           + + ++P G  VV
Sbjct: 581 NAVAWSPSGSHVV 593



>gb:AF443204_1800322 Chlamydomonas reinhardtii
           WD40-repeat-containing protein (Mut11) mRNA, complete
           cds.
          Length = 370

 Score = 82.0 bits (201), Expect = 8e-15
 Identities = 41/130 (31%), Positives = 65/130 (50%), Gaps = 1/130 (0%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           +  +G  D +V LW        +TL+GH+  V  +A++     +A  +    +KLWD E 
Sbjct: 54  LLASGSADRTVALWDAATGARVNTLAGHSCGVSDVAWNPNGRYLATAADDHSLKLWDAET 113

Query: 464 TKMIRTLSGHRSYCTALEFH-PFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
              +RTL+GH +Y     F    G   ASGS D  L++WD+R   C+     H+  +++ 
Sbjct: 114 GACLRTLTGHTNYVFCCNFDGAAGHLLASGSFDETLRLWDVRSGRCLREVPAHSDPVTSA 173

Query: 641 RFTPDGRWVV 670
            F+ DG  VV
Sbjct: 174 AFSYDGSMVV 183



 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 45/159 (28%), Positives = 77/159 (48%), Gaps = 2/159 (1%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A  G ++     HS  V+ + +     R   T  DDHS+ LW         TL+GHT+ V
Sbjct: 69  AATGARVNTLAGHSCGVSDVAWNPNG-RYLATAADDHSLKLWDAETGACLRTLTGHTNYV 127

Query: 380 ESIAFD-SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM 556
               FD +A  L+A+GS    ++LWD+   + +R +  H    T+  F   G    + S+
Sbjct: 128 FCCNFDGAAGHLLASGSFDETLRLWDVRSGRCLREVPAHSDPVTSAAFSYDGSMVVTSSL 187

Query: 557 DTNLKIWDIRKKGCIHT-YKGHTRGISTIRFTPDGRWVV 670
           D  +++WD +   C+ T +   +  +S   FTP+ ++V+
Sbjct: 188 DGLIRLWDTQTGHCLKTLFDRDSPPVSFAAFTPNAKYVL 226



 Score = 70.5 bits (171), Expect = 3e-11
 Identities = 33/100 (33%), Positives = 52/100 (52%)
 Frame = +2

Query: 347 TSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHP 526
           T  LSGHT  V ++ F     L+A+GS+   + LWD      + TL+GH    + + ++P
Sbjct: 33  THALSGHTKAVAAVKFSPDGSLLASGSADRTVALWDAATGARVNTLAGHSCGVSDVAWNP 92

Query: 527 FGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
            G + A+ + D +LK+WD     C+ T  GHT  +    F
Sbjct: 93  NGRYLATAADDHSLKLWDAETGACLRTLTGHTNYVFCCNF 132



 Score = 62.4 bits (150), Expect = 7e-09
 Identities = 37/140 (26%), Positives = 58/140 (41%), Gaps = 1/140 (0%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A+ G  L+    H+  V C  F      +  +G  D ++ LW +        +  H+ PV
Sbjct: 111 AETGACLRTLTGHTNYVFCCNFDGAAGHLLASGSFDETLRLWDVRSGRCLREVPAHSDPV 170

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTAL-EFHPFGEFFASGSM 556
            S AF     +V   S  GLI+LWD +    ++TL    S   +   F P  ++    ++
Sbjct: 171 TSAAFSYDGSMVVTSSLDGLIRLWDTQTGHCLKTLFDRDSPPVSFAAFTPNAKYVLCNTL 230

Query: 557 DTNLKIWDIRKKGCIHTYKG 616
           D   K+WD        TY G
Sbjct: 231 DGRAKLWDYAAGRTRRTYAG 250



 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 23/62 (37%), Positives = 36/62 (58%)
 Frame = +2

Query: 482 LSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
           LSGH     A++F P G   ASGS D  + +WD      ++T  GH+ G+S + + P+GR
Sbjct: 36  LSGHTKAVAAVKFSPDGSLLASGSADRTVALWDAATGARVNTLAGHSCGVSDVAWNPNGR 95

Query: 662 WV 667
           ++
Sbjct: 96  YL 97



>gb:AF056182_1764686 Emericella nidulans G-protein beta subunit
           (sfaD) gene, complete cds.
          Length = 352

 Score = 82.0 bits (201), Expect = 8e-15
 Identities = 46/150 (30%), Positives = 77/150 (51%), Gaps = 3/150 (2%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           +E   HSG ++C RF     R  +T   D +  LW I   +  +  + H   V SI+ + 
Sbjct: 147 RELSGHSGYLSCCRFIND--RRIITSSGDMTCMLWDIESGSKVTEFADHFGDVMSISINP 204

Query: 401 A-EILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
             + +  +G+     KLWD+   K ++T +GH S   A++F P G  F +GS DT  +++
Sbjct: 205 TNQNIFVSGACDAFAKLWDIRTGKAVQTFAGHESDINAIQFFPDGNAFGTGSDDTTCRLF 264

Query: 578 DIRKKGCIHTYKGH--TRGISTIRFTPDGR 661
           DIR    ++TY+      GI+++ F+  GR
Sbjct: 265 DIRADRSLNTYQSDQILCGITSVGFSVSGR 294



 Score = 66.6 bits (161), Expect = 4e-10
 Identities = 38/152 (25%), Positives = 65/152 (42%), Gaps = 2/152 (1%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G K+ EF  H G+V  +        +F++G  D    LW I    +  T +GH S + +I
Sbjct: 184 GSKVTEFADHFGDVMSISINPTNQNIFVSGACDAFAKLWDIRTGKAVQTFAGHESDINAI 243

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYC--TALEFHPFGEFFASGSMDT 562
            F         GS     +L+D+   + + T    +  C  T++ F   G    +G  D 
Sbjct: 244 QFFPDGNAFGTGSDDTTCRLFDIRADRSLNTYQSDQILCGITSVGFSVSGRLLFAGYDDF 303

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
             K+WD+ +   + +  GH   +S +  + DG
Sbjct: 304 ECKVWDVLRGDKVGSLSGHENRVSCLGVSNDG 335



 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 35/127 (27%), Positives = 57/127 (44%), Gaps = 2/127 (1%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHT--SP 376
           + G  +Q F  H  ++N ++F       F TG DD +  L+ I    S +T         
Sbjct: 225 RTGKAVQTFAGHESDINAIQFFPDG-NAFGTGSDDTTCRLFDIRADRSLNTYQSDQILCG 283

Query: 377 VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM 556
           + S+ F  +  L+ AG      K+WD+     + +LSGH +  + L     G    +GS 
Sbjct: 284 ITSVGFSVSGRLLFAGYDDFECKVWDVLRGDKVGSLSGHENRVSCLGVSNDGISLCTGSW 343

Query: 557 DTNLKIW 577
           D+ LK+W
Sbjct: 344 DSLLKVW 350



 Score = 40.4 bits (93), Expect = 0.028
 Identities = 23/107 (21%), Positives = 45/107 (42%), Gaps = 4/107 (3%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           TL GH + + ++ + +    + + S  G + +WD   T  +  +    S+     + P G
Sbjct: 60  TLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPSG 119

Query: 533 EFFASGSMDTNLKIWDIRKK----GCIHTYKGHTRGISTIRFTPDGR 661
            + A G +D    I+++  +           GH+  +S  RF  D R
Sbjct: 120 NYVACGGLDNICSIYNLSSREGPTRVARELSGHSGYLSCCRFINDRR 166



 Score = 34.3 bits (77), Expect = 2.0
 Identities = 18/64 (28%), Positives = 26/64 (40%)
 Frame = +2

Query: 476 RTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
           RTL GH +   A+ +        S S D  L IWD      +H     +  + T  + P 
Sbjct: 59  RTLKGHLAKIYAMHWSTDRRHLVSASQDGKLIIWDAYTTNKVHAIPLRSSWVMTCAYAPS 118

Query: 656 GRWV 667
           G +V
Sbjct: 119 GNYV 122



>gb:AE014298_1125350 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003488_1212359 Drosophila melanogaster
           chromosome X, section 40 of 74 of the complete
           sequence.>gb:AY051707_1290301 Drosophila melanogaster
           LD24662 full length cDNA.
          Length = 482

 Score = 82.0 bits (201), Expect = 8e-15
 Identities = 43/144 (29%), Positives = 69/144 (47%), Gaps = 1/144 (0%)
 Frame = +2

Query: 212 YKLQEFVA-HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           +KL   ++ H G V C+         F TG  D  + +W +       +L+GH S V  +
Sbjct: 162 WKLSRVISGHLGWVRCIAVEPGN-EWFATGAGDRVIKIWDLASGKLKLSLTGHVSTVRGV 220

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           A  +    + +      +K WDLE  K+IR   GH S   +L  HP  +  A+   D+  
Sbjct: 221 AVSTKHPYLFSCGEDRQVKCWDLEYNKVIRHYHGHLSAVYSLALHPTIDVLATSGRDSTA 280

Query: 569 KIWDIRKKGCIHTYKGHTRGISTI 640
           +IWD+R K  +HT  GHT  ++++
Sbjct: 281 RIWDMRTKANVHTLTGHTNTVASV 304



 Score = 69.3 bits (168), Expect = 6e-11
 Identities = 36/128 (28%), Positives = 60/128 (46%)
 Frame = +2

Query: 275 TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           T  +  T G D +  +W +    +  TL+GHT+ V S+   +    +  GS    ++LWD
Sbjct: 267 TIDVLATSGRDSTARIWDMRTKANVHTLTGHTNTVASVVAQATNPQIITGSHDSTVRLWD 326

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
           L   K + TL+ H+    ++  HP    FAS S D N+K W   +   +    GHT  ++
Sbjct: 327 LAAGKSVCTLTNHKKSVRSIVLHPSLYMFASASPD-NIKQWRCPEGKFVQNISGHTSIVN 385

Query: 635 TIRFTPDG 658
            +    +G
Sbjct: 386 CMAANSEG 393



>gb:CZA382_119892 Amycolatopsis orientalis cosmid pCZA382.
          Length = 1241

 Score = 82.0 bits (201), Expect = 8e-15
 Identities = 45/130 (34%), Positives = 68/130 (52%), Gaps = 3/130 (2%)
 Frame = +2

Query: 281  RMFLTGGDDHSVNLWSIGKPTS-TSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDL 457
            R+  TG DD  V LW         + L+GHT+ V S+AF     ++A GS  G ++LWD 
Sbjct: 934  RVLGTGADDRKVRLWETSTHRELVAPLTGHTAEVRSMAFSPQGGILATGSWDGTLRLWDA 993

Query: 458  EDTKMIRT-LSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCI-HTYKGHTRGI 631
             +   I + L+GH  +   L F P G F A+  MD  +++W++  +        GHT  +
Sbjct: 994  ANRAPIGSPLTGHVDWVRGLAFSPDGHFVATAGMDMTVRLWNVATRAPFGPPLTGHTNSV 1053

Query: 632  STIRFTPDGR 661
            + I F+PDGR
Sbjct: 1054 TGIAFSPDGR 1063



 Score = 75.9 bits (185), Expect = 6e-13
 Identities = 46/145 (31%), Positives = 73/145 (50%), Gaps = 3/145 (2%)
 Frame = +2

Query: 236  HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTST-LSGHTSPVESIAFDSAEIL 412
            H+G VN L F      +  T   D +V LW + +       +SGHT+ V SIAF S   L
Sbjct: 667  HTGMVNGLAFSPDGTTL-ATASADRTVRLWDVARHRPIGEPMSGHTNTVTSIAFSSDGRL 725

Query: 413  VAAGSSSGLIKLWDLED-TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRK 589
            +  GS+ G ++ WD+   T +   + GH+   TA+   P G   A+ S D  +++W++  
Sbjct: 726  LVTGSADGTVRTWDITSRTPIGEPMVGHKGPITAVALSPDGVTAATSSNDKTVRLWNVAT 785

Query: 590  KGCI-HTYKGHTRGISTIRFTPDGR 661
            +  I     GHT   + + F+PDG+
Sbjct: 786  RAPIGDPLTGHTSVTNGVAFSPDGQ 810



 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 41/125 (32%), Positives = 64/125 (51%), Gaps = 2/125 (1%)
 Frame = +2

Query: 293  TGGDDHSVNLWSIG-KPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
            T G D +V LW++  +      L+GHT+ V  IAF      +A  ++   I+LWD+    
Sbjct: 1024 TAGMDMTVRLWNVATRAPFGPPLTGHTNSVTGIAFSPDGRSLATAANDKTIRLWDVPSRS 1083

Query: 470  MI-RTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
             I   L+GH S    + F P G+  AS   D  +++WD+  +  I T +GHT  +  +  
Sbjct: 1084 PIGEPLTGHTSVVRDVVFSPDGKLLASAGDDKTVRLWDVASRTLIATLEGHTGEVLKLAI 1143

Query: 647  TPDGR 661
            +PDGR
Sbjct: 1144 SPDGR 1148



 Score = 72.4 bits (176), Expect = 7e-12
 Identities = 40/142 (28%), Positives = 65/142 (45%), Gaps = 1/142 (0%)
 Frame = +2

Query: 236  HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSI-GKPTSTSTLSGHTSPVESIAFDSAEIL 412
            H+ +V  + F     R   T  +D ++ LW +  +      L+GHTS V  + F     L
Sbjct: 1049 HTNSVTGIAFSPDG-RSLATAANDKTIRLWDVPSRSPIGEPLTGHTSVVRDVVFSPDGKL 1107

Query: 413  VAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKK 592
            +A+      ++LWD+    +I TL GH      L   P G   AS S+D  +++WD   +
Sbjct: 1108 LASAGDDKTVRLWDVASRTLIATLEGHTGEVLKLAISPDGRELASTSLDKTVRLWDTANR 1167

Query: 593  GCIHTYKGHTRGISTIRFTPDG 658
                     T G++ + +TPDG
Sbjct: 1168 STTTVLSAST-GLAGVAYTPDG 1188



 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 41/145 (28%), Positives = 67/145 (46%), Gaps = 3/145 (2%)
 Frame = +2

Query: 236  HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTST-LSGHTSPVESIAFDSAEIL 412
            H+  V  + F     R+ +TG  D +V  W I   T     + GH  P+ ++A     + 
Sbjct: 710  HTNTVTSIAFSSDG-RLLVTGSADGTVRTWDITSRTPIGEPMVGHKGPITAVALSPDGVT 768

Query: 413  VAAGSSSGLIKLWDLEDTKMIRT-LSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRK 589
             A  S+   ++LW++     I   L+GH S    + F P G+  AS S D  +++W++  
Sbjct: 769  AATSSNDKTVRLWNVATRAPIGDPLTGHTSVTNGVAFSPDGQILASTSGDKTVRLWNVAT 828

Query: 590  KGCI-HTYKGHTRGISTIRFTPDGR 661
            +  I     GHT     + F+PDGR
Sbjct: 829  RAPIGDPLTGHTNVTYGVAFSPDGR 853



 Score = 64.7 bits (156), Expect = 1e-09
 Identities = 38/109 (34%), Positives = 57/109 (52%), Gaps = 4/109 (3%)
 Frame = +2

Query: 356 LSGHTSPVESIAF--DSAEILVAAGSSSGLIKLWDLEDTKMI-RTLSGHRSYCTALEFHP 526
           L GHT  V  +AF  D   +  AAG SS  ++LWD+   + +   L+GH      L F P
Sbjct: 621 LLGHTGEVRDVAFSPDGRVLATAAGDSS--VRLWDIASRQPLGNPLTGHTGMVNGLAFSP 678

Query: 527 FGEFFASGSMDTNLKIWDI-RKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            G   A+ S D  +++WD+ R +       GHT  +++I F+ DGR +V
Sbjct: 679 DGTTLATASADRTVRLWDVARHRPIGEPMSGHTNTVTSIAFSSDGRLLV 727



 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 38/127 (29%), Positives = 62/127 (48%), Gaps = 5/127 (3%)
 Frame = +2

Query: 293  TGGDDHSVNLWSIG-KPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
            T  +D +V LW++  +      L+GHTS    +AF     ++A+ S    ++LW++    
Sbjct: 771  TSSNDKTVRLWNVATRAPIGDPLTGHTSVTNGVAFSPDGQILASTSGDKTVRLWNVATRA 830

Query: 470  MIRT-LSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI---RKKGCIHTYKGHTRGIST 637
             I   L+GH +    + F P G   A+ S D  ++IWD    R++G      G T  +  
Sbjct: 831  PIGDPLTGHTNVTYGVAFSPDGRTLATSSWDKTVRIWDTTSRRQQGT--ALIGSTSSVFN 888

Query: 638  IRFTPDG 658
            I F+PDG
Sbjct: 889  IAFSPDG 895



 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 35/129 (27%), Positives = 63/129 (48%), Gaps = 3/129 (2%)
 Frame = +2

Query: 290  LTGGD-DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
            L GGD D S  +WS+      + +  H   V ++A      ++  G+    ++LW+    
Sbjct: 898  LAGGDSDSSTLVWSL----RGTLVPAHADAVYAVALSPEGRVLGTGADDRKVRLWETSTH 953

Query: 467  K-MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHT-YKGHTRGISTI 640
            + ++  L+GH +   ++ F P G   A+GS D  L++WD   +  I +   GH   +  +
Sbjct: 954  RELVAPLTGHTAEVRSMAFSPQGGILATGSWDGTLRLWDAANRAPIGSPLTGHVDWVRGL 1013

Query: 641  RFTPDGRWV 667
             F+PDG +V
Sbjct: 1014 AFSPDGHFV 1022



>pir|AE2415|AE2415 WD-repeat protein [imported] - Nostoc sp. (strain
           PCC 7120)>gb:BA000019_685866 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 598

 Score = 82.0 bits (201), Expect = 8e-15
 Identities = 43/125 (34%), Positives = 63/125 (50%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           K    L   + H   V  L   K   ++ ++G  D ++ +W +       TL GHT  V 
Sbjct: 472 KDAQPLHTLMGHGHIVRSLAMSKDG-QLLISGSWDQTIKIWHLATGRLIRTLKGHTDKVY 530

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
           +IA    E ++A+GSS   IKLW LE  +++ T +GH    TAL F   GE   SGS+D 
Sbjct: 531 AIALSPDEQIIASGSSDQTIKLWHLETGELLATFTGHTDIVTALTFTTSGEMLVSGSLDK 590

Query: 563 NLKIW 577
            +K+W
Sbjct: 591 TIKLW 595



 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 37/106 (34%), Positives = 54/106 (50%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           TL GH   V S+A      L+ +GS    IK+W L   ++IRTL GH     A+   P  
Sbjct: 479 TLMGHGHIVRSLAMSKDGQLLISGSWDQTIKIWHLATGRLIRTLKGHTDKVYAIALSPDE 538

Query: 533 EFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           +  ASGS D  +K+W +     + T+ GHT  ++ + FT  G  +V
Sbjct: 539 QIIASGSSDQTIKLWHLETGELLATFTGHTDIVTALTFTTSGEMLV 584



 Score = 64.7 bits (156), Expect = 1e-09
 Identities = 44/149 (29%), Positives = 63/149 (42%), Gaps = 9/149 (6%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H+G V C  F     +M  TGGDD  +  W +      + LS   +   S+        +
Sbjct: 391 HNGIVRCAAFTPDG-QMLATGGDDRRILFWDLMHRQVKAILSLDDTAAHSLVLSRDGQTL 449

Query: 416 AAGSSSGLIKLW---------DLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
             GS    IK+W         +L+D + + TL GH     +L     G+   SGS D  +
Sbjct: 450 VTGSYRK-IKVWQTSGSWFGKNLKDAQPLHTLMGHGHIVRSLAMSKDGQLLISGSWDQTI 508

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
           KIW +     I T KGHT  +  I  +PD
Sbjct: 509 KIWHLATGRLIRTLKGHTDKVYAIALSPD 537



 Score = 52.8 bits (125), Expect = 5e-06
 Identities = 34/130 (26%), Positives = 50/130 (38%), Gaps = 9/130 (6%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRF--GKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLS-------GHTS 373
           Q    H   +NCL F  G +     L  G      LW + +     TLS       G   
Sbjct: 292 QTLRGHMRGINCLSFSSGCENGLPMLASGSRGETKLWDLNQGELIDTLSEYPWIVSGLVD 351

Query: 374 PVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGS 553
            V S+AF +   ++ +G +   IK+W      +I  L  H        F P G+  A+G 
Sbjct: 352 EVNSLAFSADGQMLVSGGADSTIKIWHTGALDLIDILHKHNGIVRCAAFTPDGQMLATGG 411

Query: 554 MDTNLKIWDI 583
            D  +  WD+
Sbjct: 412 DDRRILFWDL 421



 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 37/121 (30%), Positives = 50/121 (41%), Gaps = 10/121 (8%)
 Frame = +2

Query: 329 IGKPTSTSTLSGHTSPVESIAFDSA---EILVAAGSSSGLIKLWDLEDTKMIRTLS---- 487
           IG      TL GH   +  ++F S     + + A  S G  KLWDL   ++I TLS    
Sbjct: 285 IGDWECWQTLRGHMRGINCLSFSSGCENGLPMLASGSRGETKLWDLNQGELIDTLSEYPW 344

Query: 488 ---GHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
              G      +L F   G+   SG  D+ +KIW       I     H   +    FTPDG
Sbjct: 345 IVSGLVDEVNSLAFSADGQMLVSGGADSTIKIWHTGALDLIDILHKHNGIVRCAAFTPDG 404

Query: 659 R 661
           +
Sbjct: 405 Q 405



>sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit
           5 (Transcription initiation factor TFIID 100 kDa
           subunit) (TAF(II)100) (TAFII-100)
           (TAFII100).>gb:AK031985_1162681 Mus musculus adult male
           medulla oblongata cDNA, RIKEN full-length enriched
           library, clone:6330528C20 product:TRANSCRIPTION
           INITIATION FACTOR TFIID 100 KDA SUBUNIT (TAFII-100)
           (TAFII100) homolog [Homo sapiens], full insert sequence.
          Length = 801

 Score = 82.0 bits (201), Expect = 8e-15
 Identities = 41/124 (33%), Positives = 60/124 (48%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           L+ F  H  +VNC R+   +     TG  D +V LW +         +GH  P+ S+ F 
Sbjct: 621 LRIFAGHLADVNCTRYHPNS-NYVATGSADRTVRLWDVLNGNCVRIFTGHKGPIHSLTFS 679

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
                +A G++ G + LWD+    M+  L GH     +L F   GE  ASGSMD  +++W
Sbjct: 680 PNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLW 739

Query: 578 DIRK 589
           D  K
Sbjct: 740 DAVK 743



 Score = 79.3 bits (194), Expect = 5e-14
 Identities = 41/155 (26%), Positives = 70/155 (45%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           K   +L+    HSG V    F        L+  +D +V LWS+   T      GH  PV 
Sbjct: 532 KTASELKILYGHSGPVYGASFSPDR-NYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVW 590

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
              F        +G    + +LW  +  + +R  +GH +      +HP   + A+GS D 
Sbjct: 591 DTQFSPYGYYFVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRYHPNSNYVATGSADR 650

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            +++WD+    C+  + GH   I ++ F+P+GR++
Sbjct: 651 TVRLWDVLNGNCVRIFTGHKGPIHSLTFSPNGRFL 685



 Score = 78.6 bits (192), Expect = 9e-14
 Identities = 38/124 (30%), Positives = 62/124 (50%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F++GG D    LW+          +GH + V    +      VA GS+   ++LWD+ + 
Sbjct: 601 FVSGGHDRVARLWATDHYQPLRIFAGHLADVNCTRYHPNSNYVATGSADRTVRLWDVLNG 660

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
             +R  +GH+    +L F P G F A+G+ D  + +WDI     +   KGHT  + ++RF
Sbjct: 661 NCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRF 720

Query: 647 TPDG 658
           + DG
Sbjct: 721 SRDG 724



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 29/125 (23%), Positives = 51/125 (40%)
 Frame = +2

Query: 296 GGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMI 475
           G  D +V +WS+               + S+   S   L+   S   L ++ D +    +
Sbjct: 489 GFADSTVRVWSVTP-----------KKLRSVKQASDLSLIDKESDDVLERIMDEKTASEL 537

Query: 476 RTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
           + L GH        F P   +  S S D  +++W ++   C+  YKGH   +   +F+P 
Sbjct: 538 KILYGHSGPVYGASFSPDRNYLLSSSEDGTVRLWSLQTFTCLVGYKGHNYPVWDTQFSPY 597

Query: 656 GRWVV 670
           G + V
Sbjct: 598 GYYFV 602



>gb:AE017344_1756215 Cryptococcus neoformans var. neoformans JEC21
           chromosome 4, complete sequence.
          Length = 418

 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 47/147 (31%), Positives = 69/147 (46%), Gaps = 1/147 (0%)
 Frame = +2

Query: 233 AHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEIL 412
           +H   V  L F   T  +  +  +D +V LW         TL GHT  V  + FD    L
Sbjct: 88  SHRAPVTRLAF-HPTWTLLASASEDATVKLWDWEAGDMERTLKGHTKAVMDVDFDPRGGL 146

Query: 413 VAAGSSSGLIKLWDLEDTKM-IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRK 589
           +A  SS   +KLWD  +    ++TL GH    +++ F P GE   S S D  +++W +  
Sbjct: 147 MATCSSDLTLKLWDTANQYTNVKTLHGHDHSVSSVRFMPDGETLVSASRDKTIRVWQVSS 206

Query: 590 KGCIHTYKGHTRGISTIRFTPDGRWVV 670
             CI T+ GH   +     + DGRW+V
Sbjct: 207 GYCIKTFSGHAEWVREAVPSEDGRWLV 233



 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 42/113 (37%), Positives = 59/113 (52%), Gaps = 1/113 (0%)
 Frame = +2

Query: 335 KPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTAL 514
           +P    TL+ H +PV  +AF     L+A+ S    +KLWD E   M RTL GH      +
Sbjct: 79  RPPPRHTLASHRAPVTRLAFHPTWTLLASASEDATVKLWDWEAGDMERTLKGHTKAVMDV 138

Query: 515 EFHPFGEFFASGSMDTNLKIWDIRKKGC-IHTYKGHTRGISTIRFTPDGRWVV 670
           +F P G   A+ S D  LK+WD   +   + T  GH   +S++RF PDG  +V
Sbjct: 139 DFDPRGGLMATCSSDLTLKLWDTANQYTNVKTLHGHDHSVSSVRFMPDGETLV 191



 Score = 68.2 bits (165), Expect = 1e-10
 Identities = 43/169 (25%), Positives = 69/169 (40%), Gaps = 25/169 (14%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           GY ++ F  H+  V       +  R  ++  +D +  +W      +   L GH   VE  
Sbjct: 207 GYCIKTFSGHAEWVR-EAVPSEDGRWLVSASNDQTSRIWDFSTGETKMELRGHEHVVECA 265

Query: 389 AF-------------------------DSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGH 493
            F                          S  +  A GS    IKLWD    + +RTL GH
Sbjct: 266 VFAPVNAYPAIRELAGLKPPAPRDTRAKSPGVYAATGSRDKTIKLWDALSGQCLRTLVGH 325

Query: 494 RSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
            ++  AL FHP G++  S S D  +K+WD+    C  T + H+  ++++
Sbjct: 326 DNWIRALVFHPSGKYLLSASDDKTIKVWDLANGRCTKTIEAHSHFVTSM 374



 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 39/171 (22%), Positives = 66/171 (38%), Gaps = 26/171 (15%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV-ESIAFDSAEIL 412
           H  +V+ +RF        ++   D ++ +W +       T SGH   V E++  +    L
Sbjct: 174 HDHSVSSVRF-MPDGETLVSASRDKTIRVWQVSSGYCIKTFSGHAEWVREAVPSEDGRWL 232

Query: 413 VAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPF--------------------- 529
           V+A S+    ++WD    +    L GH        F P                      
Sbjct: 233 VSA-SNDQTSRIWDFSTGETKMELRGHEHVVECAVFAPVNAYPAIRELAGLKPPAPRDTR 291

Query: 530 ----GEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
               G + A+GS D  +K+WD     C+ T  GH   I  + F P G++++
Sbjct: 292 AKSPGVYAATGSRDKTIKLWDALSGQCLRTLVGHDNWIRALVFHPSGKYLL 342



 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 35/125 (28%), Positives = 50/125 (40%), Gaps = 2/125 (1%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKP-TSTSTLSGHTSPVESIAF-DSAEILVAAGSSSGLIKLWDL 457
           +  T   D ++ LW      T+  TL GH   V S+ F    E LV+A S    I++W +
Sbjct: 146 LMATCSSDLTLKLWDTANQYTNVKTLHGHDHSVSSVRFMPDGETLVSA-SRDKTIRVWQV 204

Query: 458 EDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIST 637
                I+T SGH  +         G +  S S D   +IWD          +GH   +  
Sbjct: 205 SSGYCIKTFSGHAEWVREAVPSEDGRWLVSASNDQTSRIWDFSTGETKMELRGHEHVVEC 264

Query: 638 IRFTP 652
             F P
Sbjct: 265 AVFAP 269



 Score = 37.4 bits (85), Expect = 0.24
 Identities = 29/126 (23%), Positives = 52/126 (41%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A  G  L+  V H   +  L F   + +  L+  DD ++ +W +     T T+  H+  V
Sbjct: 313 ALSGQCLRTLVGHDNWIRALVF-HPSGKYLLSASDDKTIKVWDLANGRCTKTIEAHSHFV 371

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
            S+ +       A G+S G+ K+     +K  R ++                  A+GS+D
Sbjct: 372 TSMTWGR-----AVGASGGIEKVNGDASSKEPRRIN----------------VLATGSVD 410

Query: 560 TNLKIW 577
             +K+W
Sbjct: 411 QTIKVW 416



>gb:AF063022_1237374 Crithidia fasciculata CACK protein (GCACK)
           gene, complete cds.
          Length = 316

 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 42/144 (29%), Positives = 73/144 (50%), Gaps = 3/144 (2%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           HSG V+C+     T    LT   DH++ +W +    S      HT  V ++AF   + L+
Sbjct: 64  HSGFVSCVSLAHAT-DYALTASWDHAIRMWDLRTGQSQRKFLKHTKDVLAVAFSPDDRLI 122

Query: 416 AAGSSSGLIKLWDLEDTKMIRTL-SGHRSYCTALEFHPFGEF--FASGSMDTNLKIWDIR 586
            +     +I++W++    M   L  GH  + +++ F P  +     SGS D  +K+W++ 
Sbjct: 123 VSAGRDNVIRVWNVAGECMHEFLRDGHEDWVSSICFSPSLDLPIVVSGSWDNTIKVWNVN 182

Query: 587 KKGCIHTYKGHTRGISTIRFTPDG 658
           +  C+HT +GH   +ST+  +PDG
Sbjct: 183 EGKCVHTLRGHKNYVSTVTVSPDG 206



 Score = 66.2 bits (160), Expect = 5e-10
 Identities = 37/130 (28%), Positives = 67/130 (51%), Gaps = 3/130 (2%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSI-GKPTSTSTLSGHTSPV 379
           + G   ++F+ H+ +V  + F     R+ ++ G D+ + +W++ G+        GH   V
Sbjct: 95  RTGQSQRKFLKHTKDVLAVAFSPDD-RLIVSAGRDNVIRVWNVAGECMHEFLRDGHEDWV 153

Query: 380 ESIAFDSAEIL--VAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGS 553
            SI F  +  L  V +GS    IK+W++ + K + TL GH++Y + +   P G   ASG 
Sbjct: 154 SSICFSPSLDLPIVVSGSWDNTIKVWNVNEGKCVHTLRGHKNYVSTVTVSPDGSLCASGG 213

Query: 554 MDTNLKIWDI 583
            D +  +WD+
Sbjct: 214 KDGSALLWDL 223



 Score = 40.4 bits (93), Expect = 0.028
 Identities = 24/104 (23%), Positives = 49/104 (47%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           ++G  D+++ +W++ +     TL GH + V ++       L A+G   G   LWDL + +
Sbjct: 168 VSGSWDNTIKVWNVNEGKCVHTLRGHKNYVSTVTVSPDGSLCASGGKDGSALLWDLSNGE 227

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCI 601
              ++    S    + F P   F+   + + +L ++D+  K  I
Sbjct: 228 QQFSIP-VESPINQIAFSP-NRFWMCVATEKSLSVYDLETKEVI 269



 Score = 36.6 bits (83), Expect = 0.41
 Identities = 14/63 (22%), Positives = 31/63 (49%)
 Frame = +2

Query: 482 LSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
           + GH  + + +      ++  + S D  +++WD+R       +  HT+ +  + F+PD R
Sbjct: 61  MEGHSGFVSCVSLAHATDYALTASWDHAIRMWDLRTGQSQRKFLKHTKDVLAVAFSPDDR 120

Query: 662 WVV 670
            +V
Sbjct: 121 LIV 123



>pir|S33263|S33263 transcription initiation factor IID-associated
           protein, 80K - fruit fly (Drosophila melanogaster)
          Length = 704

 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 40/124 (32%), Positives = 64/124 (51%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F++   D +  LW+     +     GH S V+ + F      VA GSS   ++LWD    
Sbjct: 507 FVSCSYDKTARLWATDSNQALRVFVGHLSDVDCVQFHPNSNYVATGSSDRTVRLWDNMTG 566

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
           + +R ++GH+   ++L F   G + ASGS+D N+ IWD+     + T   HT  ++TI F
Sbjct: 567 QSVRLMTGHKGSVSSLAFSACGRYLASGSVDHNIIIWDLSNGSLVTTLLRHTSTVTTITF 626

Query: 647 TPDG 658
           + DG
Sbjct: 627 SRDG 630



 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 41/124 (33%), Positives = 62/124 (50%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           L+ FV H  +V+C++F   +     TG  D +V LW      S   ++GH   V S+AF 
Sbjct: 527 LRVFVGHLSDVDCVQFHPNS-NYVATGSSDRTVRLWDNMTGQSVRLMTGHKGSVSSLAFS 585

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
           +    +A+GS    I +WDL +  ++ TL  H S  T + F   G   A+  +D NL +W
Sbjct: 586 ACGRYLASGSVDHNIIIWDLSNGSLVTTLLRHTSTVTTITFSRDGTVLAAAGLDNNLTLW 645

Query: 578 DIRK 589
           D  K
Sbjct: 646 DFHK 649



 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 38/155 (24%), Positives = 70/155 (45%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           + G   +  + H+G V    F  +   + L+  +D ++ LWS+   +   T  GH  PV 
Sbjct: 438 RSGEVTRSLMGHTGPVYRCAFAPEM-NLLLSCSEDSTIRLWSLLTWSCVVTYRGHVYPVW 496

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
            + F        + S     +LW  +  + +R   GH S    ++FHP   + A+GS D 
Sbjct: 497 DVRFAPHGYYFVSCSYDKTARLWATDSNQALRVFVGHLSDVDCVQFHPNSNYVATGSSDR 556

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            +++WD      +    GH   +S++ F+  GR++
Sbjct: 557 TVRLWDNMTGQSVRLMTGHKGSVSSLAFSACGRYL 591



 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 40/146 (27%), Positives = 64/146 (43%)
 Frame = +2

Query: 233 AHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEIL 412
           +H G V C      +  M   G  D SV +WS+  P +  TL    S +  +  +SA+I 
Sbjct: 376 SHQG-VTCAEISDDST-MLACGFGDSSVRIWSL-TPANVRTLKDADS-LRELDKESADIN 431

Query: 413 VAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKK 592
           V         ++ D    ++ R+L GH        F P      S S D+ +++W +   
Sbjct: 432 V---------RMLDDRSGEVTRSLMGHTGPVYRCAFAPEMNLLLSCSEDSTIRLWSLLTW 482

Query: 593 GCIHTYKGHTRGISTIRFTPDGRWVV 670
            C+ TY+GH   +  +RF P G + V
Sbjct: 483 SCVVTYRGHVYPVWDVRFAPHGYYFV 508



>pir|AG2375|AG2375 WD-40 repeat-protein [imported] - Nostoc sp.
            (strain PCC 7120)>gb:BA000019_685548 Nostoc sp. PCC 7120
            DNA, complete genome.
          Length = 786

 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 42/141 (29%), Positives = 72/141 (51%)
 Frame = +2

Query: 236  HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
            HS  V+ +     +  +  +G  D+ + LW+        TL+ H + V++IA       +
Sbjct: 627  HSSAVHAIAISPDST-ILASGSSDNKIRLWNPRTGDPLRTLNSHDNEVKAIAISRDGQFL 685

Query: 416  AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
             +GS+   IK+W L   +++ TL+GH     +L   P G+F  SGS DT +KIW I    
Sbjct: 686  FSGSADTTIKIWHLITGQILHTLTGHSGDIKSLTTSPNGQFLFSGSADTTIKIWRISTGE 745

Query: 596  CIHTYKGHTRGISTIRFTPDG 658
             +HT  GH+  ++++  +P G
Sbjct: 746  LLHTLTGHSASVNSVAISPGG 766



 Score = 76.3 bits (186), Expect = 5e-13
 Identities = 42/152 (27%), Positives = 80/152 (52%), Gaps = 3/152 (1%)
 Frame = +2

Query: 215 KLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAF 394
           KL+E+    G+ + L+F +K      T     S+       P  T T++GH+  V+S+A 
Sbjct: 448 KLREYFTVIGDRHNLQFVEKLLEAIATLKYKRSLEY-----PYLTKTITGHSGKVKSVAI 502

Query: 395 DSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGS---MDTN 565
                ++ +G +   + +W+L+  K+IRTL+G+    +++   P G F A GS     +N
Sbjct: 503 SPDGEVIVSGCTDQTVNIWNLQTGKLIRTLTGNLGEVSSVAISPDGNFLAVGSGVHPRSN 562

Query: 566 LKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
           +K+W ++    +HT  GH + ++ +  +PDG+
Sbjct: 563 VKVWHLKTGKLLHTLLGHQKPVNVVVISPDGQ 594



 Score = 72.0 bits (175), Expect = 9e-12
 Identities = 45/162 (27%), Positives = 75/162 (46%), Gaps = 7/162 (4%)
 Frame = +2

Query: 203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSG------ 364
            K G  L   + H   VN +          L  G +  + +W++ K        G      
Sbjct: 569  KTGKLLHTLLGHQKPVNVVVISPDG--QILASGSN-KIKIWNLQKGDGVPPTVGDRICTL 625

Query: 365  -HTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFF 541
             H+S V +IA      ++A+GSS   I+LW+      +RTL+ H +   A+     G+F 
Sbjct: 626  WHSSAVHAIAISPDSTILASGSSDNKIRLWNPRTGDPLRTLNSHDNEVKAIAISRDGQFL 685

Query: 542  ASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
             SGS DT +KIW +     +HT  GH+  I ++  +P+G+++
Sbjct: 686  FSGSADTTIKIWHLITGQILHTLTGHSGDIKSLTTSPNGQFL 727



 Score = 66.2 bits (160), Expect = 5e-10
 Identities = 34/129 (26%), Positives = 63/129 (48%)
 Frame = +2

Query: 203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
            + G  L+   +H   V  +   +    +F +G  D ++ +W +       TL+GH+  ++
Sbjct: 658  RTGDPLRTLNSHDNEVKAIAISRDGQFLF-SGSADTTIKIWHLITGQILHTLTGHSGDIK 716

Query: 383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
            S+        + +GS+   IK+W +   +++ TL+GH +   ++   P G   ASGS D 
Sbjct: 717  SLTTSPNGQFLFSGSADTTIKIWRISTGELLHTLTGHSASVNSVAISPGGNLLASGSADQ 776

Query: 563  NLKIWDIRK 589
             +KIW I K
Sbjct: 777  TIKIWQIDK 785



 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 42/158 (26%), Positives = 71/158 (44%), Gaps = 10/158 (6%)
 Frame = +2

Query: 212 YKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIA 391
           Y  +    HSG V  +        + ++G  D +VN+W++       TL+G+   V S+A
Sbjct: 485 YLTKTITGHSGKVKSVAISPDG-EVIVSGCTDQTVNIWNLQTGKLIRTLTGNLGEVSSVA 543

Query: 392 FDSAEILVAAGSS---SGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
                  +A GS       +K+W L+  K++ TL GH+     +   P G+  ASGS   
Sbjct: 544 ISPDGNFLAVGSGVHPRSNVKVWHLKTGKLLHTLLGHQKPVNVVVISPDGQILASGS--N 601

Query: 563 NLKIWDIRKKGCIHTYKG-------HTRGISTIRFTPD 655
            +KIW+++K   +    G       H+  +  I  +PD
Sbjct: 602 KIKIWNLQKGDGVPPTVGDRICTLWHSSAVHAIAISPD 639



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 20/71 (28%), Positives = 37/71 (52%)
 Frame = +2

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
           LE   + +T++GH     ++   P GE   SG  D  + IW+++    I T  G+   +S
Sbjct: 481 LEYPYLTKTITGHSGKVKSVAISPDGEVIVSGCTDQTVNIWNLQTGKLIRTLTGNLGEVS 540

Query: 635 TIRFTPDGRWV 667
           ++  +PDG ++
Sbjct: 541 SVAISPDGNFL 551



>sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit
           5 (Transcription initiation factor TFIID 85 kDa subunit)
           (p85) (TAFII-80).>gb:AE013599_1131167 Drosophila
           melanogaster chromosome 2R, complete
           sequence.>gb:AE003828_1226555 Drosophila melanogaster
           chromosome 2R, section 22 of 74 of the complete
           sequence.>gb:AY051960_1290554 Drosophila melanogaster
           LD42828 full length cDNA.>gb:DMU06460_1380369 Drosophila
           melanogaster transcription initiation factor TFIID 85
           kDa subunit mRNA, complete cds.
          Length = 704

 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 40/124 (32%), Positives = 64/124 (51%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           F++   D +  LW+     +     GH S V+ + F      VA GSS   ++LWD    
Sbjct: 507 FVSCSYDKTARLWATDSNQALRVFVGHLSDVDCVQFHPNSNYVATGSSDRTVRLWDNMTG 566

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
           + +R ++GH+   ++L F   G + ASGS+D N+ IWD+     + T   HT  ++TI F
Sbjct: 567 QSVRLMTGHKGSVSSLAFSACGRYLASGSVDHNIIIWDLSNGSLVTTLLRHTSTVTTITF 626

Query: 647 TPDG 658
           + DG
Sbjct: 627 SRDG 630



 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 41/124 (33%), Positives = 62/124 (50%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           L+ FV H  +V+C++F   +     TG  D +V LW      S   ++GH   V S+AF 
Sbjct: 527 LRVFVGHLSDVDCVQFHPNS-NYVATGSSDRTVRLWDNMTGQSVRLMTGHKGSVSSLAFS 585

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
           +    +A+GS    I +WDL +  ++ TL  H S  T + F   G   A+  +D NL +W
Sbjct: 586 ACGRYLASGSVDHNIIIWDLSNGSLVTTLLRHTSTVTTITFSRDGTVLAAAGLDNNLTLW 645

Query: 578 DIRK 589
           D  K
Sbjct: 646 DFHK 649



 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 38/155 (24%), Positives = 70/155 (45%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           + G   +  + H+G V    F  +   + L+  +D ++ LWS+   +   T  GH  PV 
Sbjct: 438 RSGEVTRSLMGHTGPVYRCAFAPEM-NLLLSCSEDSTIRLWSLLTWSCVVTYRGHVYPVW 496

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
            + F        + S     +LW  +  + +R   GH S    ++FHP   + A+GS D 
Sbjct: 497 DVRFAPHGYYFVSCSYDKTARLWATDSNQALRVFVGHLSDVDCVQFHPNSNYVATGSSDR 556

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            +++WD      +    GH   +S++ F+  GR++
Sbjct: 557 TVRLWDNMTGQSVRLMTGHKGSVSSLAFSACGRYL 591



 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 40/146 (27%), Positives = 63/146 (43%)
 Frame = +2

Query: 233 AHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEIL 412
           +H G V C      +  M   G  D SV +WS+  P    TL    S +  +  +SA+I 
Sbjct: 376 SHQG-VTCAEISDDST-MLACGFGDSSVRIWSL-TPAKLRTLKDADS-LRELDKESADIN 431

Query: 413 VAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKK 592
           V         ++ D    ++ R+L GH        F P      S S D+ +++W +   
Sbjct: 432 V---------RMLDDRSGEVTRSLMGHTGPVYRCAFAPEMNLLLSCSEDSTIRLWSLLTW 482

Query: 593 GCIHTYKGHTRGISTIRFTPDGRWVV 670
            C+ TY+GH   +  +RF P G + V
Sbjct: 483 SCVVTYRGHVYPVWDVRFAPHGYYFV 508



>gb:BC049122_2099936 Mus musculus APG16 autophagy 16-like (S.
           cerevisiae), mRNA (cDNA clone MGC:61241 IMAGE:6813377),
           complete cds.
          Length = 623

 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 47/129 (36%), Positives = 67/129 (51%), Gaps = 2/129 (1%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSI--GKPTSTSTLSGHTSPVESIAFDS 400
           F AH G VN ++F   + R+  TGG D  V LW     K     +LSG  + + SI FDS
Sbjct: 334 FDAHDGEVNAVQFSPGS-RLLATGGMDRRVKLWEAFGDKCEFKGSLSGSNAGITSIEFDS 392

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
           A   + A S+    ++W ++D ++  TL+GH     + +F        SGS D  LK+WD
Sbjct: 393 AGAYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWD 452

Query: 581 IRKKGCIHT 607
           +R K CI T
Sbjct: 453 LRSKVCIKT 461



 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 32/126 (25%), Positives = 55/126 (43%), Gaps = 3/126 (2%)
 Frame = +2

Query: 302 DDHSVNLWSIGKPTSTS-TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDL--EDTKM 472
           D H  +   +  PT+ S     H   V ++ F     L+A G     +KLW+   +  + 
Sbjct: 315 DTHPASGKDVRVPTTASYVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEAFGDKCEF 374

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
             +LSG  +  T++EF   G +  + S D   +IW +      HT  GH+  + + +F  
Sbjct: 375 KGSLSGSNAGITSIEFDSAGAYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLL 434

Query: 653 DGRWVV 670
           D   +V
Sbjct: 435 DNARIV 440



 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 29/108 (26%), Positives = 46/108 (42%), Gaps = 4/108 (3%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           L   +D +  +W++       TL+GH+  V S  F      + +GS    +KLWDL    
Sbjct: 398 LAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKV 457

Query: 470 MIRTLSGHRS----YCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCI 601
            I+T+    S     CT        +   SG  D  ++ WDIR +  +
Sbjct: 458 CIKTVFAGSSCNDIVCTE-------QCVMSGHFDKKIRFWDIRSESVV 498



 Score = 35.8 bits (81), Expect = 0.69
 Identities = 29/133 (21%), Positives = 56/133 (42%), Gaps = 6/133 (4%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           ++G  D  +  W I   +    +      + ++  +     + + S   L+K+ DL    
Sbjct: 479 MSGHFDKKIRFWDIRSESVVREME-LLGKITALDLNPERTELLSCSRDDLLKVIDLRTNA 537

Query: 470 MIRTLSGHRSYC----TALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTY--KGHTRGI 631
           + +T S     C    T + F P G + A+GS + +L +W +   G +     K H+  I
Sbjct: 538 VKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYVWSV-LTGKVEKVLSKQHSSSI 596

Query: 632 STIRFTPDGRWVV 670
           + + + P G  VV
Sbjct: 597 NAVAWAPSGLHVV 609



>gb:AB087881_2047869 Mus musculus mRNA for Apg16L gamma, complete
           cds.
          Length = 623

 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 47/129 (36%), Positives = 67/129 (51%), Gaps = 2/129 (1%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSI--GKPTSTSTLSGHTSPVESIAFDS 400
           F AH G VN ++F   + R+  TGG D  V LW     K     +LSG  + + SI FDS
Sbjct: 334 FDAHDGEVNAVQFSPGS-RLLATGGMDRRVKLWEAFGDKCEFKGSLSGSNAGITSIEFDS 392

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
           A   + A S+    ++W ++D ++  TL+GH     + +F        SGS D  LK+WD
Sbjct: 393 AGAYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWD 452

Query: 581 IRKKGCIHT 607
           +R K CI T
Sbjct: 453 LRSKVCIKT 461



 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 32/126 (25%), Positives = 55/126 (43%), Gaps = 3/126 (2%)
 Frame = +2

Query: 302 DDHSVNLWSIGKPTSTS-TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDL--EDTKM 472
           D H  +   +  PT+ S     H   V ++ F     L+A G     +KLW+   +  + 
Sbjct: 315 DTHPASGKDVRVPTTASYVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEAFGDKCEF 374

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
             +LSG  +  T++EF   G +  + S D   +IW +      HT  GH+  + + +F  
Sbjct: 375 KGSLSGSNAGITSIEFDSAGAYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLL 434

Query: 653 DGRWVV 670
           D   +V
Sbjct: 435 DNARIV 440



 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 29/108 (26%), Positives = 46/108 (42%), Gaps = 4/108 (3%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           L   +D +  +W++       TL+GH+  V S  F      + +GS    +KLWDL    
Sbjct: 398 LAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKV 457

Query: 470 MIRTLSGHRS----YCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCI 601
            I+T+    S     CT        +   SG  D  ++ WDIR +  +
Sbjct: 458 CIKTVFAGSSCNDIVCTE-------QCVMSGHFDKKIRFWDIRSESVV 498



 Score = 35.8 bits (81), Expect = 0.69
 Identities = 29/133 (21%), Positives = 56/133 (42%), Gaps = 6/133 (4%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           ++G  D  +  W I   +    +      + ++  +     + + S   L+K+ DL    
Sbjct: 479 MSGHFDKKIRFWDIRSESVVREME-LLGKITALDLNPERTELLSCSRDDLLKVIDLRTNA 537

Query: 470 MIRTLSGHRSYC----TALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTY--KGHTRGI 631
           + +T S     C    T + F P G + A+GS + +L +W +   G +     K H+  I
Sbjct: 538 VKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYVWSV-LTGKVEKVLSKQHSSSI 596

Query: 632 STIRFTPDGRWVV 670
           + + + P G  VV
Sbjct: 597 NAVAWAPSGLHVV 609



>gb:AB087880_2047868 Mus musculus mRNA for Apg16L beta, complete
           cds.
          Length = 607

 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 47/129 (36%), Positives = 67/129 (51%), Gaps = 2/129 (1%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSI--GKPTSTSTLSGHTSPVESIAFDS 400
           F AH G VN ++F   + R+  TGG D  V LW     K     +LSG  + + SI FDS
Sbjct: 318 FDAHDGEVNAVQFSPGS-RLLATGGMDRRVKLWEAFGDKCEFKGSLSGSNAGITSIEFDS 376

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
           A   + A S+    ++W ++D ++  TL+GH     + +F        SGS D  LK+WD
Sbjct: 377 AGAYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWD 436

Query: 581 IRKKGCIHT 607
           +R K CI T
Sbjct: 437 LRSKVCIKT 445



 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 32/126 (25%), Positives = 55/126 (43%), Gaps = 3/126 (2%)
 Frame = +2

Query: 302 DDHSVNLWSIGKPTSTS-TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDL--EDTKM 472
           D H  +   +  PT+ S     H   V ++ F     L+A G     +KLW+   +  + 
Sbjct: 299 DTHPASGKDVRVPTTASYVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEAFGDKCEF 358

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
             +LSG  +  T++EF   G +  + S D   +IW +      HT  GH+  + + +F  
Sbjct: 359 KGSLSGSNAGITSIEFDSAGAYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLL 418

Query: 653 DGRWVV 670
           D   +V
Sbjct: 419 DNARIV 424



 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 29/108 (26%), Positives = 46/108 (42%), Gaps = 4/108 (3%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           L   +D +  +W++       TL+GH+  V S  F      + +GS    +KLWDL    
Sbjct: 382 LAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKV 441

Query: 470 MIRTLSGHRS----YCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCI 601
            I+T+    S     CT        +   SG  D  ++ WDIR +  +
Sbjct: 442 CIKTVFAGSSCNDIVCTE-------QCVMSGHFDKKIRFWDIRSESVV 482



 Score = 35.8 bits (81), Expect = 0.69
 Identities = 29/133 (21%), Positives = 56/133 (42%), Gaps = 6/133 (4%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           ++G  D  +  W I   +    +      + ++  +     + + S   L+K+ DL    
Sbjct: 463 MSGHFDKKIRFWDIRSESVVREME-LLGKITALDLNPERTELLSCSRDDLLKVIDLRTNA 521

Query: 470 MIRTLSGHRSYC----TALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTY--KGHTRGI 631
           + +T S     C    T + F P G + A+GS + +L +W +   G +     K H+  I
Sbjct: 522 VKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYVWSV-LTGKVEKVLSKQHSSSI 580

Query: 632 STIRFTPDGRWVV 670
           + + + P G  VV
Sbjct: 581 NAVAWAPSGLHVV 593



>gb:AB087879_2047867 Mus musculus mRNA for Apg16L alpha, complete
           cds.
          Length = 588

 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 47/129 (36%), Positives = 67/129 (51%), Gaps = 2/129 (1%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSI--GKPTSTSTLSGHTSPVESIAFDS 400
           F AH G VN ++F   + R+  TGG D  V LW     K     +LSG  + + SI FDS
Sbjct: 299 FDAHDGEVNAVQFSPGS-RLLATGGMDRRVKLWEAFGDKCEFKGSLSGSNAGITSIEFDS 357

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
           A   + A S+    ++W ++D ++  TL+GH     + +F        SGS D  LK+WD
Sbjct: 358 AGAYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWD 417

Query: 581 IRKKGCIHT 607
           +R K CI T
Sbjct: 418 LRSKVCIKT 426



 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 32/126 (25%), Positives = 55/126 (43%), Gaps = 3/126 (2%)
 Frame = +2

Query: 302 DDHSVNLWSIGKPTSTS-TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDL--EDTKM 472
           D H  +   +  PT+ S     H   V ++ F     L+A G     +KLW+   +  + 
Sbjct: 280 DTHPASGKDVRVPTTASYVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEAFGDKCEF 339

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
             +LSG  +  T++EF   G +  + S D   +IW +      HT  GH+  + + +F  
Sbjct: 340 KGSLSGSNAGITSIEFDSAGAYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLL 399

Query: 653 DGRWVV 670
           D   +V
Sbjct: 400 DNARIV 405



 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 29/108 (26%), Positives = 46/108 (42%), Gaps = 4/108 (3%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           L   +D +  +W++       TL+GH+  V S  F      + +GS    +KLWDL    
Sbjct: 363 LAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKV 422

Query: 470 MIRTLSGHRS----YCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCI 601
            I+T+    S     CT        +   SG  D  ++ WDIR +  +
Sbjct: 423 CIKTVFAGSSCNDIVCTE-------QCVMSGHFDKKIRFWDIRSESVV 463



 Score = 35.8 bits (81), Expect = 0.69
 Identities = 29/133 (21%), Positives = 56/133 (42%), Gaps = 6/133 (4%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           ++G  D  +  W I   +    +      + ++  +     + + S   L+K+ DL    
Sbjct: 444 MSGHFDKKIRFWDIRSESVVREME-LLGKITALDLNPERTELLSCSRDDLLKVIDLRTNA 502

Query: 470 MIRTLSGHRSYC----TALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTY--KGHTRGI 631
           + +T S     C    T + F P G + A+GS + +L +W +   G +     K H+  I
Sbjct: 503 VKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYVWSV-LTGKVEKVLSKQHSSSI 561

Query: 632 STIRFTPDGRWVV 670
           + + + P G  VV
Sbjct: 562 NAVAWAPSGLHVV 574



>gb:AF090988_1882483 Homo sapiens U5 snRNP-specific 40 kDa protein
           mRNA, complete cds.
          Length = 357

 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 43/161 (26%), Positives = 79/161 (49%), Gaps = 8/161 (4%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           ++ G +++    H+  VN     +K+ ++  TG DD +V LW I K  +  T   +T  V
Sbjct: 138 SETGERVKRLKGHTSFVNSCYPARKSPQLVCTGSDDGTVKLWDIRKKAAIQTFQ-NTYQV 196

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
            ++ F+     + +G     IK+WDL   K+  T+ GH    T L     G +  S +MD
Sbjct: 197 LAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTGLSLSSEGSYLLSNAMD 256

Query: 560 TNLKIWDIR----KKGCIHTYKGHT----RGISTIRFTPDG 658
             +++WD+R    K+ C+  ++G+     + +    ++PDG
Sbjct: 257 NTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDG 297



 Score = 67.4 bits (163), Expect = 2e-10
 Identities = 42/147 (28%), Positives = 71/147 (48%), Gaps = 2/147 (1%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI--AFDSAEI 409
           HSG V  L +      +F +   D +V +W          L GHTS V S   A  S + 
Sbjct: 108 HSGAVMELHYNTDGSMLF-SASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARKSPQ- 165

Query: 410 LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRK 589
           LV  GS  G +KLWD+     I+T   +     A+ F+   +   SG +D ++K+WD+R+
Sbjct: 166 LVCTGSDDGTVKLWDIRKKAAIQTFQ-NTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQ 224

Query: 590 KGCIHTYKGHTRGISTIRFTPDGRWVV 670
               +T +GH   ++ +  + +G +++
Sbjct: 225 NKLTYTMRGHADSVTGLSLSSEGSYLL 251



 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 37/130 (28%), Positives = 66/130 (50%), Gaps = 4/130 (3%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSI-GKPTSTSTLSGHTSPVESIAFDSAEIL 412
           H G V C +F      +  + G D  + LW++ G   + +TL GH+  V  + +++   +
Sbjct: 65  HEGEVYCCKFHPNGSTL-ASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSM 123

Query: 413 VAAGSSSGLIKLWDLEDTKMIRTLSGHRSY---CTALEFHPFGEFFASGSMDTNLKIWDI 583
           + + S+   + +WD E  + ++ L GH S+   C      P  +   +GS D  +K+WDI
Sbjct: 124 LFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARKSP--QLVCTGSDDGTVKLWDI 181

Query: 584 RKKGCIHTYK 613
           RKK  I T++
Sbjct: 182 RKKAAIQTFQ 191



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 27/95 (28%), Positives = 39/95 (41%), Gaps = 1/95 (1%)
 Frame = +2

Query: 356 LSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE-DTKMIRTLSGHRSYCTALEFHPFG 532
           LSGH   V    F      +A+     LI LW++  D     TL GH      L ++  G
Sbjct: 62  LSGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDG 121

Query: 533 EFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIST 637
               S S D  + +WD      +   KGHT  +++
Sbjct: 122 SMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNS 156



 Score = 37.0 bits (84), Expect = 0.31
 Identities = 17/58 (29%), Positives = 28/58 (48%)
 Frame = +2

Query: 413 VAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
           +AAGS+   + +WD    +++  L GH      + FHP      S S D  L + +I+
Sbjct: 300 IAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ 357



 Score = 37.0 bits (84), Expect = 0.31
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 2/64 (3%)
 Frame = +2

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIH--TYKGHTRGISTIRF 646
           I  LSGH       +FHP G   AS   D  + +W++    C +  T KGH+  +  + +
Sbjct: 59  IMLLSGHEGEVYCCKFHPNGSTLASAGFDRLILLWNV-YGDCDNYATLKGHSGAVMELHY 117

Query: 647 TPDG 658
             DG
Sbjct: 118 NTDG 121



>gb:AX883194_1479234 Sequence 18099 from Patent
           EP1074617.>gb:AK027854_1911273 Homo sapiens cDNA
           FLJ14948 fis, clone PLACE2000164, weakly similar to TIPD
           PROTEIN.
          Length = 504

 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 47/129 (36%), Positives = 67/129 (51%), Gaps = 2/129 (1%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSI--GKPTSTSTLSGHTSPVESIAFDS 400
           F AH G VN  +F   + R+  TGG D  V LW +   K     +LSG  + + SI FDS
Sbjct: 215 FDAHDGEVNAAQFSPGS-RLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDS 273

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
           A   + A S+    ++W ++D ++  TL+GH     + +F        SGS D  LK+WD
Sbjct: 274 AGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWD 333

Query: 581 IRKKGCIHT 607
           +R K CI T
Sbjct: 334 LRSKVCIKT 342



 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 29/112 (25%), Positives = 49/112 (43%), Gaps = 2/112 (1%)
 Frame = +2

Query: 341 TSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDL--EDTKMIRTLSGHRSYCTAL 514
           T+      H   V +  F     L+A G     +KLW++  E  +   +LSG  +  T++
Sbjct: 210 TALCVFDAHDGEVNAAQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSI 269

Query: 515 EFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           EF   G +  + S D   +IW +      HT  GH+  + + +F  D   +V
Sbjct: 270 EFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIV 321



 Score = 37.0 bits (84), Expect = 0.31
 Identities = 30/133 (22%), Positives = 57/133 (42%), Gaps = 6/133 (4%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           ++G  D  +  W I   +    +      + ++  +     + + S   L+K+ DL    
Sbjct: 360 MSGHFDKKIRFWDIRSESIVREME-LLGKITALDLNPERTELLSCSRDDLLKVIDLRTNA 418

Query: 470 MIRTLSGHRSYC----TALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTY--KGHTRGI 631
           + +T S     C    T + F P G + A+GS + +L IW +   G +     K H+  I
Sbjct: 419 IKQTFSATGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSV-LTGKVEKVLSKQHSSSI 477

Query: 632 STIRFTPDGRWVV 670
           + + ++P G  VV
Sbjct: 478 NAVAWSPSGSHVV 490



>gb:AF164430_1246631 Caenorhabditis elegans LIS-1 (lis-1) mRNA,
           complete cds.>gb:CET03F6_1367086 Caenorhabditis elegans
           cosmid T03F6, complete sequence.
          Length = 404

 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 42/120 (35%), Positives = 63/120 (52%), Gaps = 1/120 (0%)
 Frame = +2

Query: 302 DDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT-KMIR 478
           +D ++ +W         TL GHT  V  IA D+A   + + SS   IKLWD   T   ++
Sbjct: 126 EDATIKVWDYETGQLERTLKGHTDAVNDIAIDAAGKQLVSCSSDLSIKLWDFGQTYDCLK 185

Query: 479 TLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           +L GH    +++ F P G+F  S S D  +K WDI    C++T++GH   +  IR + DG
Sbjct: 186 SLKGHEHTVSSVTFLPTGDFVLSASRDHTIKQWDISTGYCVYTFRGHNDWVRMIRISNDG 245



 Score = 72.4 bits (176), Expect = 7e-12
 Identities = 36/115 (31%), Positives = 59/115 (51%), Gaps = 1/115 (0%)
 Frame = +2

Query: 329 IGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           I +P  T  L+GH  P+  + F     ++A+ S    IK+WD E  ++ RTL GH     
Sbjct: 93  IPRPPETQKLTGHRLPITRVIFHPLWTIMASCSEDATIKVWDYETGQLERTLKGHTDAVN 152

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDI-RKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            +     G+   S S D ++K+WD  +   C+ + KGH   +S++ F P G +V+
Sbjct: 153 DIAIDAAGKQLVSCSSDLSIKLWDFGQTYDCLKSLKGHEHTVSSVTFLPTGDFVL 207



 Score = 65.9 bits (159), Expect = 6e-10
 Identities = 41/170 (24%), Positives = 74/170 (43%), Gaps = 16/170 (9%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           GY +  F  H+  V  +R       +F +   D +V +WS    ++   L  H   VE +
Sbjct: 223 GYCVYTFRGHNDWVRMIRISNDGT-LFASASLDQTVTVWSFATKSAKLVLRDHEHAVECV 281

Query: 389 AF----------------DSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEF 520
            +                +S  IL + GS    IK W++    ++ TL  H ++   L F
Sbjct: 282 EWAPDTAYTNVTGQQPEGNSTHILFS-GSRDRSIKAWNINTGDVLFTLLAHENWVRGLAF 340

Query: 521 HPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           HP G++  S + D  L++W++  + C+   + H   +ST+ F     +V+
Sbjct: 341 HPKGKYLISVADDKTLRVWELSAQRCMKAIEAHEHFVSTVAFHQTSPFVI 390



 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 31/126 (24%), Positives = 50/126 (39%), Gaps = 1/126 (0%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTST-STLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDL 457
           +  ++   D S+ LW  G+      +L GH   V S+ F      V + S    IK WD+
Sbjct: 161 KQLVSCSSDLSIKLWDFGQTYDCLKSLKGHEHTVSSVTFLPTGDFVLSASRDHTIKQWDI 220

Query: 458 EDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIST 637
                + T  GH  +   +     G  FAS S+D  + +W    K      + H   +  
Sbjct: 221 STGYCVYTFRGHNDWVRMIRISNDGTLFASASLDQTVTVWSFATKSAKLVLRDHEHAVEC 280

Query: 638 IRFTPD 655
           + + PD
Sbjct: 281 VEWAPD 286



 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 23/101 (22%), Positives = 48/101 (47%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           +  +G  D S+  W+I       TL  H + V  +AF      + + +    +++W+L  
Sbjct: 304 ILFSGSRDRSIKAWNINTGDVLFTLLAHENWVRGLAFHPKGKYLISVADDKTLRVWELSA 363

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            + ++ +  H  + + + FH    F  +GS+D + K+W+ R
Sbjct: 364 QRCMKAIEAHEHFVSTVAFHQTSPFVITGSVDMSCKVWECR 404



 Score = 32.7 bits (73), Expect = 5.9
 Identities = 20/82 (24%), Positives = 33/82 (40%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L   +AH   V  L F  K  +  ++  DD ++ +W +        +  H   V ++
Sbjct: 322 GDVLFTLLAHENWVRGLAFHPKG-KYLISVADDKTLRVWELSAQRCMKAIEAHEHFVSTV 380

Query: 389 AFDSAEILVAAGSSSGLIKLWD 454
           AF      V  GS     K+W+
Sbjct: 381 AFHQTSPFVITGSVDMSCKVWE 402



>gb:AF098070_1240741 Drosophila melanogaster Lis1 homolog mRNA,
           complete cds.
          Length = 409

 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 37/126 (29%), Positives = 69/126 (54%), Gaps = 1/126 (0%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  +D ++ +W         +L GHT  V+ +AFD+   L+A+ S+   IKLWD + 
Sbjct: 120 LMVSASEDATIRIWDFETGEYERSLKGHTDSVQDVAFDAQGKLLASCSADLSIKLWDFQQ 179

Query: 464 T-KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
           + + I+T+ GH    +++ F P G++  S S D  +K+W++    C+ TY GH   +  +
Sbjct: 180 SYECIKTMHGHDHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTGHREWVRMV 239

Query: 641 RFTPDG 658
           R   +G
Sbjct: 240 RVHIEG 245



 Score = 73.6 bits (179), Expect = 3e-12
 Identities = 30/98 (30%), Positives = 55/98 (56%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +G  D ++ +W +       TLSGH + V  +AF      + + S    I++WDL + + 
Sbjct: 312 SGSRDKTIRIWDVSVGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDLRNKRC 371

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
           ++TL  H+ +CT+++FH    +  SGS+D  +K+W+ R
Sbjct: 372 MKTLYAHQHFCTSIDFHKAHPYVISGSVDQTVKVWECR 409



 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 35/115 (30%), Positives = 59/115 (51%), Gaps = 1/115 (0%)
 Frame = +2

Query: 329 IGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           I +P    +L+GH + +  + F     L+ + S    I++WD E  +  R+L GH     
Sbjct: 93  IPRPPEKFSLTGHRASITRVIFHPIFALMVSASEDATIRIWDFETGEYERSLKGHTDSVQ 152

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKK-GCIHTYKGHTRGISTIRFTPDGRWVV 670
            + F   G+  AS S D ++K+WD ++   CI T  GH   +S++ F P G +V+
Sbjct: 153 DVAFDAQGKLLASCSADLSIKLWDFQQSYECIKTMHGHDHNVSSVAFVPAGDYVL 207



 Score = 68.9 bits (167), Expect = 7e-11
 Identities = 43/166 (25%), Positives = 71/166 (42%), Gaps = 20/166 (12%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           GY ++ +  H   V  +R   +   +F T  +D ++ +W          L  H   VE I
Sbjct: 223 GYCVKTYTGHREWVRMVRVHIEGS-IFATCSNDQTIRVWLTNSKDCKVELRDHEHTVECI 281

Query: 389 AFDSAEI--------------------LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           A+                          +A+GS    I++WD+     + TLSGH ++  
Sbjct: 282 AWAPEAAASAINEAAGADNKKGHHQGPFLASGSRDKTIRIWDVSVGLCLLTLSGHDNWVR 341

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
            L FHP G++  S S D  +++WD+R K C+ T   H    ++I F
Sbjct: 342 GLAFHPGGKYLVSASDDKTIRVWDLRNKRCMKTLYAHQHFCTSIDF 387



 Score = 62.8 bits (151), Expect = 5e-09
 Identities = 33/118 (27%), Positives = 54/118 (45%), Gaps = 1/118 (0%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTST-STLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRT 481
           D S+ LW   +      T+ GH   V S+AF  A   V + S    IK+W++     ++T
Sbjct: 169 DLSIKLWDFQQSYECIKTMHGHDHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKT 228

Query: 482 LSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
            +GHR +   +  H  G  FA+ S D  +++W    K C    + H   +  I + P+
Sbjct: 229 YTGHREWVRMVRVHIEGSIFATCSNDQTIRVWLTNSKDCKVELRDHEHTVECIAWAPE 286



 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 35/147 (23%), Positives = 59/147 (40%), Gaps = 20/147 (13%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLW--DLED 463
           L+   D ++ +W +       T +GH   V  +       + A  S+   I++W  + +D
Sbjct: 207 LSASRDRTIKMWEVATGYCVKTYTGHREWVRMVRVHIEGSIFATCSNDQTIRVWLTNSKD 266

Query: 464 TKMIRTLSGHRSYCTAL------------------EFHPFGEFFASGSMDTNLKIWDIRK 589
            K+      H   C A                   + H  G F ASGS D  ++IWD+  
Sbjct: 267 CKVELRDHEHTVECIAWAPEAAASAINEAAGADNKKGHHQGPFLASGSRDKTIRIWDVSV 326

Query: 590 KGCIHTYKGHTRGISTIRFTPDGRWVV 670
             C+ T  GH   +  + F P G+++V
Sbjct: 327 GLCLLTLSGHDNWVRGLAFHPGGKYLV 353



 Score = 33.5 bits (75), Expect = 3.4
 Identities = 15/58 (25%), Positives = 26/58 (44%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           +  ++  DD ++ +W +       TL  H     SI F  A   V +GS    +K+W+
Sbjct: 350 KYLVSASDDKTIRVWDLRNKRCMKTLYAHQHFCTSIDFHKAHPYVISGSVDQTVKVWE 407



>gb:CR859089_1183226 Pongo pygmaeus mRNA; cDNA DKFZp469O1320 (from
           clone DKFZp469O1320).
          Length = 607

 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 47/129 (36%), Positives = 68/129 (52%), Gaps = 2/129 (1%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSI--GKPTSTSTLSGHTSPVESIAFDS 400
           F AH G VN ++F   + R+  TGG D  V LW +   K     +LSG  + + SI FDS
Sbjct: 318 FDAHDGEVNAVQFSPGS-RLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDS 376

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
           A   + A S+    ++W ++D+++  TL+GH     + +F        SGS D  LK WD
Sbjct: 377 AGSYLLAASNDFASRIWTVDDSRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKHWD 436

Query: 581 IRKKGCIHT 607
           +R K CI T
Sbjct: 437 LRSKVCIKT 445



 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 29/112 (25%), Positives = 50/112 (44%), Gaps = 2/112 (1%)
 Frame = +2

Query: 341 TSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDL--EDTKMIRTLSGHRSYCTAL 514
           T+      H   V ++ F     L+A G     +KLW++  E  +   +LSG  +  T++
Sbjct: 313 TALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSI 372

Query: 515 EFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           EF   G +  + S D   +IW +      HT  GH+  + + +F  D   +V
Sbjct: 373 EFDSAGSYLLAASNDFASRIWTVDDSRLRHTLTGHSGKVLSAKFLLDNARIV 424



 Score = 45.4 bits (106), Expect = 9e-04
 Identities = 28/108 (25%), Positives = 45/108 (41%), Gaps = 4/108 (3%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           L   +D +  +W++       TL+GH+  V S  F      + +GS    +K WDL    
Sbjct: 382 LAASNDFASRIWTVDDSRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKHWDLRSKV 441

Query: 470 MIRTLSGHRS----YCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCI 601
            I+T+    S     CT        +   SG  D  ++ WDIR +  +
Sbjct: 442 CIKTVFAGSSCNDIVCTE-------QCVMSGHFDKKIRFWDIRSESIV 482



 Score = 36.6 bits (83), Expect = 0.41
 Identities = 18/71 (25%), Positives = 33/71 (46%), Gaps = 2/71 (2%)
 Frame = +2

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIH--TYKGHTRGIST 637
           T  +     H     A++F P     A+G MD  +K+W++  + C    +  G   GI++
Sbjct: 312 TTALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITS 371

Query: 638 IRFTPDGRWVV 670
           I F   G +++
Sbjct: 372 IEFDSAGSYLL 382



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 29/133 (21%), Positives = 56/133 (42%), Gaps = 6/133 (4%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           ++G  D  +  W I   +    +      + ++  +     + + S   L+K+ DL    
Sbjct: 463 MSGHFDKKIRFWDIRSESIVREME-LLGKITALDLNPERTELLSCSRDDLLKVIDLRTNA 521

Query: 470 MIRTLSGHRSYC----TALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTY--KGHTRGI 631
           + +T S     C    T + F P G + A+GS + +L  W +   G +     K H+  I
Sbjct: 522 IKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYTWSV-LTGKVEKVLSKQHSSSI 580

Query: 632 STIRFTPDGRWVV 670
           + + ++P G  VV
Sbjct: 581 NAVAWSPSGLHVV 593



>gb:AK030983_1162244 Mus musculus adult male thymus cDNA, RIKEN
           full-length enriched library, clone:5830475I01
           product:CDNA FLJ14948 FIS, CLONE PLACE2000164, WEAKLY
           SIMILAR TO TIPD PROTEIN homolog [Homo sapiens], full
           insert sequence.
          Length = 607

 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 47/129 (36%), Positives = 67/129 (51%), Gaps = 2/129 (1%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSI--GKPTSTSTLSGHTSPVESIAFDS 400
           F AH G VN ++F   + R+  TGG D  V LW     K     +LSG  + + SI FDS
Sbjct: 318 FDAHDGEVNAVQFSPGS-RLLATGGMDRRVKLWEAFGDKCEFKGSLSGSNAGITSIEFDS 376

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
           A   + A S+    ++W ++D ++  TL+GH     + +F        SGS D  LK+WD
Sbjct: 377 AGAYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWD 436

Query: 581 IRKKGCIHT 607
           +R K CI T
Sbjct: 437 LRSKVCIKT 445



 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 32/126 (25%), Positives = 55/126 (43%), Gaps = 3/126 (2%)
 Frame = +2

Query: 302 DDHSVNLWSIGKPTSTS-TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDL--EDTKM 472
           D H  +   +  PT+ S     H   V ++ F     L+A G     +KLW+   +  + 
Sbjct: 299 DTHPASGKDVRVPTTASYVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEAFGDKCEF 358

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
             +LSG  +  T++EF   G +  + S D   +IW +      HT  GH+  + + +F  
Sbjct: 359 KGSLSGSNAGITSIEFDSAGAYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLL 418

Query: 653 DGRWVV 670
           D   +V
Sbjct: 419 DNARIV 424



 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 29/108 (26%), Positives = 46/108 (42%), Gaps = 4/108 (3%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           L   +D +  +W++       TL+GH+  V S  F      + +GS    +KLWDL    
Sbjct: 382 LAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKV 441

Query: 470 MIRTLSGHRS----YCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCI 601
            I+T+    S     CT        +   SG  D  ++ WDIR +  +
Sbjct: 442 CIKTVFAGSSCNDIVCTE-------QCVMSGHFDKKIRFWDIRSESVV 482



 Score = 35.8 bits (81), Expect = 0.69
 Identities = 29/133 (21%), Positives = 56/133 (42%), Gaps = 6/133 (4%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           ++G  D  +  W I   +    +      + ++  +     + + S   L+K+ DL    
Sbjct: 463 MSGHFDKKIRFWDIRSESVVREME-LLGKITALDLNPERTELLSCSRDDLLKVIDLRTNA 521

Query: 470 MIRTLSGHRSYC----TALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTY--KGHTRGI 631
           + +T S     C    T + F P G + A+GS + +L +W +   G +     K H+  I
Sbjct: 522 VKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYVWSV-LTGKVEKVLSKQHSSSI 580

Query: 632 STIRFTPDGRWVV 670
           + + + P G  VV
Sbjct: 581 NAVAWAPSGLHVV 593



>gb:AK012342_1156901 Mus musculus 11 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2700038L12
           product:MEIOTIC RECOMBINATION PROTEIN REC14
           (2810418I05RIK PROTEIN) homolog [Mus musculus], full
           insert sequence.
          Length = 305

 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 38/126 (30%), Positives = 64/126 (50%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +G  D  +N++ I       TL GH  P+ S+ F     L+   S  G IK++D++   +
Sbjct: 165 SGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANL 224

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
             TLSGH S+   + F P    F S   D ++K+WD+  + CIHT+  H   +  +++  
Sbjct: 225 AGTLSGHASWVLNVAFCPDDTHFVSSLSDKSVKVWDVGTRTCIHTFFDHQDQVWGVKYNG 284

Query: 653 DGRWVV 670
           +G  +V
Sbjct: 285 NGSKIV 290



 Score = 58.9 bits (141), Expect = 8e-08
 Identities = 32/121 (26%), Positives = 56/121 (46%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           TG     VN++ +       +L      + SIA+      +A+G+  G+I ++D+   K+
Sbjct: 123 TGTHMGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKL 182

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           + TL GH     +L F P  +   + S D  +KI+D++      T  GH   +  + F P
Sbjct: 183 LHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAFCP 242

Query: 653 D 655
           D
Sbjct: 243 D 243



 Score = 58.9 bits (141), Expect = 8e-08
 Identities = 29/122 (23%), Positives = 59/122 (48%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D  + LW +       ++        ++AF      +A G+  G + ++ +E  K   +L
Sbjct: 85  DAHIRLWDLENGKQMKSIDAGPVDAWTLAFSPDSQYLATGTHMGKVNIFGVESGKKEYSL 144

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
                +  ++ + P G++ ASG++D  + I+DI     +HT +GH   I ++ F+PD + 
Sbjct: 145 DTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQL 204

Query: 665 VV 670
           +V
Sbjct: 205 LV 206



 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 28/124 (22%), Positives = 53/124 (42%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L     H+  +  L F   + ++ +T  DD  + ++ +       TLSGH S V ++
Sbjct: 180 GKLLHTLEGHAMPIRSLTFSPDS-QLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNV 238

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           AF   +    +  S   +K+WD+     I T   H+     ++++  G    S   D  +
Sbjct: 239 AFCPDDTHFVSSLSDKSVKVWDVGTRTCIHTFFDHQDQVWGVKYNGNGSKIVSVGDDQEI 298

Query: 569 KIWD 580
            ++D
Sbjct: 299 HVYD 302



>gb:AE013599_1132149 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE013599_1132150 Drosophila melanogaster
           chromosome 2R, complete sequence.>gb:AE013599_1132151
           Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE013599_1132152 Drosophila melanogaster
           chromosome 2R, complete sequence.>gb:AE013599_1132153
           Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE013599_1132154 Drosophila melanogaster
           chromosome 2R, complete sequence.>gb:AE003808_1225603
           Drosophila melanogaster chromosome 2R, section 42 of 74
           of the complete sequence.>gb:AE003808_1225604 Drosophila
           melanogaster chromosome 2R, section 42 of 74 of the
           complete sequence.>gb:AE003808_1225605 Drosophila
           melanogaster chromosome 2R, section 42 of 74 of the
           complete sequence.>gb:AE003808_1225606 Drosophila
           melanogaster chromosome 2R, section 42 of 74 of the
           complete sequence.>gb:AE003808_1225607 Drosophila
           melanogaster chromosome 2R, section 42 of 74 of the
           complete sequence.>gb:AE003808_1225608 Drosophila
           melanogaster chromosome 2R, section 42 of 74 of the
           complete sequence.>gb:AF117606_1242609 Drosophila
           melanogaster lissencephaly-1 (Lis-1) mRNA, complete
           cds.>gb:AF152419_1245602 Drosophila melanogaster WD-40
           protein LIS1 (Lis1) mRNA, complete cds.
          Length = 411

 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 37/126 (29%), Positives = 69/126 (54%), Gaps = 1/126 (0%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++  +D ++ +W         +L GHT  V+ +AFD+   L+A+ S+   IKLWD + 
Sbjct: 122 LMVSASEDATIRIWDFETGEYERSLKGHTDSVQDVAFDAQGKLLASCSADLSIKLWDFQQ 181

Query: 464 T-KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
           + + I+T+ GH    +++ F P G++  S S D  +K+W++    C+ TY GH   +  +
Sbjct: 182 SYECIKTMHGHDHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKTYTGHREWVRMV 241

Query: 641 RFTPDG 658
           R   +G
Sbjct: 242 RVHIEG 247



 Score = 73.6 bits (179), Expect = 3e-12
 Identities = 30/98 (30%), Positives = 55/98 (56%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +G  D ++ +W +       TLSGH + V  +AF      + + S    I++WDL + + 
Sbjct: 314 SGSRDKTIRIWDVSVGLCLLTLSGHDNWVRGLAFHPGGKYLVSASDDKTIRVWDLRNKRC 373

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
           ++TL  H+ +CT+++FH    +  SGS+D  +K+W+ R
Sbjct: 374 MKTLYAHQHFCTSIDFHKAHPYVISGSVDQTVKVWECR 411



 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 35/115 (30%), Positives = 59/115 (51%), Gaps = 1/115 (0%)
 Frame = +2

Query: 329 IGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           I +P    +L+GH + +  + F     L+ + S    I++WD E  +  R+L GH     
Sbjct: 95  IPRPPEKFSLTGHRASITRVIFHPIFALMVSASEDATIRIWDFETGEYERSLKGHTDSVQ 154

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKK-GCIHTYKGHTRGISTIRFTPDGRWVV 670
            + F   G+  AS S D ++K+WD ++   CI T  GH   +S++ F P G +V+
Sbjct: 155 DVAFDAQGKLLASCSADLSIKLWDFQQSYECIKTMHGHDHNVSSVAFVPAGDYVL 209



 Score = 68.9 bits (167), Expect = 7e-11
 Identities = 43/166 (25%), Positives = 71/166 (42%), Gaps = 20/166 (12%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           GY ++ +  H   V  +R   +   +F T  +D ++ +W          L  H   VE I
Sbjct: 225 GYCVKTYTGHREWVRMVRVHIEGS-IFATCSNDQTIRVWLTNSKDCKVELRDHEHTVECI 283

Query: 389 AFDSAEI--------------------LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCT 508
           A+                          +A+GS    I++WD+     + TLSGH ++  
Sbjct: 284 AWAPEAAASAINEAAGADNKKGHHQGPFLASGSRDKTIRIWDVSVGLCLLTLSGHDNWVR 343

Query: 509 ALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
            L FHP G++  S S D  +++WD+R K C+ T   H    ++I F
Sbjct: 344 GLAFHPGGKYLVSASDDKTIRVWDLRNKRCMKTLYAHQHFCTSIDF 389



 Score = 62.8 bits (151), Expect = 5e-09
 Identities = 33/118 (27%), Positives = 54/118 (45%), Gaps = 1/118 (0%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTST-STLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRT 481
           D S+ LW   +      T+ GH   V S+AF  A   V + S    IK+W++     ++T
Sbjct: 171 DLSIKLWDFQQSYECIKTMHGHDHNVSSVAFVPAGDYVLSASRDRTIKMWEVATGYCVKT 230

Query: 482 LSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
            +GHR +   +  H  G  FA+ S D  +++W    K C    + H   +  I + P+
Sbjct: 231 YTGHREWVRMVRVHIEGSIFATCSNDQTIRVWLTNSKDCKVELRDHEHTVECIAWAPE 288



 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 35/147 (23%), Positives = 59/147 (40%), Gaps = 20/147 (13%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLW--DLED 463
           L+   D ++ +W +       T +GH   V  +       + A  S+   I++W  + +D
Sbjct: 209 LSASRDRTIKMWEVATGYCVKTYTGHREWVRMVRVHIEGSIFATCSNDQTIRVWLTNSKD 268

Query: 464 TKMIRTLSGHRSYCTAL------------------EFHPFGEFFASGSMDTNLKIWDIRK 589
            K+      H   C A                   + H  G F ASGS D  ++IWD+  
Sbjct: 269 CKVELRDHEHTVECIAWAPEAAASAINEAAGADNKKGHHQGPFLASGSRDKTIRIWDVSV 328

Query: 590 KGCIHTYKGHTRGISTIRFTPDGRWVV 670
             C+ T  GH   +  + F P G+++V
Sbjct: 329 GLCLLTLSGHDNWVRGLAFHPGGKYLV 355



 Score = 33.5 bits (75), Expect = 3.4
 Identities = 15/58 (25%), Positives = 26/58 (44%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           +  ++  DD ++ +W +       TL  H     SI F  A   V +GS    +K+W+
Sbjct: 352 KYLVSASDDKTIRVWDLRNKRCMKTLYAHQHFCTSIDFHKAHPYVISGSVDQTVKVWE 409



>pir|AG1889|AG1889 WD-40 repeat protein [imported] - Nostoc sp.
            (strain PCC 7120)>gb:BA000019_681656 Nostoc sp. PCC 7120
            DNA, complete genome.
          Length = 934

 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 44/127 (34%), Positives = 73/127 (57%)
 Frame = +2

Query: 281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
            ++  T G D +V +WSI       TL+GHTS + S+ F     L+A+ S    +K+W+L 
Sbjct: 753  KLIATAGWDKTVKIWSIDGRLQ-KTLTGHTSGINSVTFSPDGKLIASASWDNTVKIWNL- 810

Query: 461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
            D K +RTL GH++    + F P G+  A+ S D  +KIW+I  +  + T +G+   + ++
Sbjct: 811  DGKELRTLRGHKNVVHNVTFSPDGKLIATASGDNTVKIWNINGQE-LRTLRGYKDAVWSL 869

Query: 641  RFTPDGR 661
            RF+ DG+
Sbjct: 870  RFSLDGK 876



 Score = 78.6 bits (192), Expect = 9e-14
 Identities = 48/156 (30%), Positives = 79/156 (50%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           ++ G +L     H   V  + F   + ++  T   D++V LWS  +     TL GH   V
Sbjct: 396 SREGKRLHTLDGHKEAVLEVAFSPDS-QLLATASWDNTVKLWS-REGKLLHTLEGHKDKV 453

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
            SI F     L+A       +KLW+L D K +RT  GH+    ++ F P G+  A+ S D
Sbjct: 454 NSITFSPDGQLIATVGWDNTMKLWNL-DGKELRTFRGHQDMIWSVSFSPDGKQIATASGD 512

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
             +K+W +  K  + T +GH  G++++ F+PDG+ +
Sbjct: 513 RTVKLWSLDGKE-LQTLRGHQNGVNSVTFSPDGKLI 547



 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 46/154 (29%), Positives = 80/154 (51%), Gaps = 1/154 (0%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSI-GKPTSTSTLSGHTSP 376
           ++ G  L     H   VN + F     ++  T G D+++ LW++ GK     T  GH   
Sbjct: 437 SREGKLLHTLEGHKDKVNSITFSPDG-QLIATVGWDNTMKLWNLDGK--ELRTFRGHQDM 493

Query: 377 VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM 556
           + S++F      +A  S    +KLW L D K ++TL GH++   ++ F P G+  A+ S 
Sbjct: 494 IWSVSFSPDGKQIATASGDRTVKLWSL-DGKELQTLRGHQNGVNSVTFSPDGKLIATASG 552

Query: 557 DTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           D  +K+W+ + +  + T  GHT  ++++ F+PDG
Sbjct: 553 DRTVKLWNSKGQE-LETLYGHTDAVNSVAFSPDG 585



 Score = 75.9 bits (185), Expect = 6e-13
 Identities = 40/128 (31%), Positives = 67/128 (52%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           +  TG  D++  +WS  +     TL GH   V  +AF     L+A  S    +KLW  E 
Sbjct: 382 LMATGSWDNTAKIWS-REGKRLHTLDGHKEAVLEVAFSPDSQLLATASWDNTVKLWSREG 440

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
            K++ TL GH+    ++ F P G+  A+   D  +K+W++  K  + T++GH   I ++ 
Sbjct: 441 -KLLHTLEGHKDKVNSITFSPDGQLIATVGWDNTMKLWNLDGKE-LRTFRGHQDMIWSVS 498

Query: 644 FTPDGRWV 667
           F+PDG+ +
Sbjct: 499 FSPDGKQI 506



 Score = 72.4 bits (176), Expect = 7e-12
 Identities = 43/157 (27%), Positives = 74/157 (47%), Gaps = 3/157 (1%)
 Frame = +2

Query: 206  RGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVES 385
            +G +L+    H+  VN + F      +  T G+D +  +W +  P S   + GH   V  
Sbjct: 562  KGQELETLYGHTDAVNSVAFSPDGTSI-ATAGNDKTAKIWKLNSPNSI-IVRGHEDEVFD 619

Query: 386  IAFDSAEILVAAGSSSGLIKLWDLEDTKM--IRTLSGHRSYCTALEFHPFGEFFASGSMD 559
            + F      +A  S     KLW +   K+  +RT +GH+     L F P G++ A+ S D
Sbjct: 620  LVFSPNGKYIATASWDKTAKLWSIVGDKLQELRTFNGHQGRVNKLSFSPDGKYIATTSWD 679

Query: 560  TNLKIWDIRKKGCIH-TYKGHTRGISTIRFTPDGRWV 667
               K+W++   G +  T  GH   + ++ F+PDG+ +
Sbjct: 680  KTAKLWNL--DGTLQKTLTGHKDTVWSVNFSPDGQLI 714



 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 54/196 (27%), Positives = 81/196 (41%), Gaps = 43/196 (21%)
 Frame = +2

Query: 209  GYKLQE---FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            G KLQE   F  H G VN L F     +   T   D +  LW++   T   TL+GH   V
Sbjct: 645  GDKLQELRTFNGHQGRVNKLSFSPDG-KYIATTSWDKTAKLWNLDG-TLQKTLTGHKDTV 702

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLE--------------------------------- 460
             S+ F     L+A  S    +KLW+ +                                 
Sbjct: 703  WSVNFSPDGQLIATASEDKTVKLWNRDGELLKTLPRQSSVVNSAVFSPDGKLIATAGWDK 762

Query: 461  -------DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGH 619
                   D ++ +TL+GH S   ++ F P G+  AS S D  +KIW++  K  + T +GH
Sbjct: 763  TVKIWSIDGRLQKTLTGHTSGINSVTFSPDGKLIASASWDNTVKIWNLDGKE-LRTLRGH 821

Query: 620  TRGISTIRFTPDGRWV 667
               +  + F+PDG+ +
Sbjct: 822  KNVVHNVTFSPDGKLI 837



 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 37/127 (29%), Positives = 63/127 (49%), Gaps = 2/127 (1%)
 Frame = +2

Query: 293  TGGDDHSVNLWSI--GKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
            T   D +  LWSI   K     T +GH   V  ++F      +A  S     KLW+L+ T
Sbjct: 631  TASWDKTAKLWSIVGDKLQELRTFNGHQGRVNKLSFSPDGKYIATTSWDKTAKLWNLDGT 690

Query: 467  KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
             + +TL+GH+    ++ F P G+  A+ S D  +K+W+ R    + T    +  +++  F
Sbjct: 691  -LQKTLTGHKDTVWSVNFSPDGQLIATASEDKTVKLWN-RDGELLKTLPRQSSVVNSAVF 748

Query: 647  TPDGRWV 667
            +PDG+ +
Sbjct: 749  SPDGKLI 755



 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 32/113 (28%), Positives = 52/113 (46%), Gaps = 1/113 (0%)
 Frame = +2

Query: 326 SIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSY- 502
           SI      + L+ H   +ES++F      +A  S    +K+W L+  K +  L   +   
Sbjct: 311 SINFVREKNRLAEHDGMLESVSFSPDSKFIATASRDKTVKIWSLDGKKQLVVLREEKGEG 370

Query: 503 CTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
             ++ F P G   A+GS D   KIW  R+   +HT  GH   +  + F+PD +
Sbjct: 371 FNSVAFSPDGTLMATGSWDNTAKIWS-REGKRLHTLDGHKEAVLEVAFSPDSQ 422



>pir|T40283|T40283 beta-transducin - fission yeast
           (Schizosaccharomyces pombe)>gb:SPBC354_1719965 S.pombe
           chromosome II cosmid c354.
          Length = 380

 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 42/159 (26%), Positives = 77/159 (48%), Gaps = 11/159 (6%)
 Frame = +2

Query: 215 KLQEFVAHSG-NVNCLRFGKK---TC-------RMFLTGGDDHSVNLWSIGKPTSTSTLS 361
           +++ + +HSG +  C  FG +   TC       R   T   D ++ +WS        TL 
Sbjct: 34  RIRNYESHSGFSEYCTLFGHEKSVTCVSVSPNKRWIATSSSDGTIKIWSALTFRLECTLF 93

Query: 362 GHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFF 541
           GH   +  + + +    +A+ S    I++WD E    +R L GH +Y ++++F+P G   
Sbjct: 94  GHYRGISQVKWATGSKYLASASDDKTIRIWDFEKRCSVRCLKGHTNYVSSIDFNPLGTLL 153

Query: 542 ASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
            SGS D  ++IW+++   C+     H+  I ++  + DG
Sbjct: 154 VSGSWDETVRIWNLQDGTCLRMLPAHSEPIISVSISADG 192



 Score = 65.5 bits (158), Expect = 8e-10
 Identities = 34/127 (26%), Positives = 63/127 (49%), Gaps = 1/127 (0%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +  DD ++ +W   K  S   L GHT+ V SI F+    L+ +GS    +++W+L+D   
Sbjct: 113 SASDDKTIRIWDFEKRCSVRCLKGHTNYVSSIDFNPLGTLLVSGSWDETVRIWNLQDGTC 172

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHT-YKGHTRGISTIRFT 649
           +R L  H     ++     G   A+ S D   +IWD+    C+ T  +     +S ++FT
Sbjct: 173 LRMLPAHSEPIISVSISADGTLCATASYDGMARIWDVLSGQCLKTLVEPINVPLSNLQFT 232

Query: 650 PDGRWVV 670
            + ++++
Sbjct: 233 ENRKYLL 239



 Score = 64.7 bits (156), Expect = 1e-09
 Identities = 34/106 (32%), Positives = 54/106 (50%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           TL GH   V  ++    +  +A  SS G IK+W     ++  TL GH    + +++    
Sbjct: 49  TLFGHEKSVTCVSVSPNKRWIATSSSDGTIKIWSALTFRLECTLFGHYRGISQVKWATGS 108

Query: 533 EFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           ++ AS S D  ++IWD  K+  +   KGHT  +S+I F P G  +V
Sbjct: 109 KYLASASDDKTIRIWDFEKRCSVRCLKGHTNYVSSIDFNPLGTLLV 154



 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 23/113 (20%), Positives = 57/113 (50%), Gaps = 1/113 (0%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + ++G  D +V +W++   T    L  H+ P+ S++  +   L A  S  G+ ++WD+  
Sbjct: 152 LLVSGSWDETVRIWNLQDGTCLRMLPAHSEPIISVSISADGTLCATASYDGMARIWDVLS 211

Query: 464 TKMIRTLSGHRSY-CTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGH 619
            + ++TL    +   + L+F    ++    ++++ +++WD R+   +  +  H
Sbjct: 212 GQCLKTLVEPINVPLSNLQFTENRKYLLVSNLNSQIRLWDYRRNRVVRIFDSH 264



>sp|P90648|KMHB_DICDI Myosin heavy chain kinase B (EC 2.7.1.129)
           (MHCK B).>gb:DDU90946_1377450 Dictyostelium discoideum
           myosin heavy chain kinase B (MHCK-B) mRNA, complete cds.
          Length = 732

 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 44/141 (31%), Positives = 70/141 (49%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           +Q    H G V  + +  +      +G  DHS+ +W + K     TL GH  PV ++  +
Sbjct: 495 VQTLKGHEGPVESICYNDQ---YLFSGSSDHSIKVWDLKKLRCIFTLEGHDKPVHTVLLN 551

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
              +   +GSS   IK+WDL+  +   TL  H      L     G++  SGS D  +K+W
Sbjct: 552 DKYLF--SGSSDKTIKVWDLKTLECKYTLESHARAVKTLCIS--GQYLFSGSNDKTIKVW 607

Query: 578 DIRKKGCIHTYKGHTRGISTI 640
           D++   C +T KGHT+ ++TI
Sbjct: 608 DLKTFRCNYTLKGHTKWVTTI 628



 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 30/117 (25%), Positives = 55/117 (47%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
           +   +G  D ++ +W +       TL  H   V+++      +   +GS+   IK+WDL+
Sbjct: 553 KYLFSGSSDKTIKVWDLKTLECKYTLESHARAVKTLCISGQYLF--SGSNDKTIKVWDLK 610

Query: 461 DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGI 631
             +   TL GH  + T +     G    SGS D  +++W+++   C  T +GH R +
Sbjct: 611 TFRCNYTLKGHTKWVTTICI--LGTNLYSGSYDKTIRVWNLKSLECSATLRGHDRWV 665



 Score = 52.8 bits (125), Expect = 5e-06
 Identities = 31/126 (24%), Positives = 56/126 (44%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +G +D ++ +W +       TL GHT  V +I      +   +GS    I++W+L+  + 
Sbjct: 597 SGSNDKTIKVWDLKTFRCNYTLKGHTKWVTTICILGTNLY--SGSYDKTIRVWNLKSLEC 654

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
             TL GH  +   +      +   + S D  +KIWD+    C  T +GH   +  +    
Sbjct: 655 SATLRGHDRWVEHMVI--CDKLLFTASDDNTIKIWDLETLRCNTTLEGHNATVQCLAVWE 712

Query: 653 DGRWVV 670
           D + V+
Sbjct: 713 DKKCVI 718



 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 26/95 (27%), Positives = 45/95 (47%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +G  D ++ +W++     ++TL GH   VE +     + L+   S    IK+WDLE  + 
Sbjct: 637 SGSYDKTIRVWNLKSLECSATLRGHDRWVEHMVI--CDKLLFTASDDNTIKIWDLETLRC 694

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
             TL GH +    L      +   S S D ++++W
Sbjct: 695 NTTLEGHNATVQCLAVWEDKKCVISCSHDQSIRVW 729



 Score = 33.9 bits (76), Expect = 2.6
 Identities = 14/57 (24%), Positives = 29/57 (50%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLW 451
           ++  T  DD+++ +W +      +TL GH + V+ +A    +  V + S    I++W
Sbjct: 673 KLLFTASDDNTIKIWDLETLRCNTTLEGHNATVQCLAVWEDKKCVISCSHDQSIRVW 729



>gb:BC051783_2550450 Danio rerio zgc:56312, mRNA (cDNA clone
           MGC:56312 IMAGE:5603337), complete cds.
          Length = 347

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 43/144 (29%), Positives = 73/144 (50%), Gaps = 4/144 (2%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           ++ G +++    H+  VN     ++  ++  TG DD +V LW I K  S  T   +T  V
Sbjct: 128 SETGERVKRLKGHTSFVNSCFPARRGPQLACTGSDDGTVKLWDIRKKASVHTFQ-NTYQV 186

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
            S+ F+     + +G     IK+WDL   K+I ++ GH    T L     G +  S SMD
Sbjct: 187 LSVTFNDTSDQIISGGIDNDIKVWDLRQNKLIYSMQGHGDSVTGLSLSADGSYLLSNSMD 246

Query: 560 TNLKIWDIR----KKGCIHTYKGH 619
            ++++WDIR    K+ C+  ++G+
Sbjct: 247 NSVRVWDIRPFAPKERCVKIFQGN 270



 Score = 66.2 bits (160), Expect = 5e-10
 Identities = 37/130 (28%), Positives = 67/130 (51%), Gaps = 4/130 (3%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSI-GKPTSTSTLSGHTSPVESIAFDSAEIL 412
           H G V C +F      +  + G D  + +W++ G   + +TL GH+  V  + +++   L
Sbjct: 55  HEGEVYCCKFHPNGATL-ASSGYDRLILMWNVYGDCENYATLKGHSGAVMELHYNTDGSL 113

Query: 413 VAAGSSSGLIKLWDLEDTKMIRTLSGHRSY---CTALEFHPFGEFFASGSMDTNLKIWDI 583
           + + S+   + +WD E  + ++ L GH S+   C      P  +   +GS D  +K+WDI
Sbjct: 114 LFSASTDKTVCVWDSETGERVKRLKGHTSFVNSCFPARRGP--QLACTGSDDGTVKLWDI 171

Query: 584 RKKGCIHTYK 613
           RKK  +HT++
Sbjct: 172 RKKASVHTFQ 181



 Score = 63.5 bits (153), Expect = 3e-09
 Identities = 38/146 (26%), Positives = 67/146 (45%), Gaps = 1/146 (0%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVES-IAFDSAEIL 412
           HSG V  L +      +F +   D +V +W          L GHTS V S         L
Sbjct: 98  HSGAVMELHYNTDGSLLF-SASTDKTVCVWDSETGERVKRLKGHTSFVNSCFPARRGPQL 156

Query: 413 VAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKK 592
              GS  G +KLWD+     + T   +     ++ F+   +   SG +D ++K+WD+R+ 
Sbjct: 157 ACTGSDDGTVKLWDIRKKASVHTFQ-NTYQVLSVTFNDTSDQIISGGIDNDIKVWDLRQN 215

Query: 593 GCIHTYKGHTRGISTIRFTPDGRWVV 670
             I++ +GH   ++ +  + DG +++
Sbjct: 216 KLIYSMQGHGDSVTGLSLSADGSYLL 241



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 32/116 (27%), Positives = 49/116 (42%), Gaps = 7/116 (6%)
 Frame = +2

Query: 311 SVNLWSIGKPTSTST------LSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE-DTK 469
           S  L ++G P S+S       LSGH   V    F      +A+     LI +W++  D +
Sbjct: 31  SQQLSAMGPPRSSSLQAPIMLLSGHEGEVYCCKFHPNGATLASSGYDRLILMWNVYGDCE 90

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIST 637
              TL GH      L ++  G    S S D  + +WD      +   KGHT  +++
Sbjct: 91  NYATLKGHSGAVMELHYNTDGSLLFSASTDKTVCVWDSETGERVKRLKGHTSFVNS 146



 Score = 42.0 bits (97), Expect = 0.010
 Identities = 28/107 (26%), Positives = 45/107 (42%), Gaps = 8/107 (7%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIG----KPTSTSTLSGHTSPVES----IAFDSAEILVAAGSSSGLIK 445
           L+   D+SV +W I     K        G+    E      ++ +    +AAGS+   + 
Sbjct: 241 LSNSMDNSVRVWDIRPFAPKERCVKIFQGNVHNFEKNLLRCSWSADGSKIAAGSADRFVY 300

Query: 446 LWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
           +WD    +++  L GH      + FHP      SGS D  L I +I+
Sbjct: 301 IWDTTTRRIVYKLPGHAGSVNEVAFHPEEPIVLSGSSDKRLYIGEIQ 347



>gb:AJ720459_2502646 Gallus gallus mRNA for hypothetical protein,
           clone 18b20.
          Length = 305

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 38/126 (30%), Positives = 63/126 (50%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +G  D  +N++ I       TL GH  P+ S+ F     L+   S  G IK++D++   +
Sbjct: 165 SGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANL 224

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
             TLSGH S+   + F P    F S S D ++K+WD   + C+HT+  H   +  +++  
Sbjct: 225 AGTLSGHGSWVLNVAFCPDDTHFVSSSSDKSVKVWDAGTRTCVHTFFDHQDQVWGVKYNG 284

Query: 653 DGRWVV 670
            G  +V
Sbjct: 285 SGSKIV 290



 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 31/122 (25%), Positives = 59/122 (48%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D  + LW +       ++        S+AF      +A GS  G + ++ +E  K   +L
Sbjct: 85  DAHIRLWDLETGKQIKSIDAGPVDAWSLAFSPDSQFLATGSHVGKVNIFGVETGKKEYSL 144

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
                +  ++ + P G++ ASG++D  + I+DI     +HT +GH   I ++ F+PD + 
Sbjct: 145 DTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQL 204

Query: 665 VV 670
           +V
Sbjct: 205 LV 206



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 32/121 (26%), Positives = 56/121 (46%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           TG     VN++ +       +L      + SIA+      +A+G+  G+I ++D+   K+
Sbjct: 123 TGSHVGKVNIFGVETGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKL 182

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           + TL GH     +L F P  +   + S D  +KI+D++      T  GH   +  + F P
Sbjct: 183 LHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHGSWVLNVAFCP 242

Query: 653 D 655
           D
Sbjct: 243 D 243



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 29/124 (23%), Positives = 53/124 (42%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L     H+  +  L F   + ++ +T  DD  + ++ +       TLSGH S V ++
Sbjct: 180 GKLLHTLEGHAMPIRSLTFSPDS-QLLVTASDDGYIKIYDVQHANLAGTLSGHGSWVLNV 238

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           AF   +    + SS   +K+WD      + T   H+     ++++  G    S   D  +
Sbjct: 239 AFCPDDTHFVSSSSDKSVKVWDAGTRTCVHTFFDHQDQVWGVKYNGSGSKIVSVGDDQEI 298

Query: 569 KIWD 580
            I+D
Sbjct: 299 HIYD 302



>gb:AF490391_2066997 Mus musculus sperm-associated WD repeat protein
           mRNA, complete cds.
          Length = 639

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 53/155 (34%), Positives = 72/155 (46%), Gaps = 4/155 (2%)
 Frame = +2

Query: 200 AKRGYKLQE-FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWS-IGKPTSTSTL--SGH 367
           AK  YKL   F  H   V+C+      CR +L    +    LW  +G P     L  SGH
Sbjct: 346 AKFDYKLNNIFRLHELPVSCIVM--HPCRDYLISCSED--RLWKMVGLPQGNVLLTGSGH 401

Query: 368 TSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFAS 547
           T  +    F  +   +A  S    IKLWDL   +   TL GH     +  +H  G+F AS
Sbjct: 402 TDWLSGCCFHPSGSKLATSSGDSTIKLWDLNKGECTLTLEGHNHAVWSCTWHSCGDFVAS 461

Query: 548 GSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
            S+D   KIWD+  + C +T  GHT  +++I F P
Sbjct: 462 ASLDMTSKIWDVNSERCRYTLYGHTDSVNSIEFFP 496



 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 40/122 (32%), Positives = 55/122 (45%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           T   D ++ LW + K   T TL GH   V S  + S    VA+ S     K+WD+   + 
Sbjct: 419 TSSGDSTIKLWDLNKGECTLTLEGHNHAVWSCTWHSCGDFVASASLDMTSKIWDVNSERC 478

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
             TL GH     ++EF PF     + S D  L +WD R   C  +  GH   ++   FTP
Sbjct: 479 RYTLYGHTDSVNSIEFFPFSNILLTASADKTLSVWDARTGKCEQSLYGHMHSVNDATFTP 538

Query: 653 DG 658
            G
Sbjct: 539 RG 540



 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 28/95 (29%), Positives = 39/95 (41%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D +  +W +       TL GHT  V SI F     ++   S+   + +WD    K  ++L
Sbjct: 465 DMTSKIWDVNSERCRYTLYGHTDSVNSIEFFPFSNILLTASADKTLSVWDARTGKCEQSL 524

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRK 589
            GH        F P G   AS       K+WD RK
Sbjct: 525 YGHMHSVNDATFTPRGHIIASCDARGVTKLWDFRK 559



 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 33/138 (23%), Positives = 59/138 (42%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H+ +VN + F   +  + LT   D ++++W         +L GH   V    F     ++
Sbjct: 485 HTDSVNSIEFFPFS-NILLTASADKTLSVWDARTGKCEQSLYGHMHSVNDATFTPRGHII 543

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
           A+  + G+ KLWD      I ++    S    + F   G   A  S +  + + D+ K G
Sbjct: 544 ASCDARGVTKLWDFRKLIPIVSIDVGPSSGNEVNFDQSGRVLAQASANGIIHLLDL-KSG 602

Query: 596 CIHTYKGHTRGISTIRFT 649
            IH   GH   + ++ F+
Sbjct: 603 QIHKLVGHESEVHSVVFS 620



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 34/127 (26%), Positives = 54/127 (42%), Gaps = 1/127 (0%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVN-LWSIGKPTSTSTLSGHTSP 376
           A+ G   Q    H  +VN   F  +     +   D   V  LW   K     ++    S 
Sbjct: 515 ARTGKCEQSLYGHMHSVNDATFTPRG--HIIASCDARGVTKLWDFRKLIPIVSIDVGPSS 572

Query: 377 VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM 556
              + FD +  ++A  S++G+I L DL+  + I  L GH S   ++ F   GE   SG  
Sbjct: 573 GNEVNFDQSGRVLAQASANGIIHLLDLKSGQ-IHKLVGHESEVHSVVFSHLGENLYSGGS 631

Query: 557 DTNLKIW 577
           D  +++W
Sbjct: 632 DGTIRLW 638



>gb:AX878269_1477372 Sequence 13174 from Patent
           EP1074617.>gb:AK002149_1908857 Homo sapiens cDNA
           FLJ11287 fis, clone PLACE1009596, weakly similar to
           VEGETATIBLE INCOMPATIBILITY PROTEIN HET-E-1.
          Length = 330

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 43/160 (26%), Positives = 77/160 (48%), Gaps = 4/160 (2%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           + G  L+    HS  V C  F   +  + ++G  D +V +W +       TLS H+ PV 
Sbjct: 113 RSGKCLKTLKGHSNYVFCCNFNPPS-NLIISGSFDETVKIWEVKTGKCLKTLSAHSDPVS 171

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL-SGHRSYCTALEFHPFGEFFASGSMD 559
           ++ F+ +  L+ +GS  GL ++WD    + ++TL        + ++F P G++  + ++D
Sbjct: 172 AVHFNCSGSLIVSGSYDGLCRIWDAASGQCLKTLVDDDNPPVSFVKFSPNGKYILTATLD 231

Query: 560 TNLKIWDIRKKGCIHTYKGHTRG---ISTIRFTPDGRWVV 670
             LK+WD  +  C+ TY G       I        G+W+V
Sbjct: 232 NTLKLWDYSRGRCLKTYTGQKNEKYCIFANFSVTGGKWIV 271



 Score = 79.3 bits (194), Expect = 5e-14
 Identities = 39/147 (26%), Positives = 66/147 (44%)
 Frame = +2

Query: 230 VAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEI 409
           V H+  V+ ++F         +   D  + +W         TL GH   +  +A+ S   
Sbjct: 38  VGHTEAVSSVKFSPNG-EWLASSSADRLIIIWGAYDGKYEKTLYGHNLEISDVAWSSDSS 96

Query: 410 LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRK 589
            + + S    +KLWD+   K ++TL GH +Y     F+P      SGS D  +KIW+++ 
Sbjct: 97  RLVSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPSNLIISGSFDETVKIWEVKT 156

Query: 590 KGCIHTYKGHTRGISTIRFTPDGRWVV 670
             C+ T   H+  +S + F   G  +V
Sbjct: 157 GKCLKTLSAHSDPVSAVHFNCSGSLIV 183



 Score = 75.5 bits (184), Expect = 8e-13
 Identities = 38/146 (26%), Positives = 76/146 (52%), Gaps = 1/146 (0%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H+  ++ + +   + R+ ++  DD ++ LW +       TL GH++ V    F+    L+
Sbjct: 82  HNLEISDVAWSSDSSRL-VSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPSNLI 140

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
            +GS    +K+W+++  K ++TLS H    +A+ F+  G    SGS D   +IWD     
Sbjct: 141 ISGSFDETVKIWEVKTGKCLKTLSAHSDPVSAVHFNCSGSLIVSGSYDGLCRIWDAASGQ 200

Query: 596 CIHT-YKGHTRGISTIRFTPDGRWVV 670
           C+ T        +S ++F+P+G++++
Sbjct: 201 CLKTLVDDDNPPVSFVKFSPNGKYIL 226



 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 34/106 (32%), Positives = 50/106 (47%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           TL GHT  V S+ F      +A+ S+  LI +W   D K  +TL GH    + + +    
Sbjct: 36  TLVGHTEAVSSVKFSPNGEWLASSSADRLIIIWGAYDGKYEKTLYGHNLEISDVAWSSDS 95

Query: 533 EFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
               S S D  LK+WD+R   C+ T KGH+  +    F P    ++
Sbjct: 96  SRLVSASDDKTLKLWDVRSGKCLKTLKGHSNYVFCCNFNPPSNLII 141



 Score = 42.4 bits (98), Expect = 0.007
 Identities = 24/105 (22%), Positives = 48/105 (45%), Gaps = 6/105 (5%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEIL----VAAGSSSGLIKL 448
           +  LT   D+++ LW   +     T +G  +    I F +  +     + +GS   L+ +
Sbjct: 223 KYILTATLDNTLKLWDYSRGRCLKTYTGQKNEKYCI-FANFSVTGGKWIVSGSEDNLVYI 281

Query: 449 WDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM--DTNLKIW 577
           W+L+  ++++ L GH     +   HP     AS ++  D  +K+W
Sbjct: 282 WNLQTKEIVQKLQGHTDVVISAACHPTENLIASAALENDKTIKLW 326



>gb:CQ783661_1452567 Sequence 3801 from Patent
           EP1396543.>gb:AK074772_1912684 Homo sapiens cDNA
           FLJ90291 fis, clone NT2RP1001031, weakly similar to
           VEGETATIBLE INCOMPATIBILITY PROTEIN
           HET-E-1.>gb:BC026080_1978688 Homo sapiens WD repeat
           domain 51B, mRNA (cDNA clone MGC:26753 IMAGE:4827689),
           complete cds.
          Length = 478

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 44/156 (28%), Positives = 74/156 (47%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           KRG K  EF AH+  V  + F     +   T  +D S+ +WS+ +     +L  HT  V 
Sbjct: 91  KRG-KFSEFKAHTAPVRSVDFSADG-QFLATASEDKSIKVWSMYRQRFLYSLYRHTHWVR 148

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
              F     L+ + S    IK+WD  + + +   S    +   ++F+P G   AS   D 
Sbjct: 149 CAKFSPDGRLIVSCSEDKTIKIWDTTNKQCVNNFSDSVGFANFVDFNPSGTCIASAGSDQ 208

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            +K+WD+R    +  Y+ H+ G++ I F P G +++
Sbjct: 209 TVKVWDVRVNKLLQHYQVHSGGVNCISFHPSGNYLI 244



 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 38/144 (26%), Positives = 61/144 (42%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           +V H   V  ++F      +  +   D +V LW   K    S    HT+PV S+ F +  
Sbjct: 56  YVGHKDVVTSVQFSPHG-NLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADG 114

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
             +A  S    IK+W +   + + +L  H  +    +F P G    S S D  +KIWD  
Sbjct: 115 QFLATASEDKSIKVWSMYRQRFLYSLYRHTHWVRCAKFSPDGRLIVSCSEDKTIKIWDTT 174

Query: 587 KKGCIHTYKGHTRGISTIRFTPDG 658
            K C++ +       + + F P G
Sbjct: 175 NKQCVNNFSDSVGFANFVDFNPSG 198



 Score = 69.3 bits (168), Expect = 6e-11
 Identities = 35/147 (23%), Positives = 66/147 (44%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           L     H+  V C +F     R+ ++  +D ++ +W        +  S        + F+
Sbjct: 137 LYSLYRHTHWVRCAKFSPDG-RLIVSCSEDKTIKIWDTTNKQCVNNFSDSVGFANFVDFN 195

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
            +   +A+  S   +K+WD+   K+++    H      + FHP G +  + S D  LKI 
Sbjct: 196 PSGTCIASAGSDQTVKVWDVRVNKLLQHYQVHSGGVNCISFHPSGNYLITASSDGTLKIL 255

Query: 578 DIRKKGCIHTYKGHTRGISTIRFTPDG 658
           D+ +   I+T +GHT  + T+ F+  G
Sbjct: 256 DLLEGRLIYTLQGHTGPVFTVSFSKGG 282



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 31/130 (23%), Positives = 59/130 (45%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
           +   T   D  + LW+           GH   V S+ F     L+A+ S    ++LW  +
Sbjct: 31  KQLATASWDTFLMLWNFKPHARAYRYVGHKDVVTSVQFSPHGNLLASASRDRTVRLWIPD 90

Query: 461 DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
                     H +   +++F   G+F A+ S D ++K+W + ++  +++   HT  +   
Sbjct: 91  KRGKFSEFKAHTAPVRSVDFSADGQFLATASEDKSIKVWSMYRQRFLYSLYRHTHWVRCA 150

Query: 641 RFTPDGRWVV 670
           +F+PDGR +V
Sbjct: 151 KFSPDGRLIV 160



 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 29/95 (30%), Positives = 45/95 (47%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           + G D +V +W +           H+  V  I+F  +   +   SS G +K+ DL + ++
Sbjct: 203 SAGSDQTVKVWDVRVNKLLQHYQVHSGGVNCISFHPSGNYLITASSDGTLKILDLLEGRL 262

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
           I TL GH      + F   GE FASG  DT + +W
Sbjct: 263 IYTLQGHTGPVFTVSFSKGGELFASGGADTQVLLW 297



 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 27/110 (24%), Positives = 50/110 (45%)
 Frame = +2

Query: 338 PTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALE 517
           P       GH + + S+        +A  S    + LW+ +         GH+   T+++
Sbjct: 8   PVLERYFKGHKAAITSLDLSPNGKQLATASWDTFLMLWNFKPHARAYRYVGHKDVVTSVQ 67

Query: 518 FHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
           F P G   AS S D  +++W   K+G    +K HT  + ++ F+ DG+++
Sbjct: 68  FSPHGNLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQFL 117



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 21/67 (31%), Positives = 38/67 (56%)
 Frame = +2

Query: 458 EDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIST 637
           ED  + R   GH++  T+L+  P G+  A+ S DT L +W+ +     + Y GH   +++
Sbjct: 6   EDPVLERYFKGHKAAITSLDLSPNGKQLATASWDTFLMLWNFKPHARAYRYVGHKDVVTS 65

Query: 638 IRFTPDG 658
           ++F+P G
Sbjct: 66  VQFSPHG 72



 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 24/78 (30%), Positives = 39/78 (50%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           LQ +  HSG VNC+ F   +    +T   D ++ +  + +     TL GHT PV +++F 
Sbjct: 221 LQHYQVHSGGVNCISF-HPSGNYLITASSDGTLKILDLLEGRLIYTLQGHTGPVFTVSFS 279

Query: 398 SAEILVAAGSSSGLIKLW 451
               L A+G +   + LW
Sbjct: 280 KGGELFASGGADTQVLLW 297



>gb:HSM804229_1187124 Homo sapiens mRNA; cDNA DKFZp762M0115 (from
           clone DKFZp762M0115).
          Length = 286

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 44/156 (28%), Positives = 74/156 (47%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           KRG K  EF AH+  V  + F     +   T  +D S+ +WS+ +     +L  HT  V 
Sbjct: 35  KRG-KFSEFKAHTAPVRSVDFSADG-QFLATASEDKSIKVWSMYRQRFLYSLYRHTHWVR 92

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
              F     L+ + S    IK+WD  + + +   S    +   ++F+P G   AS   D 
Sbjct: 93  CAKFSPDGRLIVSCSEDKTIKIWDTTNKQCVNNFSDSVGFANFVDFNPSGTCIASAGSDQ 152

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            +K+WD+R    +  Y+ H+ G++ I F P G +++
Sbjct: 153 TVKVWDVRVNKLLQHYQVHSGGVNCISFHPSGNYLI 188



 Score = 69.3 bits (168), Expect = 6e-11
 Identities = 35/147 (23%), Positives = 66/147 (44%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           L     H+  V C +F     R+ ++  +D ++ +W        +  S        + F+
Sbjct: 81  LYSLYRHTHWVRCAKFSPDG-RLIVSCSEDKTIKIWDTTNKQCVNNFSDSVGFANFVDFN 139

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
            +   +A+  S   +K+WD+   K+++    H      + FHP G +  + S D  LKI 
Sbjct: 140 PSGTCIASAGSDQTVKVWDVRVNKLLQHYQVHSGGVNCISFHPSGNYLITASSDGTLKIL 199

Query: 578 DIRKKGCIHTYKGHTRGISTIRFTPDG 658
           D+ +   I+T +GHT  + T+ F+  G
Sbjct: 200 DLLEGRLIYTLQGHTGPVFTVSFSKGG 226



 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 38/143 (26%), Positives = 60/143 (41%)
 Frame = +2

Query: 230 VAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEI 409
           V H   V  ++F      +  +   D +V LW   K    S    HT+PV S+ F +   
Sbjct: 1   VGHKDVVTSVQFSPHG-NLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQ 59

Query: 410 LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRK 589
            +A  S    IK+W +   + + +L  H  +    +F P G    S S D  +KIWD   
Sbjct: 60  FLATASEDKSIKVWSMYRQRFLYSLYRHTHWVRCAKFSPDGRLIVSCSEDKTIKIWDTTN 119

Query: 590 KGCIHTYKGHTRGISTIRFTPDG 658
           K C++ +       + + F P G
Sbjct: 120 KQCVNNFSDSVGFANFVDFNPSG 142



 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 27/103 (26%), Positives = 52/103 (50%)
 Frame = +2

Query: 362 GHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFF 541
           GH   V S+ F     L+A+ S    ++LW  +          H +   +++F   G+F 
Sbjct: 2   GHKDVVTSVQFSPHGNLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFSADGQFL 61

Query: 542 ASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           A+ S D ++K+W + ++  +++   HT  +   +F+PDGR +V
Sbjct: 62  ATASEDKSIKVWSMYRQRFLYSLYRHTHWVRCAKFSPDGRLIV 104



 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 29/95 (30%), Positives = 45/95 (47%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           + G D +V +W +           H+  V  I+F  +   +   SS G +K+ DL + ++
Sbjct: 147 SAGSDQTVKVWDVRVNKLLQHYQVHSGGVNCISFHPSGNYLITASSDGTLKILDLLEGRL 206

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
           I TL GH      + F   GE FASG  DT + +W
Sbjct: 207 IYTLQGHTGPVFTVSFSKGGELFASGGADTQVLLW 241



 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 24/78 (30%), Positives = 39/78 (50%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           LQ +  HSG VNC+ F   +    +T   D ++ +  + +     TL GHT PV +++F 
Sbjct: 165 LQHYQVHSGGVNCISF-HPSGNYLITASSDGTLKILDLLEGRLIYTLQGHTGPVFTVSFS 223

Query: 398 SAEILVAAGSSSGLIKLW 451
               L A+G +   + LW
Sbjct: 224 KGGELFASGGADTQVLLW 241



>gb:AK014865_1158168 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4921511D23
           product:hypothetical Trp-Asp repeat (WD-repeat)
           structure containing protein, full insert
           sequence.>gb:AK016618_1158809 Mus musculus adult male
           testis cDNA, RIKEN full-length enriched library,
           clone:4933402H05 product:hypothetical Trp-Asp repeat
           (WD-repeat) structure containing protein, full insert
           sequence.
          Length = 310

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 53/155 (34%), Positives = 72/155 (46%), Gaps = 4/155 (2%)
 Frame = +2

Query: 200 AKRGYKLQE-FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWS-IGKPTSTSTL--SGH 367
           AK  YKL   F  H   V+C+      CR +L    +    LW  +G P     L  SGH
Sbjct: 17  AKFDYKLNNIFRLHELPVSCIVM--HPCRDYLISCSED--RLWKMVGLPQGNVLLTGSGH 72

Query: 368 TSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFAS 547
           T  +    F  +   +A  S    IKLWDL   +   TL GH     +  +H  G+F AS
Sbjct: 73  TDWLSGCCFHPSGSKLATSSGDSTIKLWDLNKGECTLTLEGHNHAVWSCTWHSCGDFVAS 132

Query: 548 GSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
            S+D   KIWD+  + C +T  GHT  +++I F P
Sbjct: 133 ASLDMTSKIWDVNSERCRYTLYGHTDSVNSIEFFP 167



 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 40/122 (32%), Positives = 55/122 (45%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           T   D ++ LW + K   T TL GH   V S  + S    VA+ S     K+WD+   + 
Sbjct: 90  TSSGDSTIKLWDLNKGECTLTLEGHNHAVWSCTWHSCGDFVASASLDMTSKIWDVNSERC 149

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
             TL GH     ++EF PF     + S D  L +WD R   C  +  GH   ++   FTP
Sbjct: 150 RYTLYGHTDSVNSIEFFPFSNILLTASADKTLSVWDARTGKCEQSLYGHMHSVNDATFTP 209

Query: 653 DG 658
            G
Sbjct: 210 RG 211



 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 28/95 (29%), Positives = 39/95 (41%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D +  +W +       TL GHT  V SI F     ++   S+   + +WD    K  ++L
Sbjct: 136 DMTSKIWDVNSERCRYTLYGHTDSVNSIEFFPFSNILLTASADKTLSVWDARTGKCEQSL 195

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRK 589
            GH        F P G   AS       K+WD RK
Sbjct: 196 YGHMHSVNDATFTPRGHIIASCDARGVTKLWDFRK 230



 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 33/138 (23%), Positives = 59/138 (42%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H+ +VN + F   +  + LT   D ++++W         +L GH   V    F     ++
Sbjct: 156 HTDSVNSIEFFPFS-NILLTASADKTLSVWDARTGKCEQSLYGHMHSVNDATFTPRGHII 214

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
           A+  + G+ KLWD      I ++    S    + F   G   A  S +  + + D+ K G
Sbjct: 215 ASCDARGVTKLWDFRKLIPIVSIDVGPSSGNEVNFDQSGRVLAQASANGIIHLLDL-KSG 273

Query: 596 CIHTYKGHTRGISTIRFT 649
            IH   GH   + ++ F+
Sbjct: 274 QIHKLVGHESEVHSVVFS 291



 Score = 41.6 bits (96), Expect = 0.013
 Identities = 34/127 (26%), Positives = 54/127 (42%), Gaps = 1/127 (0%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVN-LWSIGKPTSTSTLSGHTSP 376
           A+ G   Q    H  +VN   F  +     +   D   V  LW   K     ++    S 
Sbjct: 186 ARTGKCEQSLYGHMHSVNDATFTPRG--HIIASCDARGVTKLWDFRKLIPIVSIDVGPSS 243

Query: 377 VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM 556
              + FD +  ++A  S++G+I L DL+  + I  L GH S   ++ F   GE   SG  
Sbjct: 244 GNEVNFDQSGRVLAQASANGIIHLLDLKSGQ-IHKLVGHESEVHSVVFSHLGENLYSGGS 302

Query: 557 DTNLKIW 577
           D  +++W
Sbjct: 303 DGTIRLW 309



>gb:AE014296_1134707 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE014296_1134708 Drosophila melanogaster
            chromosome 3L, complete sequence.>gb:AE014296_1134709
            Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003480_1212006 Drosophila melanogaster
            chromosome 3L, section 14 of 83 of the complete
            sequence.>gb:AE003480_1212007 Drosophila melanogaster
            chromosome 3L, section 14 of 83 of the complete
            sequence.>gb:AE003480_1212008 Drosophila melanogaster
            chromosome 3L, section 14 of 83 of the complete
            sequence.>gb:AY061300_1293103 Drosophila melanogaster
            LD21322 full length cDNA.>gb:AY075401_1296213 Drosophila
            melanogaster LD30271 full length cDNA.
          Length = 1326

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 42/141 (29%), Positives = 70/141 (49%)
 Frame = +2

Query: 248  VNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGS 427
            + CL+F        ++G DD+++ +WS        TL GHT  V S        ++ +GS
Sbjct: 998  ITCLQFSGNR---IVSGSDDNTLKVWSAVNGKCLRTLVGHTGGVWSSQMSGN--IIISGS 1052

Query: 428  SSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHT 607
            +   +K+WD++    + TL GH S    +  H  G    SGS D  L++WDI +  C+H 
Sbjct: 1053 TDRTLKVWDMDSGACVHTLQGHTSTVRCMHLH--GSKVVSGSRDATLRVWDIEQGSCLHV 1110

Query: 608  YKGHTRGISTIRFTPDGRWVV 670
              GH   +  +++  DG+ +V
Sbjct: 1111 LVGHLAAVRCVQY--DGKLIV 1129



 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 47/159 (29%), Positives = 80/159 (50%), Gaps = 3/159 (1%)
 Frame = +2

Query: 203  KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
            ++G  L   V H   V C+++  K   + ++G  D+ V +W   +     TL GHT+ V 
Sbjct: 1103 EQGSCLHVLVGHLAAVRCVQYDGK---LIVSGAYDYMVKIWHPERQECLHTLQGHTNRVY 1159

Query: 383  SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
            S+ FD   ++  +GS    I++WD+E      TL GH+S  + +E         SG+ D+
Sbjct: 1160 SLQFDGLHVV--SGSLDTSIRVWDVETGNCKHTLMGHQSLTSGMELRQ--NILVSGNADS 1215

Query: 563  NLKIWDIRKKGCIHTYKG---HTRGISTIRFTPDGRWVV 670
             +K+WDI    C+ T  G   H   ++ ++F  + R+VV
Sbjct: 1216 TVKVWDITTGQCLQTLSGPNKHHSAVTCLQF--NSRFVV 1252



 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 43/157 (27%), Positives = 80/157 (50%)
 Frame = +2

Query: 200  AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
            A  G  L+  V H+G V      + +  + ++G  D ++ +W +       TL GHTS V
Sbjct: 1022 AVNGKCLRTLVGHTGGVWS---SQMSGNIIISGSTDRTLKVWDMDSGACVHTLQGHTSTV 1078

Query: 380  ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
              +    ++++  +GS    +++WD+E    +  L GH +    +++   G+   SG+ D
Sbjct: 1079 RCMHLHGSKVV--SGSRDATLRVWDIEQGSCLHVLVGHLAAVRCVQYD--GKLIVSGAYD 1134

Query: 560  TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
              +KIW   ++ C+HT +GHT  + +++F  DG  VV
Sbjct: 1135 YMVKIWHPERQECLHTLQGHTNRVYSLQF--DGLHVV 1169



 Score = 73.9 bits (180), Expect = 2e-12
 Identities = 38/129 (29%), Positives = 67/129 (51%), Gaps = 1/129 (0%)
 Frame = +2

Query: 236  HSGNVNCLRF-GKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEIL 412
            H+  V C+   G K     ++G  D ++ +W I + +    L GH + V  + +D    L
Sbjct: 1074 HTSTVRCMHLHGSKV----VSGSRDATLRVWDIEQGSCLHVLVGHLAAVRCVQYDGK--L 1127

Query: 413  VAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKK 592
            + +G+   ++K+W  E  + + TL GH +   +L+F   G    SGS+DT++++WD+   
Sbjct: 1128 IVSGAYDYMVKIWHPERQECLHTLQGHTNRVYSLQFD--GLHVVSGSLDTSIRVWDVETG 1185

Query: 593  GCIHTYKGH 619
             C HT  GH
Sbjct: 1186 NCKHTLMGH 1194



 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 35/107 (32%), Positives = 49/107 (45%)
 Frame = +2

Query: 323  WSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSY 502
            W          L GH   V +    S   +V+ GS    +K+W   + K +RTL GH   
Sbjct: 979  WRSRPVRKPKVLKGHDDHVITCLQFSGNRIVS-GSDDNTLKVWSAVNGKCLRTLVGHTGG 1037

Query: 503  CTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
              + +    G    SGS D  LK+WD+    C+HT +GHT   ST+R
Sbjct: 1038 VWSSQMS--GNIIISGSTDRTLKVWDMDSGACVHTLQGHT---STVR 1079



 Score = 40.0 bits (92), Expect = 0.037
 Identities = 24/70 (34%), Positives = 34/70 (48%), Gaps = 3/70 (4%)
 Frame = +2

Query: 284  MFLTGGDDHSVNLWSIGKPTSTSTLSG---HTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
            + ++G  D +V +W I       TLSG   H S V  + F+S    V   S  G +KLWD
Sbjct: 1207 ILVSGNADSTVKVWDITTGQCLQTLSGPNKHHSAVTCLQFNSR--FVVTSSDDGTVKLWD 1264

Query: 455  LEDTKMIRTL 484
            ++    IR L
Sbjct: 1265 VKTGDFIRNL 1274



>pir|T46032|T46032 WD-40 repeat regulatory protein tup1 homolog -
           Arabidopsis thaliana>gb:ATT16K5_1554579 Arabidopsis
           thaliana DNA chromosome 3, BAC clone T16K5.
          Length = 317

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 40/152 (26%), Positives = 75/152 (49%), Gaps = 1/152 (0%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           +QEF  H   ++ + F     R  ++  DD ++ LW +   +   TL GHT+    + F+
Sbjct: 64  VQEFTGHENGISDVAFSSDA-RFIVSASDDKTLKLWDVETGSLIKTLIGHTNYAFCVNFN 122

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
               ++ +GS    +++WD+   K ++ L  H    TA++F+  G    S S D   +IW
Sbjct: 123 PQSNMIVSGSFDETVRIWDVTTGKCLKVLPAHSDPVTAVDFNRDGSLIVSSSYDGLCRIW 182

Query: 578 DIRKKGCIHT-YKGHTRGISTIRFTPDGRWVV 670
           D     C+ T        +S +RF+P+G++++
Sbjct: 183 DSGTGHCVKTLIDDENPPVSFVRFSPNGKFIL 214



 Score = 79.3 bits (194), Expect = 5e-14
 Identities = 39/155 (25%), Positives = 72/155 (46%), Gaps = 5/155 (3%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTS-----TSTLSGHTSPVES 385
           Q   +H+  V+ ++F     R+  +   D ++  ++I              +GH + +  
Sbjct: 18  QTLTSHNRAVSSVKFSSDG-RLLASASADKTIRTYTINTINDPIAEPVQEFTGHENGISD 76

Query: 386 IAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTN 565
           +AF S    + + S    +KLWD+E   +I+TL GH +Y   + F+P      SGS D  
Sbjct: 77  VAFSSDARFIVSASDDKTLKLWDVETGSLIKTLIGHTNYAFCVNFNPQSNMIVSGSFDET 136

Query: 566 LKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           ++IWD+    C+     H+  ++ + F  DG  +V
Sbjct: 137 VRIWDVTTGKCLKVLPAHSDPVTAVDFNRDGSLIV 171



 Score = 72.0 bits (175), Expect = 9e-12
 Identities = 39/158 (24%), Positives = 74/158 (46%), Gaps = 4/158 (2%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  ++  + H+    C+ F  ++  M ++G  D +V +W +        L  H+ PV ++
Sbjct: 103 GSLIKTLIGHTNYAFCVNFNPQS-NMIVSGSFDETVRIWDVTTGKCLKVLPAHSDPVTAV 161

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL-SGHRSYCTALEFHPFGEFFASGSMDTN 565
            F+    L+ + S  GL ++WD      ++TL        + + F P G+F   G++D  
Sbjct: 162 DFNRDGSLIVSSSYDGLCRIWDSGTGHCVKTLIDDENPPVSFVRFSPNGKFILVGTLDNT 221

Query: 566 LKIWDIRKKGCIHTYKGHTRG---ISTIRFTPDGRWVV 670
           L++W+I     + TY GH      IS+     +G+ +V
Sbjct: 222 LRLWNISSAKFLKTYTGHVNAQYCISSAFSVTNGKRIV 259



 Score = 56.6 bits (135), Expect = 4e-07
 Identities = 30/107 (28%), Positives = 51/107 (47%), Gaps = 3/107 (2%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI--AFDSAE-ILVAAGSSSGLIKLW 451
           +  L G  D+++ LW+I       T +GH +    I  AF       + +GS    + +W
Sbjct: 211 KFILVGTLDNTLRLWNISSAKFLKTYTGHVNAQYCISSAFSVTNGKRIVSGSEDNCVHMW 270

Query: 452 DLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKK 592
           +L   K+++ L GH      +  HP     ASGS+D  ++IW  +K+
Sbjct: 271 ELNSKKLLQKLEGHTETVMNVACHPTENLIASGSLDKTVRIWTQKKE 317



>gb:AB099715_2464872 Oryzias latipes Ol-Gb1 mRNA for guanine
           nucleotide-binding protein beta subunit, complete cds.
          Length = 340

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 46/149 (30%), Positives = 76/149 (51%), Gaps = 2/149 (1%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           +E   H+G ++C RF        +T   D S  LW I     T+T +GHT  V S++   
Sbjct: 137 RELAGHTGYLSCCRFLDDN--QIVTSSGDTSCALWDIETGQQTTTFAGHTGDVMSLSLAP 194

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
              L  +G+     KLWD+ +    +T +GH S   A+ F P G  FA+GS D   +++D
Sbjct: 195 DTRLFVSGACDASAKLWDIREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFD 254

Query: 581 IR--KKGCIHTYKGHTRGISTIRFTPDGR 661
           +R  ++  I+++     GI+++ F+  GR
Sbjct: 255 LRADQELMIYSHDNIICGITSVAFSKSGR 283



 Score = 69.3 bits (168), Expect = 6e-11
 Identities = 44/152 (28%), Positives = 64/152 (42%), Gaps = 2/152 (1%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +   F  H+G+V  L     T R+F++G  D S  LW I +     T +GH S + +I
Sbjct: 174 GQQTTTFAGHTGDVMSLSLAPDT-RLFVSGACDASAKLWDIREGMCRQTFTGHESDINAI 232

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYC--TALEFHPFGEFFASGSMDT 562
            F       A GS     +L+DL   + +   S     C  T++ F   G    +G  D 
Sbjct: 233 CFFPNGNAFATGSDDATCRLFDLRADQELMIYSHDNIICGITSVAFSKSGRLLLAGYDDF 292

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           N  +WD  K        GH   +S +  T DG
Sbjct: 293 NCNVWDTLKADRAGVLAGHDNRVSCLGVTDDG 324



 Score = 48.9 bits (115), Expect = 8e-05
 Identities = 33/149 (22%), Positives = 64/149 (42%), Gaps = 4/149 (2%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H   +  + +G  + R+ ++   D  + +W          +   +S V + A+  +   V
Sbjct: 54  HLAKIYAMHWGTDS-RLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYV 112

Query: 416 AAGSSSGLIKLWDLE----DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
           A G    +  +++L+    + ++ R L+GH  Y +   F    +   S S DT+  +WDI
Sbjct: 113 ACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTS-SGDTSCALWDI 171

Query: 584 RKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
                  T+ GHT  + ++   PD R  V
Sbjct: 172 ETGQQTTTFAGHTGDVMSLSLAPDTRLFV 200



 Score = 45.4 bits (106), Expect = 9e-04
 Identities = 26/109 (23%), Positives = 52/109 (47%), Gaps = 4/109 (3%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           TL GH + + ++ + +   L+ + S  G + +WD   T  +  +    S+     + P G
Sbjct: 50  TLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSG 109

Query: 533 EFFASGSMDTNLKIWDIR-KKGCIHTYK---GHTRGISTIRFTPDGRWV 667
            + A G +D    I++++ ++G +   +   GHT  +S  RF  D + V
Sbjct: 110 NYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIV 158



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 19/61 (31%), Positives = 30/61 (49%)
 Frame = +2

Query: 272 KTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLW 451
           K+ R+ L G DD + N+W   K      L+GH + V  +      + VA GS    +K+W
Sbjct: 280 KSGRLLLAGYDDFNCNVWDTLKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIW 339

Query: 452 D 454
           +
Sbjct: 340 N 340



 Score = 34.3 bits (77), Expect = 2.0
 Identities = 18/64 (28%), Positives = 26/64 (40%)
 Frame = +2

Query: 476 RTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
           RTL GH +   A+ +        S S D  L IWD      +H     +  + T  + P 
Sbjct: 49  RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 656 GRWV 667
           G +V
Sbjct: 109 GNYV 112



>gb:BC034901_2097799 Mus musculus RIKEN cDNA 2510040D07 gene, mRNA
           (cDNA clone MGC:41475 IMAGE:5255069), complete cds.
          Length = 405

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 40/148 (27%), Positives = 70/148 (47%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           F AH+  V  + F     +  +T  DD +V +WS  +     +L+ H + V    F    
Sbjct: 99  FRAHTATVRSVHFCSDG-QSLVTASDDKTVKVWSTHRQRFLFSLTQHINWVRCAKFSPDG 157

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            L+ + S    +KLWD    + I +   H  + T ++FHP G   A+  MD  +K+WD R
Sbjct: 158 RLIVSASDDKTVKLWDKTSRECIHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDAR 217

Query: 587 KKGCIHTYKGHTRGISTIRFTPDGRWVV 670
               +  Y+ H+  ++ + F P G +++
Sbjct: 218 THRLLQHYQLHSAAVNALSFHPSGNYLI 245



 Score = 72.4 bits (176), Expect = 7e-12
 Identities = 37/144 (25%), Positives = 63/144 (43%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           F  H   V C+ F      +  +G  D +V +W       ++    HT+ V S+ F S  
Sbjct: 57  FTGHKDAVTCVNFSPSG-HLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDG 115

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
             +   S    +K+W     + + +L+ H ++    +F P G    S S D  +K+WD  
Sbjct: 116 QSLVTASDDKTVKVWSTHRQRFLFSLTQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKT 175

Query: 587 KKGCIHTYKGHTRGISTIRFTPDG 658
            + CIH+Y  H   ++ + F P G
Sbjct: 176 SRECIHSYCEHGGFVTYVDFHPSG 199



 Score = 69.3 bits (168), Expect = 6e-11
 Identities = 37/143 (25%), Positives = 64/143 (44%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H   V C +F     R+ ++  DD +V LW         +   H   V  + F  +   +
Sbjct: 144 HINWVRCAKFSPDG-RLIVSASDDKTVKLWDKTSRECIHSYCEHGGFVTYVDFHPSGTCI 202

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
           AA      +K+WD    ++++    H +   AL FHP G +  + S D+ LKI D+ +  
Sbjct: 203 AAAGMDNTVKVWDARTHRLLQHYQLHSAAVNALSFHPSGNYLITASSDSTLKILDLMEGR 262

Query: 596 CIHTYKGHTRGISTIRFTPDGRW 664
            ++T  GH    +T+ F+  G +
Sbjct: 263 LLYTLHGHQGPATTVAFSRTGEY 285



 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 30/111 (27%), Positives = 50/111 (45%)
 Frame = +2

Query: 338 PTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALE 517
           P+      GH   V  + F      +A+GS    + +W ++        +GH+   T + 
Sbjct: 9   PSLERHFKGHRDAVTCVDFSLNTKHLASGSMDSTLMIWHMKSQSRAYRFTGHKDAVTCVN 68

Query: 518 FHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           F P G   ASGS D  ++IW    KG    ++ HT  + ++ F  DG+ +V
Sbjct: 69  FSPSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDGQSLV 119



 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 32/150 (21%), Positives = 64/150 (42%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           + F  H   V C+ F   T +   +G  D ++ +W +   +     +GH   V  + F  
Sbjct: 13  RHFKGHRDAVTCVDFSLNT-KHLASGSMDSTLMIWHMKSQSRAYRFTGHKDAVTCVNFSP 71

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
           +  L+A+GS    +++W             H +   ++ F   G+   + S D  +K+W 
Sbjct: 72  SGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDGQSLVTASDDKTVKVWS 131

Query: 581 IRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
             ++  + +   H   +   +F+PDGR +V
Sbjct: 132 THRQRFLFSLTQHINWVRCAKFSPDGRLIV 161



 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 32/121 (26%), Positives = 56/121 (46%), Gaps = 1/121 (0%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKK-TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAF 394
           +  +  H G V  + F    TC      G D++V +W             H++ V +++F
Sbjct: 180 IHSYCEHGGFVTYVDFHPSGTC--IAAAGMDNTVKVWDARTHRLLQHYQLHSAAVNALSF 237

Query: 395 DSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI 574
             +   +   SS   +K+ DL + +++ TL GH+   T + F   GE+FASG  D  + +
Sbjct: 238 HPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMV 297

Query: 575 W 577
           W
Sbjct: 298 W 298



 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 22/67 (32%), Positives = 36/67 (53%)
 Frame = +2

Query: 458 EDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIST 637
           ED  + R   GHR   T ++F    +  ASGSMD+ L IW ++ +   + + GH   ++ 
Sbjct: 7   EDPSLERHFKGHRDAVTCVDFSLNTKHLASGSMDSTLMIWHMKSQSRAYRFTGHKDAVTC 66

Query: 638 IRFTPDG 658
           + F+P G
Sbjct: 67  VNFSPSG 73



>gb:AY392427_2084491 Cricetulus griseus guanine nucleotide binding
           protein beta 1 mRNA, complete cds.
          Length = 340

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 46/149 (30%), Positives = 74/149 (49%), Gaps = 2/149 (1%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           +E   H+G ++C RF        +T  +D +  LW I     T+T +GHT  V S++   
Sbjct: 137 RELAGHTGYLSCCRFLNDN--QIVTSSEDTTCALWDIETGQQTTTFTGHTGDVMSLSLAP 194

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
              L  +G+     KLWD+ +    +T +GH S   A+ F P G  FA+GS D   +++D
Sbjct: 195 DTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFD 254

Query: 581 IRKKGCIHTYKGHT--RGISTIRFTPDGR 661
           +R    + TY       GI+++ F+  GR
Sbjct: 255 LRADQELMTYSHDNIICGITSVSFSKSGR 283



 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 44/152 (28%), Positives = 65/152 (42%), Gaps = 2/152 (1%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +   F  H+G+V  L     T R+F++G  D S  LW + +     T +GH S + +I
Sbjct: 174 GQQTTTFTGHTGDVMSLSLAPDT-RLFVSGACDASAKLWDVREGMCRQTFTGHESDINAI 232

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYC--TALEFHPFGEFFASGSMDT 562
            F       A GS     +L+DL   + + T S     C  T++ F   G    +G  D 
Sbjct: 233 CFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDF 292

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           N  +WD  K        GH   +S +  T DG
Sbjct: 293 NCNVWDALKADRAGVLAGHDNRVSCLGVTDDG 324



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 33/149 (22%), Positives = 63/149 (42%), Gaps = 4/149 (2%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H   +  + +G  + R+ ++   D  + +W          +   +S V + A+  +   V
Sbjct: 54  HLAKIYAMHWGTDS-RLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYV 112

Query: 416 AAGSSSGLIKLWDLE----DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
           A G    +  +++L+    + ++ R L+GH  Y +   F    +   S S DT   +WDI
Sbjct: 113 ACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLNDNQIVTS-SEDTTCALWDI 171

Query: 584 RKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
                  T+ GHT  + ++   PD R  V
Sbjct: 172 ETGQQTTTFTGHTGDVMSLSLAPDTRLFV 200



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 26/109 (23%), Positives = 52/109 (47%), Gaps = 4/109 (3%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           TL GH + + ++ + +   L+ + S  G + +WD   T  +  +    S+     + P G
Sbjct: 50  TLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSG 109

Query: 533 EFFASGSMDTNLKIWDIR-KKGCIHTYK---GHTRGISTIRFTPDGRWV 667
            + A G +D    I++++ ++G +   +   GHT  +S  RF  D + V
Sbjct: 110 NYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLNDNQIV 158



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 19/61 (31%), Positives = 30/61 (49%)
 Frame = +2

Query: 272 KTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLW 451
           K+ R+ L G DD + N+W   K      L+GH + V  +      + VA GS    +K+W
Sbjct: 280 KSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIW 339

Query: 452 D 454
           +
Sbjct: 340 N 340



 Score = 34.3 bits (77), Expect = 2.0
 Identities = 18/64 (28%), Positives = 26/64 (40%)
 Frame = +2

Query: 476 RTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
           RTL GH +   A+ +        S S D  L IWD      +H     +  + T  + P 
Sbjct: 49  RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 656 GRWV 667
           G +V
Sbjct: 109 GNYV 112



>gb:AF427101_2065587 Mus musculus F-box protein (Fbwd6) mRNA,
           complete cds.
          Length = 629

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 48/149 (32%), Positives = 75/149 (50%), Gaps = 3/149 (2%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L   + H   V C+++     R  ++G  D  V +W     T   TL GHT+ V S+
Sbjct: 413 GQCLHVLMGHVAAVRCVQYDG---RRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSL 469

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            FD   I V +GS    I++WD+E    I TL+GH+S  + +E         SG+ D+ +
Sbjct: 470 QFDG--IHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTV 525

Query: 569 KIWDIRKKGCIHTYKG---HTRGISTIRF 646
           KIWDI+   C+ T +G   H   ++ ++F
Sbjct: 526 KIWDIKTGQCLQTLEGPSKHQSAVTCLQF 554



 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 40/140 (28%), Positives = 70/140 (50%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A+ G  +     H+  V C+   +K     ++G  D ++ +W I        L GH + V
Sbjct: 370 AETGECIHTLYGHTSTVRCMHLHEKRV---VSGSRDATLRVWDIETGQCLHVLMGHVAAV 426

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             + +D   ++  +G+   ++K+WD E    + TL GH +   +L+F   G    SGS+D
Sbjct: 427 RCVQYDGRRVV--SGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFD--GIHVVSGSLD 482

Query: 560 TNLKIWDIRKKGCIHTYKGH 619
           T++++WD+    CIHT  GH
Sbjct: 483 TSIRVWDVETGNCIHTLTGH 502



 Score = 75.9 bits (185), Expect = 6e-13
 Identities = 45/142 (31%), Positives = 71/142 (50%), Gaps = 1/142 (0%)
 Frame = +2

Query: 248 VNCLRFGKKTC-RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAG 424
           + CL+F    C    ++G DD+++ +WS        TL GHT  V S      + ++ +G
Sbjct: 306 ITCLQF----CGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS--SQMRDNIIISG 359

Query: 425 SSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIH 604
           S+   +K+W+ E  + I TL GH S    +  H   +   SGS D  L++WDI    C+H
Sbjct: 360 STDRTLKVWNAETGECIHTLYGHTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQCLH 417

Query: 605 TYKGHTRGISTIRFTPDGRWVV 670
              GH   +  +++  DGR VV
Sbjct: 418 VLMGHVAAVRCVQY--DGRRVV 437



 Score = 72.4 bits (176), Expect = 7e-12
 Identities = 45/157 (28%), Positives = 77/157 (49%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A  G  L+  V H+G V   +       + ++G  D ++ +W+        TL GHTS V
Sbjct: 330 AVTGKCLRTLVGHTGGVWSSQMRDN---IIISGSTDRTLKVWNAETGECIHTLYGHTSTV 386

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             +     E  V +GS    +++WD+E  + +  L GH +    +++   G    SG+ D
Sbjct: 387 RCMHLH--EKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYD--GRRVVSGAYD 442

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
             +K+WD   + C+HT +GHT  + +++F  DG  VV
Sbjct: 443 FMVKVWDPETETCLHTLQGHTNRVYSLQF--DGIHVV 477



 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 35/107 (32%), Positives = 47/107 (43%)
 Frame = +2

Query: 323 WSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSY 502
           W  G+  S   L GH   V +        +V+ GS    +K+W     K +RTL GH   
Sbjct: 287 WRRGELKSPKVLKGHDDHVITCLQFCGNRIVS-GSDDNTLKVWSAVTGKCLRTLVGHTGG 345

Query: 503 CTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
             + +         SGS D  LK+W+     CIHT  GHT   ST+R
Sbjct: 346 VWSSQMR--DNIIISGSTDRTLKVWNAETGECIHTLYGHT---STVR 387



 Score = 38.9 bits (89), Expect = 0.082
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 3/70 (4%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSG---HTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           + ++G  D +V +W I       TL G   H S V  + F+   ++ +  S  G +KLWD
Sbjct: 515 ILVSGNADSTVKIWDIKTGQCLQTLEGPSKHQSAVTCLQFNKNFVITS--SDDGTVKLWD 572

Query: 455 LEDTKMIRTL 484
           L+  + IR L
Sbjct: 573 LKTGEFIRNL 582



>gb:AF383178_1900017 Homo sapiens F-box protein FBX30 mRNA, partial
           cds.
          Length = 561

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 48/149 (32%), Positives = 75/149 (50%), Gaps = 3/149 (2%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L   + H   V C+++     R  ++G  D  V +W     T   TL GHT+ V S+
Sbjct: 345 GQCLHVLMGHVAAVRCVQYDG---RRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSL 401

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            FD   I V +GS    I++WD+E    I TL+GH+S  + +E         SG+ D+ +
Sbjct: 402 QFDG--IHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTV 457

Query: 569 KIWDIRKKGCIHTYKG---HTRGISTIRF 646
           KIWDI+   C+ T +G   H   ++ ++F
Sbjct: 458 KIWDIKTGQCLQTLQGPNKHQSAVTCLQF 486



 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 40/140 (28%), Positives = 70/140 (50%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A+ G  +     H+  V C+   +K     ++G  D ++ +W I        L GH + V
Sbjct: 302 AETGECIHTLYGHTSTVRCMHLHEKRV---VSGSRDATLRVWDIETGQCLHVLMGHVAAV 358

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             + +D   ++  +G+   ++K+WD E    + TL GH +   +L+F   G    SGS+D
Sbjct: 359 RCVQYDGRRVV--SGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFD--GIHVVSGSLD 414

Query: 560 TNLKIWDIRKKGCIHTYKGH 619
           T++++WD+    CIHT  GH
Sbjct: 415 TSIRVWDVETGNCIHTLTGH 434



 Score = 75.9 bits (185), Expect = 6e-13
 Identities = 45/142 (31%), Positives = 71/142 (50%), Gaps = 1/142 (0%)
 Frame = +2

Query: 248 VNCLRFGKKTC-RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAG 424
           + CL+F    C    ++G DD+++ +WS        TL GHT  V S      + ++ +G
Sbjct: 238 ITCLQF----CGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS--SQMRDNIIISG 291

Query: 425 SSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIH 604
           S+   +K+W+ E  + I TL GH S    +  H   +   SGS D  L++WDI    C+H
Sbjct: 292 STDRTLKVWNAETGECIHTLYGHTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQCLH 349

Query: 605 TYKGHTRGISTIRFTPDGRWVV 670
              GH   +  +++  DGR VV
Sbjct: 350 VLMGHVAAVRCVQY--DGRRVV 369



 Score = 72.4 bits (176), Expect = 7e-12
 Identities = 45/157 (28%), Positives = 77/157 (49%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A  G  L+  V H+G V   +       + ++G  D ++ +W+        TL GHTS V
Sbjct: 262 AVTGKCLRTLVGHTGGVWSSQMRDN---IIISGSTDRTLKVWNAETGECIHTLYGHTSTV 318

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             +     E  V +GS    +++WD+E  + +  L GH +    +++   G    SG+ D
Sbjct: 319 RCMHLH--EKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYD--GRRVVSGAYD 374

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
             +K+WD   + C+HT +GHT  + +++F  DG  VV
Sbjct: 375 FMVKVWDPETETCLHTLQGHTNRVYSLQF--DGIHVV 409



 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 35/107 (32%), Positives = 47/107 (43%)
 Frame = +2

Query: 323 WSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSY 502
           W  G+  S   L GH   V +        +V+ GS    +K+W     K +RTL GH   
Sbjct: 219 WRRGELKSPKVLKGHDDHVITCLQFCGNRIVS-GSDDNTLKVWSAVTGKCLRTLVGHTGG 277

Query: 503 CTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
             + +         SGS D  LK+W+     CIHT  GHT   ST+R
Sbjct: 278 VWSSQMR--DNIIISGSTDRTLKVWNAETGECIHTLYGHT---STVR 319



 Score = 38.9 bits (89), Expect = 0.082
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 3/70 (4%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSG---HTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           + ++G  D +V +W I       TL G   H S V  + F+   ++ +  S  G +KLWD
Sbjct: 447 ILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITS--SDDGTVKLWD 504

Query: 455 LEDTKMIRTL 484
           L+  + IR L
Sbjct: 505 LKTGEFIRNL 514



>gb:AF053883_1764476 Emericella nidulans coatomer alpha subunit
           (sodVIC) mRNA, complete cds.
          Length = 1205

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 41/133 (30%), Positives = 70/133 (52%), Gaps = 3/133 (2%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           + G  +  F  H G V  + F   T  +F++GGDD+ + +W+        TL+GH   V 
Sbjct: 39  RMGTLIDRFEEHDGPVRGIDF-HPTQPLFVSGGDDYKIKVWNYQTRRCLFTLNGHLDYVR 97

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
           ++ F      + + S    I++W+ ++  +I T++GH  Y    +FHP  +  AS S+D 
Sbjct: 98  TVFFHPELPWILSASDDQTIRIWNWQNRSLICTMTGHNHYVMCAQFHPTEDLIASASLDQ 157

Query: 563 NLKIWDI---RKK 592
           +++IWDI   RKK
Sbjct: 158 SVRIWDISGLRKK 170



 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 32/114 (28%), Positives = 51/114 (44%)
 Frame = +2

Query: 311 SVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSG 490
           ++ LW     T       H  PV  I F   + L  +G     IK+W+ +  + + TL+G
Sbjct: 32  TIQLWDYRMGTLIDRFEEHDGPVRGIDFHPTQPLFVSGGDDYKIKVWNYQTRRCLFTLNG 91

Query: 491 HRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           H  Y   + FHP   +  S S D  ++IW+ + +  I T  GH   +   +F P
Sbjct: 92  HLDYVRTVFFHPELPWILSASDDQTIRIWNWQNRSLICTMTGHNHYVMCAQFHP 145



 Score = 59.3 bits (142), Expect = 6e-08
 Identities = 28/101 (27%), Positives = 46/101 (45%)
 Frame = +2

Query: 368 TSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFAS 547
           +S  + IAF      +     S  I+LWD     +I     H      ++FHP    F S
Sbjct: 9   SSRAKGIAFHPKRPWILVSLHSSTIQLWDYRMGTLIDRFEEHDGPVRGIDFHPTQPLFVS 68

Query: 548 GSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           G  D  +K+W+ + + C+ T  GH   + T+ F P+  W++
Sbjct: 69  GGDDYKIKVWNYQTRRCLFTLNGHLDYVRTVFFHPELPWIL 109



 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 28/88 (31%), Positives = 43/88 (48%), Gaps = 2/88 (2%)
 Frame = +2

Query: 356 LSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM--IRTLSGHRSYCTALEFHPF 529
           L GH   V  +AF  +  L+ +     LIKLW + DTK   + T  GH    +A  FHP 
Sbjct: 205 LEGHDRGVNWVAFHPSLPLIVSAGDDRLIKLWRMSDTKAWEVDTCRGHFQNASACLFHPH 264

Query: 530 GEFFASGSMDTNLKIWDIRKKGCIHTYK 613
            +   S   D  ++ WD+ K+  + ++K
Sbjct: 265 QDLILSVGEDKTIRAWDLNKRTPVQSFK 292



 Score = 38.9 bits (89), Expect = 0.082
 Identities = 26/121 (21%), Positives = 49/121 (40%), Gaps = 2/121 (1%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIG--KPTSTSTLSGHTSPVESIAFDSAEI 409
           H   VN + F   +  + ++ GDD  + LW +   K     T  GH     +  F   + 
Sbjct: 208 HDRGVNWVAF-HPSLPLIVSAGDDRLIKLWRMSDTKAWEVDTCRGHFQNASACLFHPHQD 266

Query: 410 LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRK 589
           L+ +      I+ WDL     +++          +  HP    FA+G  DT + ++ + +
Sbjct: 267 LILSVGEDKTIRAWDLNKRTPVQSFKRDVDRFWVIAAHPEINLFAAGH-DTGVMVFKLER 325

Query: 590 K 592
           +
Sbjct: 326 E 326



>gb:AY661671_1620416 Lentinula edodes guanine nucleotide binding
           protein beta subunit 2 (Gbeta2) mRNA, complete cds.
          Length = 349

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 46/149 (30%), Positives = 76/149 (51%), Gaps = 2/149 (1%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           +E  AHSG ++C RF     R  +T   D +  LW I         S HT  V S++   
Sbjct: 146 RELSAHSGYLSCCRFLND--RQIVTSSGDMTCMLWDIEAGVRVVEFSDHTGDVMSLSLGP 203

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
            + +  +G+     KLWD+   +  +T +GH S   A++F P G+ FA+GS D + +++D
Sbjct: 204 NQNVFVSGACDATAKLWDIRSGRATQTFTGHESDINAVQFFPNGDAFATGSDDASCRLFD 263

Query: 581 IRKKGCIHTY--KGHTRGISTIRFTPDGR 661
           IR    ++T+       GI+++ F+  GR
Sbjct: 264 IRADRELNTFIHDNILCGITSVAFSISGR 292



 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 40/152 (26%), Positives = 65/152 (42%), Gaps = 2/152 (1%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G ++ EF  H+G+V  L  G     +F++G  D +  LW I    +T T +GH S + ++
Sbjct: 183 GVRVVEFSDHTGDVMSLSLGPNQ-NVFVSGACDATAKLWDIRSGRATQTFTGHESDINAV 241

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYC--TALEFHPFGEFFASGSMDT 562
            F       A GS     +L+D+   + + T       C  T++ F   G     G  D 
Sbjct: 242 QFFPNGDAFATGSDDASCRLFDIRADRELNTFIHDNILCGITSVAFSISGRILFGGYDDW 301

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
              +WD  K   +    GH   +S +  + DG
Sbjct: 302 TCNVWDTLKGERVGVLTGHENRVSCLGVSTDG 333



 Score = 48.9 bits (115), Expect = 8e-05
 Identities = 31/127 (24%), Positives = 53/127 (41%), Gaps = 2/127 (1%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTL--SGHTSP 376
           + G   Q F  H  ++N ++F       F TG DD S  L+ I      +T         
Sbjct: 223 RSGRATQTFTGHESDINAVQFFPNG-DAFATGSDDASCRLFDIRADRELNTFIHDNILCG 281

Query: 377 VESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSM 556
           + S+AF  +  ++  G       +WD    + +  L+GH +  + L     G    +GS 
Sbjct: 282 ITSVAFSISGRILFGGYDDWTCNVWDTLKGERVGVLTGHENRVSCLGVSTDGMALCTGSW 341

Query: 557 DTNLKIW 577
           D+ L++W
Sbjct: 342 DSTLRVW 348



 Score = 33.1 bits (74), Expect = 4.5
 Identities = 16/79 (20%), Positives = 34/79 (43%)
 Frame = +2

Query: 356 LSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGE 535
           L GH + + ++ + +    + + S  G + +WD   T  +  +    S+     +   G 
Sbjct: 59  LRGHLAKIYAMHWAADRRHLVSASQDGKLIVWDAYTTNKVHAIPLRSSWVMTCAYSASGN 118

Query: 536 FFASGSMDTNLKIWDIRKK 592
           F A G +D    I+++  K
Sbjct: 119 FVACGGLDNICSIYNLNSK 137



>gb:AX877849_1477188 Sequence 12754 from Patent
           EP1074617.>gb:AK001933_1908732 Homo sapiens cDNA
           FLJ11071 fis, clone PLACE1004937, moderately similar to
           SEL-10 PROTEIN.
          Length = 553

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 48/149 (32%), Positives = 75/149 (50%), Gaps = 3/149 (2%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L   + H   V C+++     R  ++G  D  V +W     T   TL GHT+ V S+
Sbjct: 337 GQCLHVLMGHVAAVRCVQYDG---RRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSL 393

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            FD   I V +GS    I++WD+E    I TL+GH+S  + +E         SG+ D+ +
Sbjct: 394 QFDG--IHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTV 449

Query: 569 KIWDIRKKGCIHTYKG---HTRGISTIRF 646
           KIWDI+   C+ T +G   H   ++ ++F
Sbjct: 450 KIWDIKTGQCLQTLQGPNKHQSAVTCLQF 478



 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 40/140 (28%), Positives = 70/140 (50%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A+ G  +     H+  V C+   +K     ++G  D ++ +W I        L GH + V
Sbjct: 294 AETGECIHTLYGHTSTVRCMHLHEKRV---VSGSRDATLRVWDIETGQCLHVLMGHVAAV 350

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             + +D   ++  +G+   ++K+WD E    + TL GH +   +L+F   G    SGS+D
Sbjct: 351 RCVQYDGRRVV--SGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFD--GIHVVSGSLD 406

Query: 560 TNLKIWDIRKKGCIHTYKGH 619
           T++++WD+    CIHT  GH
Sbjct: 407 TSIRVWDVETGNCIHTLTGH 426



 Score = 75.9 bits (185), Expect = 6e-13
 Identities = 45/142 (31%), Positives = 71/142 (50%), Gaps = 1/142 (0%)
 Frame = +2

Query: 248 VNCLRFGKKTC-RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAG 424
           + CL+F    C    ++G DD+++ +WS        TL GHT  V S      + ++ +G
Sbjct: 230 ITCLQF----CGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS--SQMRDNIIISG 283

Query: 425 SSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIH 604
           S+   +K+W+ E  + I TL GH S    +  H   +   SGS D  L++WDI    C+H
Sbjct: 284 STDRTLKVWNAETGECIHTLYGHTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQCLH 341

Query: 605 TYKGHTRGISTIRFTPDGRWVV 670
              GH   +  +++  DGR VV
Sbjct: 342 VLMGHVAAVRCVQY--DGRRVV 361



 Score = 72.4 bits (176), Expect = 7e-12
 Identities = 45/157 (28%), Positives = 77/157 (49%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A  G  L+  V H+G V   +       + ++G  D ++ +W+        TL GHTS V
Sbjct: 254 AVTGKCLRTLVGHTGGVWSSQMRDN---IIISGSTDRTLKVWNAETGECIHTLYGHTSTV 310

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             +     E  V +GS    +++WD+E  + +  L GH +    +++   G    SG+ D
Sbjct: 311 RCMHLH--EKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYD--GRRVVSGAYD 366

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
             +K+WD   + C+HT +GHT  + +++F  DG  VV
Sbjct: 367 FMVKVWDPETETCLHTLQGHTNRVYSLQF--DGIHVV 401



 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 35/107 (32%), Positives = 47/107 (43%)
 Frame = +2

Query: 323 WSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSY 502
           W  G+  S   L GH   V +        +V+ GS    +K+W     K +RTL GH   
Sbjct: 211 WRRGELKSPKVLKGHDDHVITCLQFCGNRIVS-GSDDNTLKVWSAVTGKCLRTLVGHTGG 269

Query: 503 CTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
             + +         SGS D  LK+W+     CIHT  GHT   ST+R
Sbjct: 270 VWSSQMR--DNIIISGSTDRTLKVWNAETGECIHTLYGHT---STVR 311



 Score = 38.9 bits (89), Expect = 0.082
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 3/70 (4%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSG---HTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           + ++G  D +V +W I       TL G   H S V  + F+   ++ +  S  G +KLWD
Sbjct: 439 ILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITS--SDDGTVKLWD 496

Query: 455 LEDTKMIRTL 484
           L+  + IR L
Sbjct: 497 LKTGEFIRNL 506



>gb:AX722159_1473864 Sequence 17 from Patent
           WO03024999.>gb:AY008274_1934105 Homo sapiens F-box
           protein SEL10 (SEL10) mRNA, complete cds.
          Length = 589

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 48/149 (32%), Positives = 75/149 (50%), Gaps = 3/149 (2%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L   + H   V C+++     R  ++G  D  V +W     T   TL GHT+ V S+
Sbjct: 373 GQCLHVLMGHVAAVRCVQYDG---RRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSL 429

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            FD   I V +GS    I++WD+E    I TL+GH+S  + +E         SG+ D+ +
Sbjct: 430 QFDG--IHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTV 485

Query: 569 KIWDIRKKGCIHTYKG---HTRGISTIRF 646
           KIWDI+   C+ T +G   H   ++ ++F
Sbjct: 486 KIWDIKTGQCLQTLQGPNKHQSAVTCLQF 514



 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 40/140 (28%), Positives = 70/140 (50%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A+ G  +     H+  V C+   +K     ++G  D ++ +W I        L GH + V
Sbjct: 330 AETGECIHTLYGHTSTVRCMHLHEKRV---VSGSRDATLRVWDIETGQCLHVLMGHVAAV 386

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             + +D   ++  +G+   ++K+WD E    + TL GH +   +L+F   G    SGS+D
Sbjct: 387 RCVQYDGRRVV--SGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFD--GIHVVSGSLD 442

Query: 560 TNLKIWDIRKKGCIHTYKGH 619
           T++++WD+    CIHT  GH
Sbjct: 443 TSIRVWDVETGNCIHTLTGH 462



 Score = 75.9 bits (185), Expect = 6e-13
 Identities = 45/142 (31%), Positives = 71/142 (50%), Gaps = 1/142 (0%)
 Frame = +2

Query: 248 VNCLRFGKKTC-RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAG 424
           + CL+F    C    ++G DD+++ +WS        TL GHT  V S      + ++ +G
Sbjct: 266 ITCLQF----CGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS--SQMRDNIIISG 319

Query: 425 SSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIH 604
           S+   +K+W+ E  + I TL GH S    +  H   +   SGS D  L++WDI    C+H
Sbjct: 320 STDRTLKVWNAETGECIHTLYGHTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQCLH 377

Query: 605 TYKGHTRGISTIRFTPDGRWVV 670
              GH   +  +++  DGR VV
Sbjct: 378 VLMGHVAAVRCVQY--DGRRVV 397



 Score = 72.4 bits (176), Expect = 7e-12
 Identities = 45/157 (28%), Positives = 77/157 (49%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A  G  L+  V H+G V   +       + ++G  D ++ +W+        TL GHTS V
Sbjct: 290 AVTGKCLRTLVGHTGGVWSSQMRDN---IIISGSTDRTLKVWNAETGECIHTLYGHTSTV 346

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             +     E  V +GS    +++WD+E  + +  L GH +    +++   G    SG+ D
Sbjct: 347 RCMHLH--EKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYD--GRRVVSGAYD 402

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
             +K+WD   + C+HT +GHT  + +++F  DG  VV
Sbjct: 403 FMVKVWDPETETCLHTLQGHTNRVYSLQF--DGIHVV 437



 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 35/107 (32%), Positives = 47/107 (43%)
 Frame = +2

Query: 323 WSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSY 502
           W  G+  S   L GH   V +        +V+ GS    +K+W     K +RTL GH   
Sbjct: 247 WRRGELKSPKVLKGHDDHVITCLQFCGNRIVS-GSDDNTLKVWSAVTGKCLRTLVGHTGG 305

Query: 503 CTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
             + +         SGS D  LK+W+     CIHT  GHT   ST+R
Sbjct: 306 VWSSQMR--DNIIISGSTDRTLKVWNAETGECIHTLYGHT---STVR 347



 Score = 38.9 bits (89), Expect = 0.082
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 3/70 (4%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSG---HTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           + ++G  D +V +W I       TL G   H S V  + F+   ++ +  S  G +KLWD
Sbjct: 475 ILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITS--SDDGTVKLWD 532

Query: 455 LEDTKMIRTL 484
           L+  + IR L
Sbjct: 533 LKTGEFIRNL 542



>gb:AX722147_1473863 Sequence 5 from Patent
           WO03024999.>gb:AF411972_1901547 Homo sapiens archipelago
           beta form mRNA, complete cds.>gb:AY033553_1934655 Homo
           sapiens F-box protein FBW7 mRNA, complete cds.
          Length = 627

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 48/149 (32%), Positives = 75/149 (50%), Gaps = 3/149 (2%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L   + H   V C+++     R  ++G  D  V +W     T   TL GHT+ V S+
Sbjct: 411 GQCLHVLMGHVAAVRCVQYDG---RRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSL 467

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            FD   I V +GS    I++WD+E    I TL+GH+S  + +E         SG+ D+ +
Sbjct: 468 QFDG--IHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTV 523

Query: 569 KIWDIRKKGCIHTYKG---HTRGISTIRF 646
           KIWDI+   C+ T +G   H   ++ ++F
Sbjct: 524 KIWDIKTGQCLQTLQGPNKHQSAVTCLQF 552



 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 40/140 (28%), Positives = 70/140 (50%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A+ G  +     H+  V C+   +K     ++G  D ++ +W I        L GH + V
Sbjct: 368 AETGECIHTLYGHTSTVRCMHLHEKRV---VSGSRDATLRVWDIETGQCLHVLMGHVAAV 424

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             + +D   ++  +G+   ++K+WD E    + TL GH +   +L+F   G    SGS+D
Sbjct: 425 RCVQYDGRRVV--SGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFD--GIHVVSGSLD 480

Query: 560 TNLKIWDIRKKGCIHTYKGH 619
           T++++WD+    CIHT  GH
Sbjct: 481 TSIRVWDVETGNCIHTLTGH 500



 Score = 75.9 bits (185), Expect = 6e-13
 Identities = 45/142 (31%), Positives = 71/142 (50%), Gaps = 1/142 (0%)
 Frame = +2

Query: 248 VNCLRFGKKTC-RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAG 424
           + CL+F    C    ++G DD+++ +WS        TL GHT  V S      + ++ +G
Sbjct: 304 ITCLQF----CGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS--SQMRDNIIISG 357

Query: 425 SSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIH 604
           S+   +K+W+ E  + I TL GH S    +  H   +   SGS D  L++WDI    C+H
Sbjct: 358 STDRTLKVWNAETGECIHTLYGHTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQCLH 415

Query: 605 TYKGHTRGISTIRFTPDGRWVV 670
              GH   +  +++  DGR VV
Sbjct: 416 VLMGHVAAVRCVQY--DGRRVV 435



 Score = 72.4 bits (176), Expect = 7e-12
 Identities = 45/157 (28%), Positives = 77/157 (49%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A  G  L+  V H+G V   +       + ++G  D ++ +W+        TL GHTS V
Sbjct: 328 AVTGKCLRTLVGHTGGVWSSQMRDN---IIISGSTDRTLKVWNAETGECIHTLYGHTSTV 384

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             +     E  V +GS    +++WD+E  + +  L GH +    +++   G    SG+ D
Sbjct: 385 RCMHLH--EKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYD--GRRVVSGAYD 440

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
             +K+WD   + C+HT +GHT  + +++F  DG  VV
Sbjct: 441 FMVKVWDPETETCLHTLQGHTNRVYSLQF--DGIHVV 475



 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 35/107 (32%), Positives = 47/107 (43%)
 Frame = +2

Query: 323 WSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSY 502
           W  G+  S   L GH   V +        +V+ GS    +K+W     K +RTL GH   
Sbjct: 285 WRRGELKSPKVLKGHDDHVITCLQFCGNRIVS-GSDDNTLKVWSAVTGKCLRTLVGHTGG 343

Query: 503 CTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
             + +         SGS D  LK+W+     CIHT  GHT   ST+R
Sbjct: 344 VWSSQMR--DNIIISGSTDRTLKVWNAETGECIHTLYGHT---STVR 385



 Score = 38.9 bits (89), Expect = 0.082
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 3/70 (4%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSG---HTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           + ++G  D +V +W I       TL G   H S V  + F+   ++ +  S  G +KLWD
Sbjct: 513 ILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITS--SDDGTVKLWD 570

Query: 455 LEDTKMIRTL 484
           L+  + IR L
Sbjct: 571 LKTGEFIRNL 580



>gb:CR859650_1183756 Pongo pygmaeus mRNA; cDNA DKFZp459C1034 (from
           clone DKFZp459C1034).
          Length = 600

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 48/149 (32%), Positives = 75/149 (50%), Gaps = 3/149 (2%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L   + H   V C+++     R  ++G  D  V +W     T   TL GHT+ V S+
Sbjct: 384 GQCLHVLMGHVAAVRCVQYDG---RRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSL 440

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            FD   I V +GS    I++WD+E    I TL+GH+S  + +E         SG+ D+ +
Sbjct: 441 QFDG--IHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTV 496

Query: 569 KIWDIRKKGCIHTYKG---HTRGISTIRF 646
           KIWDI+   C+ T +G   H   ++ ++F
Sbjct: 497 KIWDIKTGQCLQTLQGPNKHQSAVTCLQF 525



 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 40/140 (28%), Positives = 69/140 (49%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A+ G  +     H+  V C+   +K     + G  D ++ +W I        L GH + V
Sbjct: 341 AETGECIHTLYGHTSTVRCMHLHEKRV---VGGSRDATLRVWDIETGQCLHVLMGHVAAV 397

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             + +D   ++  +G+   ++K+WD E    + TL GH +   +L+F   G    SGS+D
Sbjct: 398 RCVQYDGRRVV--SGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFD--GIHVVSGSLD 453

Query: 560 TNLKIWDIRKKGCIHTYKGH 619
           T++++WD+    CIHT  GH
Sbjct: 454 TSIRVWDVETGNCIHTLTGH 473



 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 44/142 (30%), Positives = 70/142 (49%), Gaps = 1/142 (0%)
 Frame = +2

Query: 248 VNCLRFGKKTC-RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAG 424
           + CL+F    C    ++G DD+++ +WS        TL GHT  V S      + ++ +G
Sbjct: 277 ITCLQF----CGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS--SQMRDNIIISG 330

Query: 425 SSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIH 604
           S+   +K+W+ E  + I TL GH S    +  H   +    GS D  L++WDI    C+H
Sbjct: 331 STDRTLKVWNAETGECIHTLYGHTSTVRCMHLHE--KRVVGGSRDATLRVWDIETGQCLH 388

Query: 605 TYKGHTRGISTIRFTPDGRWVV 670
              GH   +  +++  DGR VV
Sbjct: 389 VLMGHVAAVRCVQY--DGRRVV 408



 Score = 72.0 bits (175), Expect = 9e-12
 Identities = 45/157 (28%), Positives = 76/157 (48%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A  G  L+  V H+G V   +       + ++G  D ++ +W+        TL GHTS V
Sbjct: 301 AVTGKCLRTLVGHTGGVWSSQMRDN---IIISGSTDRTLKVWNAETGECIHTLYGHTSTV 357

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             +     E  V  GS    +++WD+E  + +  L GH +    +++   G    SG+ D
Sbjct: 358 RCMHLH--EKRVVGGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYD--GRRVVSGAYD 413

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
             +K+WD   + C+HT +GHT  + +++F  DG  VV
Sbjct: 414 FMVKVWDPETETCLHTLQGHTNRVYSLQF--DGIHVV 448



 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 35/107 (32%), Positives = 47/107 (43%)
 Frame = +2

Query: 323 WSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSY 502
           W  G+  S   L GH   V +        +V+ GS    +K+W     K +RTL GH   
Sbjct: 258 WRRGELKSPKVLKGHDDHVITCLQFCGNRIVS-GSDDNTLKVWSAVTGKCLRTLVGHTGG 316

Query: 503 CTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
             + +         SGS D  LK+W+     CIHT  GHT   ST+R
Sbjct: 317 VWSSQMR--DNIIISGSTDRTLKVWNAETGECIHTLYGHT---STVR 358



 Score = 38.9 bits (89), Expect = 0.082
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 3/70 (4%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSG---HTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           + ++G  D +V +W I       TL G   H S V  + F+   ++ +  S  G +KLWD
Sbjct: 486 ILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITS--SDDGTVKLWD 543

Query: 455 LEDTKMIRTL 484
           L+  + IR L
Sbjct: 544 LKTGEFIRNL 553



>gb:AK032174_1162787 Mus musculus adult male olfactory brain cDNA,
           RIKEN full-length enriched library, clone:6430407G20
           product:F-box and WD-40 domain protein 7, archipelago
           homolog (Drosophila)], full insert sequence.
          Length = 325

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 48/149 (32%), Positives = 75/149 (50%), Gaps = 3/149 (2%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L   + H   V C+++     R  ++G  D  V +W     T   TL GHT+ V S+
Sbjct: 109 GQCLHVLMGHVAAVRCVQYDG---RRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSL 165

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            FD   I V +GS    I++WD+E    I TL+GH+S  + +E         SG+ D+ +
Sbjct: 166 QFDG--IHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTV 221

Query: 569 KIWDIRKKGCIHTYKG---HTRGISTIRF 646
           KIWDI+   C+ T +G   H   ++ ++F
Sbjct: 222 KIWDIKTGQCLQTLQGPSKHQSAVTCLQF 250



 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 40/140 (28%), Positives = 70/140 (50%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A+ G  +     H+  V C+   +K     ++G  D ++ +W I        L GH + V
Sbjct: 66  AETGECIHTLYGHTSTVRCMHLHEKRV---VSGSRDATLRVWDIETGQCLHVLMGHVAAV 122

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             + +D   ++  +G+   ++K+WD E    + TL GH +   +L+F   G    SGS+D
Sbjct: 123 RCVQYDGRRVV--SGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFD--GIHVVSGSLD 178

Query: 560 TNLKIWDIRKKGCIHTYKGH 619
           T++++WD+    CIHT  GH
Sbjct: 179 TSIRVWDVETGNCIHTLTGH 198



 Score = 75.9 bits (185), Expect = 6e-13
 Identities = 45/142 (31%), Positives = 71/142 (50%), Gaps = 1/142 (0%)
 Frame = +2

Query: 248 VNCLRFGKKTC-RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAG 424
           + CL+F    C    ++G DD+++ +WS        TL GHT  V S      + ++ +G
Sbjct: 2   ITCLQF----CGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS--SQMRDNIIISG 55

Query: 425 SSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIH 604
           S+   +K+W+ E  + I TL GH S    +  H   +   SGS D  L++WDI    C+H
Sbjct: 56  STDRTLKVWNAETGECIHTLYGHTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQCLH 113

Query: 605 TYKGHTRGISTIRFTPDGRWVV 670
              GH   +  +++  DGR VV
Sbjct: 114 VLMGHVAAVRCVQY--DGRRVV 133



 Score = 72.4 bits (176), Expect = 7e-12
 Identities = 45/157 (28%), Positives = 77/157 (49%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A  G  L+  V H+G V   +       + ++G  D ++ +W+        TL GHTS V
Sbjct: 26  AVTGKCLRTLVGHTGGVWSSQMRDN---IIISGSTDRTLKVWNAETGECIHTLYGHTSTV 82

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             +     E  V +GS    +++WD+E  + +  L GH +    +++   G    SG+ D
Sbjct: 83  RCMHLH--EKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYD--GRRVVSGAYD 138

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
             +K+WD   + C+HT +GHT  + +++F  DG  VV
Sbjct: 139 FMVKVWDPETETCLHTLQGHTNRVYSLQF--DGIHVV 173



 Score = 38.9 bits (89), Expect = 0.082
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 3/70 (4%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSG---HTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           + ++G  D +V +W I       TL G   H S V  + F+   ++ +  S  G +KLWD
Sbjct: 211 ILVSGNADSTVKIWDIKTGQCLQTLQGPSKHQSAVTCLQFNKNFVITS--SDDGTVKLWD 268

Query: 455 LEDTKMIRTL 484
           L+  + IR L
Sbjct: 269 LKTGEFIRNL 278



>gb:AK011064_1156171 Mus musculus 13 days embryo liver cDNA, RIKEN
           full-length enriched library, clone:2510040D07
           product:hypothetical Signal peptidase/Trp-Asp (WD)
           repeats profile/Trp-Asp (WD) repeats circular
           profile/G-protein beta WD-40 repeats containing protein,
           full insert sequence.
          Length = 356

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 40/148 (27%), Positives = 70/148 (47%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           F AH+  V  + F     +  +T  DD +V +WS  +     +L+ H + V    F    
Sbjct: 98  FRAHTATVRSVHFCSDG-QSLVTASDDKTVKVWSTHRQRFLFSLTQHINWVRCAKFSPDG 156

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            L+ + S    +KLWD    + I +   H  + T ++FHP G   A+  MD  +K+WD R
Sbjct: 157 RLIVSASDDKTVKLWDKTSRECIHSYCEHGGFVTYVDFHPSGTCIAAAGMDNTVKVWDAR 216

Query: 587 KKGCIHTYKGHTRGISTIRFTPDGRWVV 670
               +  Y+ H+  ++ + F P G +++
Sbjct: 217 THRLLQHYQLHSAAVNALSFHPSGNYLI 244



 Score = 72.8 bits (177), Expect = 5e-12
 Identities = 37/144 (25%), Positives = 64/144 (44%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           F  H+  V C+ F      +  +G  D +V +W       ++    HT+ V S+ F S  
Sbjct: 56  FTGHNDAVTCVNFSPSG-HLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDG 114

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
             +   S    +K+W     + + +L+ H ++    +F P G    S S D  +K+WD  
Sbjct: 115 QSLVTASDDKTVKVWSTHRQRFLFSLTQHINWVRCAKFSPDGRLIVSASDDKTVKLWDKT 174

Query: 587 KKGCIHTYKGHTRGISTIRFTPDG 658
            + CIH+Y  H   ++ + F P G
Sbjct: 175 SRECIHSYCEHGGFVTYVDFHPSG 198



 Score = 69.3 bits (168), Expect = 6e-11
 Identities = 37/143 (25%), Positives = 64/143 (44%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H   V C +F     R+ ++  DD +V LW         +   H   V  + F  +   +
Sbjct: 143 HINWVRCAKFSPDG-RLIVSASDDKTVKLWDKTSRECIHSYCEHGGFVTYVDFHPSGTCI 201

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
           AA      +K+WD    ++++    H +   AL FHP G +  + S D+ LKI D+ +  
Sbjct: 202 AAAGMDNTVKVWDARTHRLLQHYQLHSAAVNALSFHPSGNYLITASSDSTLKILDLMEGR 261

Query: 596 CIHTYKGHTRGISTIRFTPDGRW 664
            ++T  GH    +T+ F+  G +
Sbjct: 262 LLYTLHGHQGPATTVAFSRTGEY 284



 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 30/111 (27%), Positives = 49/111 (44%)
 Frame = +2

Query: 338 PTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALE 517
           P+      GH   V  + F      +A+GS    + +W ++        +GH    T + 
Sbjct: 8   PSLERHFKGHRDAVTRVDFSLNTKHLASGSMDSTLMIWHMKPQSRAYRFTGHNDAVTCVN 67

Query: 518 FHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           F P G   ASGS D  ++IW    KG    ++ HT  + ++ F  DG+ +V
Sbjct: 68  FSPSGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDGQSLV 118



 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 32/121 (26%), Positives = 56/121 (46%), Gaps = 1/121 (0%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKK-TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAF 394
           +  +  H G V  + F    TC      G D++V +W             H++ V +++F
Sbjct: 179 IHSYCEHGGFVTYVDFHPSGTC--IAAAGMDNTVKVWDARTHRLLQHYQLHSAAVNALSF 236

Query: 395 DSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI 574
             +   +   SS   +K+ DL + +++ TL GH+   T + F   GE+FASG  D  + +
Sbjct: 237 HPSGNYLITASSDSTLKILDLMEGRLLYTLHGHQGPATTVAFSRTGEYFASGGSDEQVMV 296

Query: 575 W 577
           W
Sbjct: 297 W 297



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 31/150 (20%), Positives = 63/150 (42%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           + F  H   V  + F   T +   +G  D ++ +W +   +     +GH   V  + F  
Sbjct: 12  RHFKGHRDAVTRVDFSLNT-KHLASGSMDSTLMIWHMKPQSRAYRFTGHNDAVTCVNFSP 70

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
           +  L+A+GS    +++W             H +   ++ F   G+   + S D  +K+W 
Sbjct: 71  SGHLLASGSRDKTVRIWVPNVKGESTVFRAHTATVRSVHFCSDGQSLVTASDDKTVKVWS 130

Query: 581 IRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
             ++  + +   H   +   +F+PDGR +V
Sbjct: 131 THRQRFLFSLTQHINWVRCAKFSPDGRLIV 160



 Score = 49.3 bits (116), Expect = 6e-05
 Identities = 21/67 (31%), Positives = 36/67 (53%)
 Frame = +2

Query: 458 EDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIST 637
           +D  + R   GHR   T ++F    +  ASGSMD+ L IW ++ +   + + GH   ++ 
Sbjct: 6   QDPSLERHFKGHRDAVTRVDFSLNTKHLASGSMDSTLMIWHMKPQSRAYRFTGHNDAVTC 65

Query: 638 IRFTPDG 658
           + F+P G
Sbjct: 66  VNFSPSG 72



>sp|Q12417|PR46_YEAST Pre-mRNA splicing factor
           PRP46.>pir|S65162|S65162 hypothetical protein YPL151c -
           yeast (Saccharomyces cerevisiae)>gb:SCLACHXVI_1708657
           S.cerevisiae chromosome XVI, left arm
           DNA.>gb:SCYPL151C_1714664 S.cerevisiae chromosome XVI
           reading frame ORF YPL151c.
          Length = 451

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 42/148 (28%), Positives = 71/148 (47%), Gaps = 1/148 (0%)
 Frame = +2

Query: 212 YKLQEFV-AHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           +KL   +  H G V C+         F+TG +D ++ +W +      +TL+GH   V  +
Sbjct: 129 WKLSRVINGHLGWVRCVAIDPVDNEWFITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDV 188

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           A       + + S    +K WDLE  ++IR   GH S    +  HP  +  A+   D+ +
Sbjct: 189 AVSDRHPYLFSVSEDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVI 248

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           K+WD+R +  + T  GH   I+ ++ TP
Sbjct: 249 KLWDMRTRIPVITLVGHKGPINQVQCTP 276



 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 29/138 (21%), Positives = 59/138 (42%)
 Frame = +2

Query: 218 LQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD 397
           ++++  H   V  +     T  +  T G D  + LW +       TL GH  P+  +   
Sbjct: 217 IRDYYGHLSGVRTVSI-HPTLDLIATAGRDSVIKLWDMRTRIPVITLVGHKGPINQVQCT 275

Query: 398 SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
             +  V + S+   ++LWD+   K ++ L+ H+    A   HP  EF  + +   +++ W
Sbjct: 276 PVDPQVVSSSTDATVRLWDVVAGKTMKVLTHHKRSVRATALHP-KEFSVASACTDDIRSW 334

Query: 578 DIRKKGCIHTYKGHTRGI 631
            + +   +  ++    GI
Sbjct: 335 GLAEGSLLTNFESEKTGI 352



 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 28/117 (23%), Positives = 47/117 (40%)
 Frame = +2

Query: 302 DDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRT 481
           +D +V  W + K        GH S V +++      L+A      +IKLWD+     + T
Sbjct: 202 EDKTVKCWDLEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWDMRTRIPVIT 261

Query: 482 LSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           L GH+     ++  P      S S D  +++WD+     +     H R +      P
Sbjct: 262 LVGHKGPINQVQCTPVDPQVVSSSTDATVRLWDVVAGKTMKVLTHHKRSVRATALHP 318



>sp|Q8VBV4|FBW7_MOUSE F-box/WD-repeat protein 7 (F-box and WD-40
           domain protein 7) (F-box protein FBW7) (F-box protein
           Fbxw6) (F-box-WD40 repeat protein 6)
           (SEL-10).>gb:AF391192_2064733 Mus musculus F-box-WD40
           repeat protein 6 (Fbxw6) mRNA, complete
           cds.>gb:F391193S10_2112876 Mus musculus F-box-WD40
           repeat protein 6 (Fbxw6) gene, exon 10 and complete cds.
          Length = 629

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 48/149 (32%), Positives = 75/149 (50%), Gaps = 3/149 (2%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L   + H   V C+++     R  ++G  D  V +W     T   TL GHT+ V S+
Sbjct: 413 GQCLHVLMGHVAAVRCVQYDG---RRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSL 469

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            FD   I V +GS    I++WD+E    I TL+GH+S  + +E         SG+ D+ +
Sbjct: 470 QFDG--IHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTV 525

Query: 569 KIWDIRKKGCIHTYKG---HTRGISTIRF 646
           KIWDI+   C+ T +G   H   ++ ++F
Sbjct: 526 KIWDIKTGQCLQTLQGPSKHQSAVTCLQF 554



 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 40/140 (28%), Positives = 70/140 (50%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A+ G  +     H+  V C+   +K     ++G  D ++ +W I        L GH + V
Sbjct: 370 AETGECIHTLYGHTSTVRCMHLHEKRV---VSGSRDATLRVWDIETGQCLHVLMGHVAAV 426

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             + +D   ++  +G+   ++K+WD E    + TL GH +   +L+F   G    SGS+D
Sbjct: 427 RCVQYDGRRVV--SGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFD--GIHVVSGSLD 482

Query: 560 TNLKIWDIRKKGCIHTYKGH 619
           T++++WD+    CIHT  GH
Sbjct: 483 TSIRVWDVETGNCIHTLTGH 502



 Score = 75.9 bits (185), Expect = 6e-13
 Identities = 45/142 (31%), Positives = 71/142 (50%), Gaps = 1/142 (0%)
 Frame = +2

Query: 248 VNCLRFGKKTC-RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAG 424
           + CL+F    C    ++G DD+++ +WS        TL GHT  V S      + ++ +G
Sbjct: 306 ITCLQF----CGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS--SQMRDNIIISG 359

Query: 425 SSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIH 604
           S+   +K+W+ E  + I TL GH S    +  H   +   SGS D  L++WDI    C+H
Sbjct: 360 STDRTLKVWNAETGECIHTLYGHTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQCLH 417

Query: 605 TYKGHTRGISTIRFTPDGRWVV 670
              GH   +  +++  DGR VV
Sbjct: 418 VLMGHVAAVRCVQY--DGRRVV 437



 Score = 72.4 bits (176), Expect = 7e-12
 Identities = 45/157 (28%), Positives = 77/157 (49%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A  G  L+  V H+G V   +       + ++G  D ++ +W+        TL GHTS V
Sbjct: 330 AVTGKCLRTLVGHTGGVWSSQMRDN---IIISGSTDRTLKVWNAETGECIHTLYGHTSTV 386

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             +     E  V +GS    +++WD+E  + +  L GH +    +++   G    SG+ D
Sbjct: 387 RCMHLH--EKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYD--GRRVVSGAYD 442

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
             +K+WD   + C+HT +GHT  + +++F  DG  VV
Sbjct: 443 FMVKVWDPETETCLHTLQGHTNRVYSLQF--DGIHVV 477



 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 35/107 (32%), Positives = 47/107 (43%)
 Frame = +2

Query: 323 WSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSY 502
           W  G+  S   L GH   V +        +V+ GS    +K+W     K +RTL GH   
Sbjct: 287 WRRGELKSPKVLKGHDDHVITCLQFCGNRIVS-GSDDNTLKVWSAVTGKCLRTLVGHTGG 345

Query: 503 CTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
             + +         SGS D  LK+W+     CIHT  GHT   ST+R
Sbjct: 346 VWSSQMR--DNIIISGSTDRTLKVWNAETGECIHTLYGHT---STVR 387



 Score = 38.9 bits (89), Expect = 0.082
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 3/70 (4%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSG---HTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           + ++G  D +V +W I       TL G   H S V  + F+   ++ +  S  G +KLWD
Sbjct: 515 ILVSGNADSTVKIWDIKTGQCLQTLQGPSKHQSAVTCLQFNKNFVITS--SDDGTVKLWD 572

Query: 455 LEDTKMIRTL 484
           L+  + IR L
Sbjct: 573 LKTGEFIRNL 582



>sp|Q969H0|FBW7_HUMAN F-box/WD-repeat protein 7 (F-box and WD-40
           domain protein 7) (F-box protein FBX30) (hCdc4)
           (Archipelago homolog) (hAgo)
           (SEL-10).>gb:CR749305_1180934 Homo sapiens mRNA; cDNA
           DKFZp686F23254 (from clone
           DKFZp686F23254).>gb:AX722143_1473862 Sequence 1 from
           Patent WO03024999.>gb:AF411971_1901546 Homo sapiens
           archipelago alpha form mRNA, complete
           cds.>gb:AY049984_1935217 Homo sapiens F-box protein CDC4
           (CDC4) mRNA, complete cds.
          Length = 707

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 48/149 (32%), Positives = 75/149 (50%), Gaps = 3/149 (2%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L   + H   V C+++     R  ++G  D  V +W     T   TL GHT+ V S+
Sbjct: 491 GQCLHVLMGHVAAVRCVQYDG---RRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSL 547

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            FD   I V +GS    I++WD+E    I TL+GH+S  + +E         SG+ D+ +
Sbjct: 548 QFDG--IHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELK--DNILVSGNADSTV 603

Query: 569 KIWDIRKKGCIHTYKG---HTRGISTIRF 646
           KIWDI+   C+ T +G   H   ++ ++F
Sbjct: 604 KIWDIKTGQCLQTLQGPNKHQSAVTCLQF 632



 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 40/140 (28%), Positives = 70/140 (50%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A+ G  +     H+  V C+   +K     ++G  D ++ +W I        L GH + V
Sbjct: 448 AETGECIHTLYGHTSTVRCMHLHEKRV---VSGSRDATLRVWDIETGQCLHVLMGHVAAV 504

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             + +D   ++  +G+   ++K+WD E    + TL GH +   +L+F   G    SGS+D
Sbjct: 505 RCVQYDGRRVV--SGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFD--GIHVVSGSLD 560

Query: 560 TNLKIWDIRKKGCIHTYKGH 619
           T++++WD+    CIHT  GH
Sbjct: 561 TSIRVWDVETGNCIHTLTGH 580



 Score = 75.9 bits (185), Expect = 6e-13
 Identities = 45/142 (31%), Positives = 71/142 (50%), Gaps = 1/142 (0%)
 Frame = +2

Query: 248 VNCLRFGKKTC-RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAG 424
           + CL+F    C    ++G DD+++ +WS        TL GHT  V S      + ++ +G
Sbjct: 384 ITCLQF----CGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWS--SQMRDNIIISG 437

Query: 425 SSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIH 604
           S+   +K+W+ E  + I TL GH S    +  H   +   SGS D  L++WDI    C+H
Sbjct: 438 STDRTLKVWNAETGECIHTLYGHTSTVRCMHLHE--KRVVSGSRDATLRVWDIETGQCLH 495

Query: 605 TYKGHTRGISTIRFTPDGRWVV 670
              GH   +  +++  DGR VV
Sbjct: 496 VLMGHVAAVRCVQY--DGRRVV 515



 Score = 72.4 bits (176), Expect = 7e-12
 Identities = 45/157 (28%), Positives = 77/157 (49%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           A  G  L+  V H+G V   +       + ++G  D ++ +W+        TL GHTS V
Sbjct: 408 AVTGKCLRTLVGHTGGVWSSQMRDN---IIISGSTDRTLKVWNAETGECIHTLYGHTSTV 464

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
             +     E  V +GS    +++WD+E  + +  L GH +    +++   G    SG+ D
Sbjct: 465 RCMHLH--EKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYD--GRRVVSGAYD 520

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
             +K+WD   + C+HT +GHT  + +++F  DG  VV
Sbjct: 521 FMVKVWDPETETCLHTLQGHTNRVYSLQF--DGIHVV 555



 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 35/107 (32%), Positives = 47/107 (43%)
 Frame = +2

Query: 323 WSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSY 502
           W  G+  S   L GH   V +        +V+ GS    +K+W     K +RTL GH   
Sbjct: 365 WRRGELKSPKVLKGHDDHVITCLQFCGNRIVS-GSDDNTLKVWSAVTGKCLRTLVGHTGG 423

Query: 503 CTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIR 643
             + +         SGS D  LK+W+     CIHT  GHT   ST+R
Sbjct: 424 VWSSQMR--DNIIISGSTDRTLKVWNAETGECIHTLYGHT---STVR 465



 Score = 38.9 bits (89), Expect = 0.082
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 3/70 (4%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSG---HTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           + ++G  D +V +W I       TL G   H S V  + F+   ++ +  S  G +KLWD
Sbjct: 593 ILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITS--SDDGTVKLWD 650

Query: 455 LEDTKMIRTL 484
           L+  + IR L
Sbjct: 651 LKTGEFIRNL 660



>gb:RNU88324_2137869 Rattus norvegicus G protein beta1 subunit
           (rGb1) mRNA, complete cds.
          Length = 340

 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 46/149 (30%), Positives = 74/149 (49%), Gaps = 2/149 (1%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           +E   H+G ++C RF        +T   D +  LW I     T+T +GHT  V S++   
Sbjct: 137 RELAGHTGYLSCCRFLDDN--QIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAP 194

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
              L  +G+    +KLWD+ +    +T +GH S   A+ F P G  FA+GS D   +++D
Sbjct: 195 DTRLFVSGACDASVKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFD 254

Query: 581 IRKKGCIHTYKGHT--RGISTIRFTPDGR 661
           +R    + TY       GI+++ F+  GR
Sbjct: 255 LRADQELMTYSHDNIICGITSVPFSKSGR 283



 Score = 70.5 bits (171), Expect = 3e-11
 Identities = 44/152 (28%), Positives = 64/152 (42%), Gaps = 2/152 (1%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +   F  H+G+V  L     T R+F++G  D SV LW + +     T +GH S + +I
Sbjct: 174 GQQTTTFTGHTGDVMSLSLAPDT-RLFVSGACDASVKLWDVREGMCRQTFTGHESDINAI 232

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYC--TALEFHPFGEFFASGSMDT 562
            F       A GS     +L+DL   + + T S     C  T++ F   G     G  D 
Sbjct: 233 CFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVPFSKSGRLLLGGYDDF 292

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           N  +WD           GH   +S +  T DG
Sbjct: 293 NCNVWDALNADRAGVLAGHDNRVSCLGVTDDG 324



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 33/149 (22%), Positives = 63/149 (42%), Gaps = 4/149 (2%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H   +  + +G  + R+ ++   D  + +W          +   +S V + A+  +   V
Sbjct: 54  HLAKIYAMHWGTDS-RLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYV 112

Query: 416 AAGSSSGLIKLWDLE----DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
           A G    +  +++L+    + ++ R L+GH  Y +   F    +   S S DT   +WDI
Sbjct: 113 ACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTS-SGDTTCALWDI 171

Query: 584 RKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
                  T+ GHT  + ++   PD R  V
Sbjct: 172 ETGQQTTTFTGHTGDVMSLSLAPDTRLFV 200



 Score = 45.4 bits (106), Expect = 9e-04
 Identities = 26/109 (23%), Positives = 52/109 (47%), Gaps = 4/109 (3%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           TL GH + + ++ + +   L+ + S  G + +WD   T  +  +    S+     + P G
Sbjct: 50  TLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSG 109

Query: 533 EFFASGSMDTNLKIWDIR-KKGCIHTYK---GHTRGISTIRFTPDGRWV 667
            + A G +D    I++++ ++G +   +   GHT  +S  RF  D + V
Sbjct: 110 NYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIV 158



 Score = 38.5 bits (88), Expect = 0.11
 Identities = 18/61 (29%), Positives = 29/61 (47%)
 Frame = +2

Query: 272 KTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLW 451
           K+ R+ L G DD + N+W          L+GH + V  +      + VA GS    +K+W
Sbjct: 280 KSGRLLLGGYDDFNCNVWDALNADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIW 339

Query: 452 D 454
           +
Sbjct: 340 N 340



 Score = 34.3 bits (77), Expect = 2.0
 Identities = 18/64 (28%), Positives = 26/64 (40%)
 Frame = +2

Query: 476 RTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
           RTL GH +   A+ +        S S D  L IWD      +H     +  + T  + P 
Sbjct: 49  RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 656 GRWV 667
           G +V
Sbjct: 109 GNYV 112



>gb:AY120781_1579663 Arabidopsis thaliana WD40-repeat protein
           (At5g16750) mRNA, partial cds.
          Length = 823

 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 43/151 (28%), Positives = 71/151 (47%), Gaps = 10/151 (6%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIG-------KPTSTSTLS---GHTSPVES 385
           H+G++  + F KK+   F++G  D ++ +WS+        +P +  T S    H   + S
Sbjct: 445 HNGDILAVAFAKKSFSFFVSGSGDRTLKVWSLDGISEDSEEPINLKTRSVVAAHDKDINS 504

Query: 386 IAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTN 565
           +A    + LV  GS      +W L D   + TL GH+    ++EF    +   + S D  
Sbjct: 505 VAVARNDSLVCTGSEDRTASIWRLPDLVHVVTLKGHKRRIFSVEFSTVDQCVMTASGDKT 564

Query: 566 LKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           +KIW I    C+ T++GHT  +    F  DG
Sbjct: 565 VKIWAISDGSCLKTFEGHTSSVLRASFITDG 595



 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 35/129 (27%), Positives = 57/129 (44%)
 Frame = +2

Query: 233 AHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEIL 412
           AH  ++N +   +    +  TG +D + ++W +       TL GH   + S+ F + +  
Sbjct: 497 AHDKDINSVAVARNDS-LVCTGSEDRTASIWRLPDLVHVVTLKGHKRRIFSVEFSTVDQC 555

Query: 413 VAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKK 592
           V   S    +K+W + D   ++T  GH S      F   G  F S   D  LK+W++   
Sbjct: 556 VMTASGDKTVKIWAISDGSCLKTFEGHTSSVLRASFITDGTQFVSCGADGLLKLWNVNTS 615

Query: 593 GCIHTYKGH 619
            CI TY  H
Sbjct: 616 ECIATYDQH 624



 Score = 65.9 bits (159), Expect = 6e-10
 Identities = 31/102 (30%), Positives = 51/102 (50%)
 Frame = +2

Query: 350 STLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPF 529
           ST+ G +  + ++A    + L+ +   S  I++WDLE  K IR+  GH      +  H  
Sbjct: 54  STIEGESDTLTALALSPDDKLLFSAGHSRQIRVWDLETLKCIRSWKGHEGPVMGMACHAS 113

Query: 530 GEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
           G   A+   D  + +WD+    C H ++GH   +S+I F PD
Sbjct: 114 GGLLATAGADRKVLVWDVDGGFCTHYFRGHKGVVSSILFHPD 155



 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 28/132 (21%), Positives = 59/132 (44%), Gaps = 6/132 (4%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
           ++  + G    + +W +       +  GH  PV  +A  ++  L+A   +   + +WD++
Sbjct: 73  KLLFSAGHSRQIRVWDLETLKCIRSWKGHEGPVMGMACHASGGLLATAGADRKVLVWDVD 132

Query: 461 DTKMIRTLSGHRSYCTALEFHPFG--EFFASGSMDTNLKIWDIR----KKGCIHTYKGHT 622
                    GH+   +++ FHP        SGS D  +++WD+     +K C+   + H 
Sbjct: 133 GGFCTHYFRGHKGVVSSILFHPDSNKNILISGSDDATVRVWDLNAKNTEKKCLAIMEKHF 192

Query: 623 RGISTIRFTPDG 658
             +++I  + DG
Sbjct: 193 SAVTSIALSEDG 204



 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 27/96 (28%), Positives = 44/96 (45%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           +T   D +V +W+I   +   T  GHTS V   +F +      +  + GL+KLW++  ++
Sbjct: 557 MTASGDKTVKIWAISDGSCLKTFEGHTSSVLRASFITDGTQFVSCGADGLLKLWNVNTSE 616

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
            I T   H     AL      E  A+G  D  + +W
Sbjct: 617 CIATYDQHEDKVWALAVGKKTEMIATGGGDAVINLW 652



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 29/121 (23%), Positives = 52/121 (42%), Gaps = 8/121 (6%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCR-MFLTGGDDHSVNLWSIGKPTST----STLSGHTS 373
           G+    F  H G V+ + F   + + + ++G DD +V +W +    +     + +  H S
Sbjct: 134 GFCTHYFRGHKGVVSSILFHPDSNKNILISGSDDATVRVWDLNAKNTEKKCLAIMEKHFS 193

Query: 374 PVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGH---RSYCTALEFHPFGEFFA 544
            V SIA     + + +     ++ LWDL D     T++ +    +  T     PF  F A
Sbjct: 194 AVTSIALSEDGLTLFSAGRDKVVNLWDLHDYSCKATVATYEVLEAVTTVSSGTPFASFVA 253

Query: 545 S 547
           S
Sbjct: 254 S 254



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 21/78 (26%), Positives = 36/78 (46%)
 Frame = +2

Query: 386 IAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTN 565
           ++ D + I  A G    +I + D  D+ +  T+ G     TAL   P  +   S      
Sbjct: 27  VSSDGSFIACACGD---VINIVDSTDSSVKSTIEGESDTLTALALSPDDKLLFSAGHSRQ 83

Query: 566 LKIWDIRKKGCIHTYKGH 619
           +++WD+    CI ++KGH
Sbjct: 84  IRVWDLETLKCIRSWKGH 101



 Score = 34.3 bits (77), Expect = 2.0
 Identities = 21/101 (20%), Positives = 42/101 (41%), Gaps = 4/101 (3%)
 Frame = +2

Query: 356 LSGHTSPVESIAF-DSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           L G+   +  + F    E  +A  ++   ++++D+        L+GH+    +L+     
Sbjct: 354 LVGYNEEIADMKFLGDEEQFLAVATNLEEVRVYDVATMSCSYVLAGHKEVVLSLDTCVSS 413

Query: 533 E---FFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
                  +GS D  +++W+   K CI    GH   I  + F
Sbjct: 414 SGNVLIVTGSKDKTVRLWNATSKSCIGVGTGHNGDILAVAF 454



>gb:AY056281_1563595 Arabidopsis thaliana putative WD40-repeat
           protein (At5g16750) mRNA, complete
           cds.>gb:AY117219_1579260 Arabidopsis thaliana putative
           WD40-repeat protein (At5g16750) mRNA, complete cds.
          Length = 689

 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 43/151 (28%), Positives = 71/151 (47%), Gaps = 10/151 (6%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIG-------KPTSTSTLS---GHTSPVES 385
           H+G++  + F KK+   F++G  D ++ +WS+        +P +  T S    H   + S
Sbjct: 258 HNGDILAVAFAKKSFSFFVSGSGDRTLKVWSLDGISEDSEEPINLKTRSVVAAHDKDINS 317

Query: 386 IAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTN 565
           +A    + LV  GS      +W L D   + TL GH+    ++EF    +   + S D  
Sbjct: 318 VAVARNDSLVCTGSEDRTASIWRLPDLVHVVTLKGHKRRIFSVEFSTVDQCVMTASGDKT 377

Query: 566 LKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           +KIW I    C+ T++GHT  +    F  DG
Sbjct: 378 VKIWAISDGSCLKTFEGHTSSVLRASFITDG 408



 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 35/129 (27%), Positives = 57/129 (44%)
 Frame = +2

Query: 233 AHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEIL 412
           AH  ++N +   +    +  TG +D + ++W +       TL GH   + S+ F + +  
Sbjct: 310 AHDKDINSVAVARNDS-LVCTGSEDRTASIWRLPDLVHVVTLKGHKRRIFSVEFSTVDQC 368

Query: 413 VAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKK 592
           V   S    +K+W + D   ++T  GH S      F   G  F S   D  LK+W++   
Sbjct: 369 VMTASGDKTVKIWAISDGSCLKTFEGHTSSVLRASFITDGTQFVSCGADGLLKLWNVNTS 428

Query: 593 GCIHTYKGH 619
            CI TY  H
Sbjct: 429 ECIATYDQH 437



 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 27/96 (28%), Positives = 44/96 (45%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           +T   D +V +W+I   +   T  GHTS V   +F +      +  + GL+KLW++  ++
Sbjct: 370 MTASGDKTVKIWAISDGSCLKTFEGHTSSVLRASFITDGTQFVSCGADGLLKLWNVNTSE 429

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
            I T   H     AL      E  A+G  D  + +W
Sbjct: 430 CIATYDQHEDKVWALAVGKKTEMIATGGGDAVINLW 465



 Score = 34.3 bits (77), Expect = 2.0
 Identities = 21/101 (20%), Positives = 42/101 (41%), Gaps = 4/101 (3%)
 Frame = +2

Query: 356 LSGHTSPVESIAF-DSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           L G+   +  + F    E  +A  ++   ++++D+        L+GH+    +L+     
Sbjct: 167 LVGYNEEIADMKFLGDEEQFLAVATNLEEVRVYDVATMSCSYVLAGHKEVVLSLDTCVSS 226

Query: 533 E---FFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
                  +GS D  +++W+   K CI    GH   I  + F
Sbjct: 227 SGNVLIVTGSKDKTVRLWNATSKSCIGVGTGHNGDILAVAF 267



>gb:AK077037_1171628 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4932422L05
           product:MEIOTIC RECOMBINATION PROTEIN REC14
           (2810418I05RIK PROTEIN) homolog [Mus musculus], full
           insert sequence.
          Length = 279

 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 37/109 (33%), Positives = 57/109 (52%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           +G  D  +N++ I       TL GH  P+ S+ F     L+   S  G IK++D++   +
Sbjct: 165 SGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANL 224

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGH 619
             TLSGH S+   + F P    F S S D ++K+WD+  + CIHT+  H
Sbjct: 225 AGTLSGHASWVLNVAFCPDDTHFVSSSSDKSVKVWDVGTRTCIHTFFDH 273



 Score = 58.9 bits (141), Expect = 8e-08
 Identities = 32/121 (26%), Positives = 56/121 (46%)
 Frame = +2

Query: 293 TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM 472
           TG     VN++ +       +L      + SIA+      +A+G+  G+I ++D+   K+
Sbjct: 123 TGTHMGKVNIFGVESGKKEYSLDTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKL 182

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           + TL GH     +L F P  +   + S D  +KI+D++      T  GH   +  + F P
Sbjct: 183 LHTLEGHAMPIRSLTFSPDSQLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNVAFCP 242

Query: 653 D 655
           D
Sbjct: 243 D 243



 Score = 58.9 bits (141), Expect = 8e-08
 Identities = 29/122 (23%), Positives = 59/122 (48%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D  + LW +       ++        ++AF      +A G+  G + ++ +E  K   +L
Sbjct: 85  DAHIRLWDLENGKQMKSIDAGPVDAWTLAFSPDSQYLATGTHMGKVNIFGVESGKKEYSL 144

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
                +  ++ + P G++ ASG++D  + I+DI     +HT +GH   I ++ F+PD + 
Sbjct: 145 DTRGKFILSIAYSPDGKYLASGAIDGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQL 204

Query: 665 VV 670
           +V
Sbjct: 205 LV 206



 Score = 43.1 bits (100), Expect = 0.004
 Identities = 25/96 (26%), Positives = 43/96 (44%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L     H+  +  L F   + ++ +T  DD  + ++ +       TLSGH S V ++
Sbjct: 180 GKLLHTLEGHAMPIRSLTFSPDS-QLLVTASDDGYIKIYDVQHANLAGTLSGHASWVLNV 238

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHR 496
           AF   +    + SS   +K+WD+     I T   H+
Sbjct: 239 AFCPDDTHFVSSSSDKSVKVWDVGTRTCIHTFFDHQ 274



>gb:BA000039_726273 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 349

 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 37/127 (29%), Positives = 66/127 (51%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           ++G  D ++ LW +G     +TLSGH   V  +A       +A+ S    +KLW++   +
Sbjct: 124 ISGSKDKTIKLWGVGDRQLQATLSGHQDFVNGLALSPDGRTLASASYDHTVKLWNVPSRQ 183

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFT 649
            I TL  +     ++     G F A+G +D  ++IWD+  +  + T +GHT  ++++ FT
Sbjct: 184 EITTLKANEGIMLSVAISRDGRFLATGGVDKLIRIWDLPSRRLLRTLEGHTSDVNSLAFT 243

Query: 650 PDGRWVV 670
           PD   +V
Sbjct: 244 PDSSQLV 250



 Score = 72.8 bits (177), Expect = 5e-12
 Identities = 39/144 (27%), Positives = 67/144 (46%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H   VN +          ++ GDD  +  W++   T+     GHT  + ++        V
Sbjct: 65  HEDEVNAIALSPDG-NFLVSAGDDRRLYFWNLATGTALGQAKGHTDWIYALVMTPDGQTV 123

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
            +GS    IKLW + D ++  TLSGH+ +   L   P G   AS S D  +K+W++  + 
Sbjct: 124 ISGSKDKTIKLWGVGDRQLQATLSGHQDFVNGLALSPDGRTLASASYDHTVKLWNVPSRQ 183

Query: 596 CIHTYKGHTRGISTIRFTPDGRWV 667
            I T K +   + ++  + DGR++
Sbjct: 184 EITTLKANEGIMLSVAISRDGRFL 207



 Score = 65.5 bits (158), Expect = 8e-10
 Identities = 34/126 (26%), Positives = 58/126 (46%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
           R   +   DH+V LW++      +TL  +   + S+A       +A G    LI++WDL 
Sbjct: 163 RTLASASYDHTVKLWNVPSRQEITTLKANEGIMLSVAISRDGRFLATGGVDKLIRIWDLP 222

Query: 461 DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
             +++RTL GH S   +L F P      SGS    +K+W++        +      + ++
Sbjct: 223 SRRLLRTLEGHTSDVNSLAFTPDSSQLVSGSDKDGIKLWNLTTGELQQQFGTEGGQVFSV 282

Query: 641 RFTPDG 658
             +PDG
Sbjct: 283 AVSPDG 288



 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 36/125 (28%), Positives = 57/125 (45%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
           R   TGG D  + +W +       TL GHTS V S+AF      + +GS    IKLW+L 
Sbjct: 205 RFLATGGVDKLIRIWDLPSRRLLRTLEGHTSDVNSLAFTPDSSQLVSGSDKDGIKLWNLT 264

Query: 461 DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
             ++ +          ++   P G   ASG  D  +K+W +  +  +   KGH+  + ++
Sbjct: 265 TGELQQQFGTEGGQVFSVAVSPDGSTLASGHGDQTVKLWSLSGQ-LLRNLKGHSGAVYSV 323

Query: 641 RFTPD 655
            F  D
Sbjct: 324 VFGQD 328



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 1/104 (0%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFD-SAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPF 529
           TL GH   V +IA       LV+AG    L   W+L     +    GH  +  AL   P 
Sbjct: 61  TLRGHEDEVNAIALSPDGNFLVSAGDDRRLY-FWNLATGTALGQAKGHTDWIYALVMTPD 119

Query: 530 GEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGR 661
           G+   SGS D  +K+W +  +    T  GH   ++ +  +PDGR
Sbjct: 120 GQTVISGSKDKTIKLWGVGDRQLQATLSGHQDFVNGLALSPDGR 163



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 22/64 (34%), Positives = 29/64 (45%)
 Frame = +2

Query: 479 TLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           TL GH     A+   P G F  S   D  L  W++     +   KGHT  I  +  TPDG
Sbjct: 61  TLRGHEDEVNAIALSPDGNFLVSAGDDRRLYFWNLATGTALGQAKGHTDWIYALVMTPDG 120

Query: 659 RWVV 670
           + V+
Sbjct: 121 QTVI 124



>pir|T51507|T51507 WD40-repeat protein - Arabidopsis
           thaliana>gb:ATF5E19_1550764 Arabidopsis thaliana DNA
           chromosome 5, BAC clone F5E19 (ESSA project).
          Length = 876

 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 43/151 (28%), Positives = 71/151 (47%), Gaps = 10/151 (6%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIG-------KPTSTSTLS---GHTSPVES 385
           H+G++  + F KK+   F++G  D ++ +WS+        +P +  T S    H   + S
Sbjct: 445 HNGDILAVAFAKKSFSFFVSGSGDRTLKVWSLDGISEDSEEPINLKTRSVVAAHDKDINS 504

Query: 386 IAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTN 565
           +A    + LV  GS      +W L D   + TL GH+    ++EF    +   + S D  
Sbjct: 505 VAVARNDSLVCTGSEDRTASIWRLPDLVHVVTLKGHKRRIFSVEFSTVDQCVMTASGDKT 564

Query: 566 LKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           +KIW I    C+ T++GHT  +    F  DG
Sbjct: 565 VKIWAISDGSCLKTFEGHTSSVLRASFITDG 595



 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 35/129 (27%), Positives = 57/129 (44%)
 Frame = +2

Query: 233 AHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEIL 412
           AH  ++N +   +    +  TG +D + ++W +       TL GH   + S+ F + +  
Sbjct: 497 AHDKDINSVAVARNDS-LVCTGSEDRTASIWRLPDLVHVVTLKGHKRRIFSVEFSTVDQC 555

Query: 413 VAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKK 592
           V   S    +K+W + D   ++T  GH S      F   G  F S   D  LK+W++   
Sbjct: 556 VMTASGDKTVKIWAISDGSCLKTFEGHTSSVLRASFITDGTQFVSCGADGLLKLWNVNTS 615

Query: 593 GCIHTYKGH 619
            CI TY  H
Sbjct: 616 ECIATYDQH 624



 Score = 65.9 bits (159), Expect = 6e-10
 Identities = 31/102 (30%), Positives = 51/102 (50%)
 Frame = +2

Query: 350 STLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPF 529
           ST+ G +  + ++A    + L+ +   S  I++WDLE  K IR+  GH      +  H  
Sbjct: 54  STIEGESDTLTALALSPDDKLLFSAGHSRQIRVWDLETLKCIRSWKGHEGPVMGMACHAS 113

Query: 530 GEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
           G   A+   D  + +WD+    C H ++GH   +S+I F PD
Sbjct: 114 GGLLATAGADRKVLVWDVDGGFCTHYFRGHKGVVSSILFHPD 155



 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 28/132 (21%), Positives = 59/132 (44%), Gaps = 6/132 (4%)
 Frame = +2

Query: 281 RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
           ++  + G    + +W +       +  GH  PV  +A  ++  L+A   +   + +WD++
Sbjct: 73  KLLFSAGHSRQIRVWDLETLKCIRSWKGHEGPVMGMACHASGGLLATAGADRKVLVWDVD 132

Query: 461 DTKMIRTLSGHRSYCTALEFHPFG--EFFASGSMDTNLKIWDIR----KKGCIHTYKGHT 622
                    GH+   +++ FHP        SGS D  +++WD+     +K C+   + H 
Sbjct: 133 GGFCTHYFRGHKGVVSSILFHPDSNKNILISGSDDATVRVWDLNAKNTEKKCLAIMEKHF 192

Query: 623 RGISTIRFTPDG 658
             +++I  + DG
Sbjct: 193 SAVTSIALSEDG 204



 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 27/96 (28%), Positives = 44/96 (45%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
           +T   D +V +W+I   +   T  GHTS V   +F +      +  + GL+KLW++  ++
Sbjct: 557 MTASGDKTVKIWAISDGSCLKTFEGHTSSVLRASFITDGTQFVSCGADGLLKLWNVNTSE 616

Query: 470 MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
            I T   H     AL      E  A+G  D  + +W
Sbjct: 617 CIATYDQHEDKVWALAVGKKTEMIATGGGDAVINLW 652



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 29/121 (23%), Positives = 52/121 (42%), Gaps = 8/121 (6%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCR-MFLTGGDDHSVNLWSIGKPTST----STLSGHTS 373
           G+    F  H G V+ + F   + + + ++G DD +V +W +    +     + +  H S
Sbjct: 134 GFCTHYFRGHKGVVSSILFHPDSNKNILISGSDDATVRVWDLNAKNTEKKCLAIMEKHFS 193

Query: 374 PVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGH---RSYCTALEFHPFGEFFA 544
            V SIA     + + +     ++ LWDL D     T++ +    +  T     PF  F A
Sbjct: 194 AVTSIALSEDGLTLFSAGRDKVVNLWDLHDYSCKATVATYEVLEAVTTVSSGTPFASFVA 253

Query: 545 S 547
           S
Sbjct: 254 S 254



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 21/78 (26%), Positives = 36/78 (46%)
 Frame = +2

Query: 386 IAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTN 565
           ++ D + I  A G    +I + D  D+ +  T+ G     TAL   P  +   S      
Sbjct: 27  VSSDGSFIACACGD---VINIVDSTDSSVKSTIEGESDTLTALALSPDDKLLFSAGHSRQ 83

Query: 566 LKIWDIRKKGCIHTYKGH 619
           +++WD+    CI ++KGH
Sbjct: 84  IRVWDLETLKCIRSWKGH 101



 Score = 34.3 bits (77), Expect = 2.0
 Identities = 21/101 (20%), Positives = 42/101 (41%), Gaps = 4/101 (3%)
 Frame = +2

Query: 356 LSGHTSPVESIAF-DSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           L G+   +  + F    E  +A  ++   ++++D+        L+GH+    +L+     
Sbjct: 354 LVGYNEEIADMKFLGDEEQFLAVATNLEEVRVYDVATMSCSYVLAGHKEVVLSLDTCVSS 413

Query: 533 E---FFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
                  +GS D  +++W+   K CI    GH   I  + F
Sbjct: 414 SGNVLIVTGSKDKTVRLWNATSKSCIGVGTGHNGDILAVAF 454



>gb:AJ719967_2502154 Gallus gallus mRNA for hypothetical protein,
           clone 8n22.
          Length = 388

 Score = 79.7 bits (195), Expect = 4e-14
 Identities = 43/161 (26%), Positives = 78/161 (48%), Gaps = 8/161 (4%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           ++ G +++    H+  VN     ++  ++  TG DD +V LW I K  +  T   +T  V
Sbjct: 169 SETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAVQTFQ-NTYQV 227

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
            ++ F+     + +G     IK+WDL   K+  T+ GH    T L     G +  S +MD
Sbjct: 228 LAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTGLSLSSEGSYLLSNAMD 287

Query: 560 TNLKIWDIR----KKGCIHTYKGHT----RGISTIRFTPDG 658
             ++IWD+R    K+ C+  ++G+     + +    ++PDG
Sbjct: 288 NTVRIWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDG 328



 Score = 66.2 bits (160), Expect = 5e-10
 Identities = 39/146 (26%), Positives = 68/146 (46%), Gaps = 1/146 (0%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI-AFDSAEIL 412
           HSG V  L +      +F +   D +V +W          L GHTS V S         L
Sbjct: 139 HSGAVMELHYNTDGSMLF-SASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQL 197

Query: 413 VAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKK 592
           V  GS  G +KLWD+     ++T   +     A+ F+   +   SG +D ++K+WD+R+ 
Sbjct: 198 VCTGSDDGTVKLWDIRKKAAVQTFQ-NTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQN 256

Query: 593 GCIHTYKGHTRGISTIRFTPDGRWVV 670
              +T +GH   ++ +  + +G +++
Sbjct: 257 KLTYTMRGHADSVTGLSLSSEGSYLL 282



 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 38/132 (28%), Positives = 67/132 (50%), Gaps = 6/132 (4%)
 Frame = +2

Query: 236 HSGNVNCLRF--GKKTCRMFLTGGDDHSVNLWSI-GKPTSTSTLSGHTSPVESIAFDSAE 406
           H G V C +F  G  T     + G D  + LW++ G   + +TL GH+  V  + +++  
Sbjct: 96  HEGEVYCCKFHPGGNT---LASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDG 152

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSY---CTALEFHPFGEFFASGSMDTNLKIW 577
            ++ + S+   + +WD E  + ++ L GH S+   C      P  +   +GS D  +K+W
Sbjct: 153 SMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGP--QLVCTGSDDGTVKLW 210

Query: 578 DIRKKGCIHTYK 613
           DIRKK  + T++
Sbjct: 211 DIRKKAAVQTFQ 222



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 33/121 (27%), Positives = 47/121 (38%), Gaps = 7/121 (5%)
 Frame = +2

Query: 296 GGDDHSVNLWSIGKPTSTST------LSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDL 457
           GG   +  L   G P  +S       LSGH   V    F      +A+     LI LW++
Sbjct: 67  GGQPSTGALLQSGPPRCSSLQAPIMLLSGHEGEVYCCKFHPGGNTLASAGFDRLILLWNV 126

Query: 458 E-DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIS 634
             D     TL GH      L ++  G    S S D  + +WD      +   KGHT  ++
Sbjct: 127 YGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVN 186

Query: 635 T 637
           +
Sbjct: 187 S 187



 Score = 36.6 bits (83), Expect = 0.41
 Identities = 17/58 (29%), Positives = 27/58 (46%)
 Frame = +2

Query: 413 VAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
           +A GS+   + +WD    +++  L GH      L FHP      S S D  L + +I+
Sbjct: 331 IAGGSADRFVYVWDTTSRRILYKLPGHAGSVNELAFHPEEPIILSASSDKRLYMGEIQ 388



>gb:CR382126_1658855 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 434

 Score = 79.7 bits (195), Expect = 4e-14
 Identities = 43/148 (29%), Positives = 67/148 (45%), Gaps = 1/148 (0%)
 Frame = +2

Query: 212 YKLQEFV-AHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           +KL + +  H+G V C+         F TG +D ++ +W +       TL GH   V  I
Sbjct: 112 WKLSKVINGHTGWVRCVCVDPVDNEWFATGSNDTTIKIWDLAAGKLKITLIGHVMSVRDI 171

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
           A       + + S   L+K WDLE    IR   GH S    ++ HP  +  A+   D  +
Sbjct: 172 AISKRHPYMFSASEDKLVKCWDLERNTAIRDFHGHLSGVHTVDVHPSLDIIATAGRDAVV 231

Query: 569 KIWDIRKKGCIHTYKGHTRGISTIRFTP 652
           ++WDIR +  I    GH   I+ ++  P
Sbjct: 232 RLWDIRSRSEIMVLPGHKSPINKVKCLP 259



 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 33/141 (23%), Positives = 59/141 (41%)
 Frame = +2

Query: 230 VAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEI 409
           + H  +V  +   K+   MF +  +D  V  W + + T+     GH S V ++    +  
Sbjct: 162 IGHVMSVRDIAISKRHPYMF-SASEDKLVKCWDLERNTAIRDFHGHLSGVHTVDVHPSLD 220

Query: 410 LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRK 589
           ++A      +++LWD+     I  L GH+S    ++  P      S S D  +++WDI  
Sbjct: 221 IIATAGRDAVVRLWDIRSRSEIMVLPGHKSPINKVKCLPVDPQIISCSGDATVRLWDIIA 280

Query: 590 KGCIHTYKGHTRGISTIRFTP 652
                    H+R I  +   P
Sbjct: 281 GKASKVLTHHSRNIRDLTLHP 301



 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 33/143 (23%), Positives = 61/143 (42%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           +R   +++F  H   V+ +     +  +  T G D  V LW I   +    L GH SP+ 
Sbjct: 195 ERNTAIRDFHGHLSGVHTVDV-HPSLDIIATAGRDAVVRLWDIRSRSEIMVLPGHKSPIN 253

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
            +     +  + + S    ++LWD+   K  + L+ H      L  HP    FAS S + 
Sbjct: 254 KVKCLPVDPQIISCSGDATVRLWDIIAGKASKVLTHHSRNIRDLTLHPAEFSFASVSTN- 312

Query: 563 NLKIWDIRKKGCIHTYKGHTRGI 631
           +++ W + +   +  ++    GI
Sbjct: 313 DVRSWKLPEGQLLTNFQSQNTGI 335



>gb:AK016977_1158973 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4933429D11
           product:hypothetical G-protein beta WD-40 repeats
           containing protein, full insert sequence.
          Length = 310

 Score = 79.7 bits (195), Expect = 4e-14
 Identities = 41/152 (26%), Positives = 68/152 (44%)
 Frame = +2

Query: 215 KLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAF 394
           K+   + H   ++   F    C + LTG  D +  LW        +TL+GH   +    F
Sbjct: 148 KVHTLIGHCAEISSALFNWD-CSLILTGSMDKTCMLWDATSGKYVATLTGHDDEILDSCF 206

Query: 395 DSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKI 574
           D    L+A  S+ G  ++++    K +  L GH    + + F+P G    +GS D   +I
Sbjct: 207 DYTGKLIATASADGTARVYNATTRKCVTKLEGHEGEISKISFNPQGNRLLTGSSDKTARI 266

Query: 575 WDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           WD++   C+   +GHT  I +  F   G  V+
Sbjct: 267 WDVQTGQCLQVLEGHTDEIFSCAFNYKGNIVI 298



 Score = 62.4 bits (150), Expect = 7e-09
 Identities = 41/146 (28%), Positives = 60/146 (41%), Gaps = 22/146 (15%)
 Frame = +2

Query: 287 FLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS------------AEI------- 409
           F+TG  D +  +W         TL GH + V +IAF++            AEI       
Sbjct: 107 FITGSYDRTCKVWDTASGEELHTLEGHKNVVYAIAFNNPYGKVHTLIGHCAEISSALFNW 166

Query: 410 ---LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
              L+  GS      LWD    K + TL+GH        F   G+  A+ S D   ++++
Sbjct: 167 DCSLILTGSMDKTCMLWDATSGKYVATLTGHDDEILDSCFDYTGKLIATASADGTARVYN 226

Query: 581 IRKKGCIHTYKGHTRGISTIRFTPDG 658
              + C+   +GH   IS I F P G
Sbjct: 227 ATTRKCVTKLEGHEGEISKISFNPQG 252



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 23/101 (22%), Positives = 46/101 (45%)
 Frame = +2

Query: 275 TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           T ++  T   D +  +++       + L GH   +  I+F+     +  GSS    ++WD
Sbjct: 209 TGKLIATASADGTARVYNATTRKCVTKLEGHEGEISKISFNPQGNRLLTGSSDKTARIWD 268

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
           ++  + ++ L GH     +  F+  G    +GS D + +IW
Sbjct: 269 VQTGQCLQVLEGHTDEIFSCAFNYKGNIVITGSKDNSCRIW 309



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 33/143 (23%), Positives = 54/143 (37%), Gaps = 22/143 (15%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           DH+  L+ +        L  H  P+ ++A + A      GS     K+WD    + + TL
Sbjct: 79  DHNFYLFKV--------LRAHILPLTNVALNKAGSCFITGSYDRTCKVWDTASGEELHTL 130

Query: 485 SGHRSYCTALEF-HPFGE---------------------FFASGSMDTNLKIWDIRKKGC 598
            GH++   A+ F +P+G+                        +GSMD    +WD      
Sbjct: 131 EGHKNVVYAIAFNNPYGKVHTLIGHCAEISSALFNWDCSLILTGSMDKTCMLWDATSGKY 190

Query: 599 IHTYKGHTRGISTIRFTPDGRWV 667
           + T  GH   I    F   G+ +
Sbjct: 191 VATLTGHDDEILDSCFDYTGKLI 213



 Score = 36.2 bits (82), Expect = 0.53
 Identities = 24/114 (21%), Positives = 45/114 (39%), Gaps = 2/114 (1%)
 Frame = +2

Query: 311 SVNLWSIGKPTSTSTLSGHTSPVESI--AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           S++L  +      +TL G     E +  A  + ++ +        ++     +  + + L
Sbjct: 29  SIDLLELSPSADVNTLVGEIQQAEPLITASRTKQVRLLVQRLQEKLRQHSDHNFYLFKVL 88

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
             H    T +  +  G  F +GS D   K+WD      +HT +GH   +  I F
Sbjct: 89  RAHILPLTNVALNKAGSCFITGSYDRTCKVWDTASGEELHTLEGHKNVVYAIAF 142



>gb:BC058365_2103177 Mus musculus U5 snRNP-specific protein
           (Prp8-binding), mRNA (cDNA clone MGC:66747
           IMAGE:5714866), complete cds.
          Length = 358

 Score = 79.3 bits (194), Expect = 5e-14
 Identities = 42/161 (26%), Positives = 78/161 (48%), Gaps = 8/161 (4%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           ++ G +++    H+  VN     ++  ++  TG DD +V LW I K  +  T   +T  V
Sbjct: 139 SETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAVQTFQ-NTYQV 197

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
            ++ F+     + +G     IK+WDL   K+  T+ GH    T L     G +  S +MD
Sbjct: 198 LAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTGLSLSSEGSYLLSNAMD 257

Query: 560 TNLKIWDIR----KKGCIHTYKGHT----RGISTIRFTPDG 658
             +++WD+R    K+ C+  ++G+     + +    ++PDG
Sbjct: 258 NTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDG 298



 Score = 66.2 bits (160), Expect = 5e-10
 Identities = 39/146 (26%), Positives = 68/146 (46%), Gaps = 1/146 (0%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI-AFDSAEIL 412
           HSG V  L +      +F +   D +V +W          L GHTS V S         L
Sbjct: 109 HSGAVMELHYNTDGSMLF-SASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQL 167

Query: 413 VAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKK 592
           V  GS  G +KLWD+     ++T   +     A+ F+   +   SG +D ++K+WD+R+ 
Sbjct: 168 VCTGSDDGTVKLWDIRKKAAVQTFQ-NTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQN 226

Query: 593 GCIHTYKGHTRGISTIRFTPDGRWVV 670
              +T +GH   ++ +  + +G +++
Sbjct: 227 KLTYTMRGHADSVTGLSLSSEGSYLL 252



 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 36/130 (27%), Positives = 66/130 (50%), Gaps = 4/130 (3%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSI-GKPTSTSTLSGHTSPVESIAFDSAEIL 412
           H G V C +F      +  + G D  + LW++ G   + +TL GH+  V  + +++   +
Sbjct: 66  HEGEVYCCKFHPNGSTL-ASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSM 124

Query: 413 VAAGSSSGLIKLWDLEDTKMIRTLSGHRSY---CTALEFHPFGEFFASGSMDTNLKIWDI 583
           + + S+   + +WD E  + ++ L GH S+   C      P  +   +GS D  +K+WDI
Sbjct: 125 LFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGP--QLVCTGSDDGTVKLWDI 182

Query: 584 RKKGCIHTYK 613
           RKK  + T++
Sbjct: 183 RKKAAVQTFQ 192



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 27/95 (28%), Positives = 39/95 (41%), Gaps = 1/95 (1%)
 Frame = +2

Query: 356 LSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE-DTKMIRTLSGHRSYCTALEFHPFG 532
           LSGH   V    F      +A+     LI LW++  D     TL GH      L ++  G
Sbjct: 63  LSGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDG 122

Query: 533 EFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIST 637
               S S D  + +WD      +   KGHT  +++
Sbjct: 123 SMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNS 157



 Score = 37.0 bits (84), Expect = 0.31
 Identities = 17/58 (29%), Positives = 28/58 (48%)
 Frame = +2

Query: 413 VAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
           +AAGS+   + +WD    +++  L GH      + FHP      S S D  L + +I+
Sbjct: 301 IAAGSADRFVYVWDTTSRRVLYKLPGHAGSINEVAFHPDEPIILSASSDKRLYMGEIQ 358



 Score = 37.0 bits (84), Expect = 0.31
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 2/64 (3%)
 Frame = +2

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIH--TYKGHTRGISTIRF 646
           I  LSGH       +FHP G   AS   D  + +W++    C +  T KGH+  +  + +
Sbjct: 60  IMLLSGHEGEVYCCKFHPNGSTLASAGFDRLILLWNV-YGDCDNYATLKGHSGAVMELHY 118

Query: 647 TPDG 658
             DG
Sbjct: 119 NTDG 122



>gb:AF083383_1881616 Homo sapiens 38kDa splicing factor mRNA,
           complete cds.
          Length = 310

 Score = 79.3 bits (194), Expect = 5e-14
 Identities = 42/161 (26%), Positives = 78/161 (48%), Gaps = 8/161 (4%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           ++ G +++    H+  VN     ++  ++  TG DD +V LW I K  +  T   +T  V
Sbjct: 79  SETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAVQTFQ-NTYQV 137

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
            ++ F+     + +G     IK+WDL   K+  T+ GH    T L     G +  S +MD
Sbjct: 138 LAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTGLSLSSEGSYLLSNAMD 197

Query: 560 TNLKIWDIR----KKGCIHTYKGHT----RGISTIRFTPDG 658
             +++WD+R    K+ C+  ++G+     + +    ++PDG
Sbjct: 198 NTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDG 238



 Score = 66.2 bits (160), Expect = 5e-10
 Identities = 39/146 (26%), Positives = 68/146 (46%), Gaps = 1/146 (0%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI-AFDSAEIL 412
           HSG V  L +      +F +   D +V +W          L GHTS V S         L
Sbjct: 49  HSGAVMELHYNTDGSMLF-SASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQL 107

Query: 413 VAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKK 592
           V  GS  G +KLWD+     ++T   +     A+ F+   +   SG +D ++K+WD+R+ 
Sbjct: 108 VCTGSDDGTVKLWDIRKKAAVQTFQ-NTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQN 166

Query: 593 GCIHTYKGHTRGISTIRFTPDGRWVV 670
              +T +GH   ++ +  + +G +++
Sbjct: 167 KLTYTMRGHADSVTGLSLSSEGSYLL 192



 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 36/130 (27%), Positives = 66/130 (50%), Gaps = 4/130 (3%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSI-GKPTSTSTLSGHTSPVESIAFDSAEIL 412
           H G V C +F      +  + G D  + LW++ G   + +TL GH+  V  + +++   +
Sbjct: 6   HEGEVYCCKFHPNGSTL-ASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSM 64

Query: 413 VAAGSSSGLIKLWDLEDTKMIRTLSGHRSY---CTALEFHPFGEFFASGSMDTNLKIWDI 583
           + + S+   + +WD E  + ++ L GH S+   C      P  +   +GS D  +K+WDI
Sbjct: 65  LFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGP--QLVCTGSDDGTVKLWDI 122

Query: 584 RKKGCIHTYK 613
           RKK  + T++
Sbjct: 123 RKKAAVQTFQ 132



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 27/95 (28%), Positives = 39/95 (41%), Gaps = 1/95 (1%)
 Frame = +2

Query: 356 LSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE-DTKMIRTLSGHRSYCTALEFHPFG 532
           LSGH   V    F      +A+     LI LW++  D     TL GH      L ++  G
Sbjct: 3   LSGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDG 62

Query: 533 EFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIST 637
               S S D  + +WD      +   KGHT  +++
Sbjct: 63  SMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNS 97



>gb:CR380959_1653747 Candida glabrata strain CBS138 chromosome M
           complete sequence.
          Length = 427

 Score = 79.3 bits (194), Expect = 5e-14
 Identities = 40/139 (28%), Positives = 63/139 (45%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H G V C+   K     F TG +D ++ +W++       TL  H   V  +A  +    +
Sbjct: 114 HHGWVRCIAMDKVDNEWFATGSNDKTIKIWNLASGKLKVTLKAHDMTVRDLAISNRHPYM 173

Query: 416 AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG 595
            + S    +K WDLE    IR   GH S    ++ HP  +   +   D+ +K+WDIR + 
Sbjct: 174 FSVSEDKTVKCWDLEKNTAIRNYHGHLSGVHTVDIHPTVDVVVTAGRDSVVKVWDIRTRL 233

Query: 596 CIHTYKGHTRGISTIRFTP 652
            + T  GH   I+ +R  P
Sbjct: 234 PVMTLPGHKGPITKVRCLP 252



 Score = 59.3 bits (142), Expect = 6e-08
 Identities = 37/141 (26%), Positives = 63/141 (44%), Gaps = 1/141 (0%)
 Frame = +2

Query: 233 AHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFD-SAEI 409
           AH   V  L    +   MF    +D +V  W + K T+     GH S V ++    + ++
Sbjct: 156 AHDMTVRDLAISNRHPYMFSVS-EDKTVKCWDLEKNTAIRNYHGHLSGVHTVDIHPTVDV 214

Query: 410 LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRK 589
           +V AG  S ++K+WD+     + TL GH+   T +   P      S S+D ++++WD+  
Sbjct: 215 VVTAGRDS-VVKVWDIRTRLPVMTLPGHKGPITKVRCLPVDPQVISSSVDASIRLWDLVA 273

Query: 590 KGCIHTYKGHTRGISTIRFTP 652
              +     H R +  I   P
Sbjct: 274 GKSMKVLTHHQRTVRDISVHP 294



 Score = 49.3 bits (116), Expect = 6e-05
 Identities = 28/105 (26%), Positives = 47/105 (44%)
 Frame = +2

Query: 275 TCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD 454
           T  + +T G D  V +W I       TL GH  P+  +     +  V + S    I+LWD
Sbjct: 211 TVDVVVTAGRDSVVKVWDIRTRLPVMTLPGHKGPITKVRCLPVDPQVISSSVDASIRLWD 270

Query: 455 LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRK 589
           L   K ++ L+ H+     +  HP  EF  + +   +++ W + K
Sbjct: 271 LVAGKSMKVLTHHQRTVRDISVHP-SEFSFASACTNDIRSWLLPK 314



>gb:AY080732_1568450 Arabidopsis thaliana unknown protein
           (At1g71840) mRNA, complete cds.>gb:BT001964_1635567
           Arabidopsis thaliana clone U18329 unknown protein
           (At1g71840) mRNA, complete cds.
          Length = 407

 Score = 79.3 bits (194), Expect = 5e-14
 Identities = 41/147 (27%), Positives = 68/147 (46%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           F  H G +  L        +  TGG D    LW IG     + L GH   V  +AF    
Sbjct: 66  FTGHKGELYALACSPTDATLVATGGGDDKAFLWKIGNGDWAAELPGHKDSVSCLAFSYDG 125

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
            L+A+G   G+++++D     +   L G  +    + +HP G    +GS D +L +W+  
Sbjct: 126 QLLASGGLDGVVQIFDASSGTLKCVLDGPGAGIEWVRWHPRGHIVLAGSEDCSLWMWNAD 185

Query: 587 KKGCIHTYKGHTRGISTIRFTPDGRWV 667
           K+  ++ + GH   ++   FTPDG+ +
Sbjct: 186 KEAYLNMFSGHNLNVTCGDFTPDGKLI 212



 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 37/148 (25%), Positives = 71/148 (47%), Gaps = 3/148 (2%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H+  + CL     +  + ++G  D SV++ +I      S+L+ HT  VE + F  +   +
Sbjct: 241 HTEGLTCLDINSNSS-LAISGSKDGSVHIVNIVTGKVVSSLNSHTDSVECVKFSPSSATI 299

Query: 416 AAGSSSGLIK---LWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
              ++ G+ K   +WDL+ +   R +  H    T+L +    ++ A+G  +  + IWD  
Sbjct: 300 PLAATGGMDKKLIIWDLQHSTP-RFICEHEEGVTSLTWIGTSKYLATGCANGTVSIWDSL 358

Query: 587 KKGCIHTYKGHTRGISTIRFTPDGRWVV 670
              C+HTY GH   +  I  + +  ++V
Sbjct: 359 LGNCVHTYHGHQDAVQAISVSTNTDFIV 386



 Score = 62.0 bits (149), Expect = 9e-09
 Identities = 38/142 (26%), Positives = 65/142 (45%), Gaps = 3/142 (2%)
 Frame = +2

Query: 224 EFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSA 403
           E   H  +V+CL F     ++  +GG D  V ++     T    L G  + +E + +   
Sbjct: 108 ELPGHKDSVSCLAFSYDG-QLLASGGLDGVVQIFDASSGTLKCVLDGPGAGIEWVRWHPR 166

Query: 404 EILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
             +V AGS    + +W+ +    +   SGH    T  +F P G+   +GS D +L +W+ 
Sbjct: 167 GHIVLAGSEDCSLWMWNADKEAYLNMFSGHNLNVTCGDFTPDGKLICTGSDDASLIVWNP 226

Query: 584 RKKGCIHTYKG---HTRGISTI 640
           +    IH  KG   HT G++ +
Sbjct: 227 KTCESIHIVKGHPYHTEGLTCL 248



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 27/118 (22%), Positives = 54/118 (45%), Gaps = 2/118 (1%)
 Frame = +2

Query: 233 AHSGNVNCLRFGKKTCRMFL--TGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAE 406
           +H+ +V C++F   +  + L  TGG D  + +W +   T    +  H   V S+ +    
Sbjct: 282 SHTDSVECVKFSPSSATIPLAATGGMDKKLIIWDLQHSTPRF-ICEHEEGVTSLTWIGTS 340

Query: 407 ILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
             +A G ++G + +WD      + T  GH+    A+      +F  S S+D   ++++
Sbjct: 341 KYLATGCANGTVSIWDSLLGNCVHTYHGHQDAVQAISVSTNTDFIVSVSVDNTARVFE 398



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 30/110 (27%), Positives = 47/110 (42%), Gaps = 1/110 (0%)
 Frame = +2

Query: 344 STSTLSGHTSPVESIAFDSAEI-LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEF 520
           S  T +GH   + ++A    +  LVA G       LW + +      L GH+   + L F
Sbjct: 62  SVHTFTGHKGELYALACSPTDATLVATGGGDDKAFLWKIGNGDWAAELPGHKDSVSCLAF 121

Query: 521 HPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
              G+  ASG +D  ++I+D           G   GI  +R+ P G  V+
Sbjct: 122 SYDGQLLASGGLDGVVQIFDASSGTLKCVLDGPGAGIEWVRWHPRGHIVL 171



>gb:DDU27537_1377318 Dictyostelium discoideum G beta like protein
           mRNA, complete cds.
          Length = 332

 Score = 79.3 bits (194), Expect = 5e-14
 Identities = 47/130 (36%), Positives = 66/130 (50%), Gaps = 7/130 (5%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD-LEDT 466
           L+G  D+++ LW I K  ST    GHT  V S+AF S    + +GS    IK+W+ L + 
Sbjct: 86  LSGSWDNTLRLWDITKGVSTRLFKGHTQDVMSVAFSSDNRQIISGSRDATIKVWNTLGEC 145

Query: 467 KMIRTLSGHRSYCTAL------EFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRG 628
           K   TL G  ++   L      + H       SGS D  +KIWDI+   C HT   HT  
Sbjct: 146 KF--TLEGPEAHQAVLIGFHVSDSHQNTPTIVSGSWDNKVKIWDIKSFKCNHTLTDHTGY 203

Query: 629 ISTIRFTPDG 658
           ++T+  +PDG
Sbjct: 204 VNTVTISPDG 213



 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 34/113 (30%), Positives = 53/113 (46%), Gaps = 7/113 (6%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFDSAEI-LVAAGSSSGLIKLWDLEDT------KMIRTLSGHRSYCTA 511
           +L GH   V SIA        + + S    + +W L  T      K  R+L GH  +   
Sbjct: 16  SLVGHNGFVTSIAVSPENPDTIISSSRDKTVMVWQLTPTDATSPGKAHRSLKGHSHFVQD 75

Query: 512 LEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           +     G+F  SGS D  L++WDI K      +KGHT+ + ++ F+ D R ++
Sbjct: 76  VVISHDGQFALSGSWDNTLRLWDITKGVSTRLFKGHTQDVMSVAFSSDNRQII 128



>gb:BA000045_742319 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 1721

 Score = 79.3 bits (194), Expect = 5e-14
 Identities = 46/154 (29%), Positives = 77/154 (50%)
 Frame = +2

Query: 209  GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
            G  ++    HS +VN L FG+   R  +TGGDD ++ +W +      ++     +PV SI
Sbjct: 1337 GTLIRTLRGHSASVNSLSFGRSD-RTLVTGGDDSNLRIWKLSN--FNTSFQAFENPVRSI 1393

Query: 389  AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            A    E  + AG S G IK+W   + + I TL GH      +   P  +  AS   D  +
Sbjct: 1394 ALGPQEQFLIAGGSDGTIKIWG-NNGRQISTLRGHIRTVHDISISPDKKMIASAGWDKTI 1452

Query: 569  KIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            K+W    +  I T + H+R + ++  +P+G+++V
Sbjct: 1453 KLWHTSGE-LIQTLREHSRPVFSVAISPNGQYLV 1485



 Score = 66.2 bits (160), Expect = 5e-10
 Identities = 38/130 (29%), Positives = 65/130 (50%), Gaps = 1/130 (0%)
 Frame = +2

Query: 281  RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE 460
            R+  TG  +  +NLW + +      +  H   +  ++F      +   S  G IK+W + 
Sbjct: 1155 RLIATGNLNGGLNLW-LAEGKWLRFIPAHVQRITGLSFSPDGQKIVTSSYDGTIKVWRIN 1213

Query: 461  DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCI-HTYKGHTRGIST 637
              K+I+TL+GH      + F P G++ AS S D  +K+W  R  G +  T KGHT  I +
Sbjct: 1214 G-KLIKTLTGHNDKVIDVAFSPDGKWIASASADKTVKVW--RDDGILSKTLKGHTEQIES 1270

Query: 638  IRFTPDGRWV 667
            + F+P+ + +
Sbjct: 1271 VTFSPNSQMI 1280



 Score = 64.7 bits (156), Expect = 1e-09
 Identities = 38/122 (31%), Positives = 60/122 (49%)
 Frame = +2

Query: 305  DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
            D +V +W      S  TL GHT  +ES+ F     ++A  S    +KLW L    +IRT+
Sbjct: 1245 DKTVKVWRDDGILS-KTLKGHTEQIESVTFSPNSQMIATASVDKTVKLWQLNGV-LIRTV 1302

Query: 485  SGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRW 664
             GH      + F   G+ FA+GS D  + +W +     I T +GH+  ++++ F    R 
Sbjct: 1303 RGHTDGVYDVVFSQDGQTFATGSSDRTIMLWHV-DGTLIRTLRGHSASVNSLSFGRSDRT 1361

Query: 665  VV 670
            +V
Sbjct: 1362 LV 1363



 Score = 58.9 bits (141), Expect = 8e-08
 Identities = 36/116 (31%), Positives = 54/116 (46%)
 Frame = +2

Query: 236  HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
            H+  +  + F   + +M  T   D +V LW +       T+ GHT  V  + F       
Sbjct: 1264 HTEQIESVTFSPNS-QMIATASVDKTVKLWQLNG-VLIRTVRGHTDGVYDVVFSQDGQTF 1321

Query: 416  AAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
            A GSS   I LW ++ T +IRTL GH +   +L F        +G  D+NL+IW +
Sbjct: 1322 ATGSSDRTIMLWHVDGT-LIRTLRGHSASVNSLSFGRSDRTLVTGGDDSNLRIWKL 1376



 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 34/124 (27%), Positives = 61/124 (49%), Gaps = 1/124 (0%)
 Frame = +2

Query: 290  LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTK 469
            ++ G D ++ +W     T    L GH+S V  + F ++   + +G + G + LW+++ +K
Sbjct: 1485 VSAGADKNIIVWK-ADGTKLRVLKGHSSEVNRVFFTASGQEIISGGADGKLILWNIDGSK 1543

Query: 470  MIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKG-CIHTYKGHTRGISTIRF 646
              RT+    +   +L   P G   A GS+D + K+W   K G  +     H   I +I +
Sbjct: 1544 K-RTIEDRGNSLRSLSISPDGRIIAVGSVDGHFKLW--HKDGRLLWQTVAHETEIRSIAY 1600

Query: 647  TPDG 658
            +PDG
Sbjct: 1601 SPDG 1604



 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 39/154 (25%), Positives = 63/154 (40%), Gaps = 41/154 (26%)
 Frame = +2

Query: 329  IGKPTSTSTLSGHTSPVESIAF-------------------------------DSAEI-- 409
            +G  +  + L GH S + SIA                                D++++  
Sbjct: 1088 LGNISEFNRLVGHKSWISSIAHSPDGKAIASASADKTVKIWNSNGTSFKTLFTDTSDVRA 1147

Query: 410  --------LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTN 565
                    L+A G+ +G + LW L + K +R +  H    T L F P G+   + S D  
Sbjct: 1148 VSYSPDGRLIATGNLNGGLNLW-LAEGKWLRFIPAHVQRITGLSFSPDGQKIVTSSYDGT 1206

Query: 566  LKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWV 667
            +K+W I  K  I T  GH   +  + F+PDG+W+
Sbjct: 1207 IKVWRINGK-LIKTLTGHNDKVIDVAFSPDGKWI 1239



>gb:BC044482_2548786 Danio rerio guanine nucleotide binding protein
           (G protein), beta polypeptide 1, like, mRNA (cDNA clone
           MGC:55774 IMAGE:3817085), complete cds.
          Length = 340

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 44/149 (29%), Positives = 76/149 (51%), Gaps = 2/149 (1%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           +E   H+G ++C RF        +T   D +  LW I     T+T +GHT  V S++   
Sbjct: 137 RELAGHTGYLSCCRFLDDN--QIVTSSGDTTCALWDIETGQQTTTFAGHTGDVMSLSLAP 194

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
              L  +G+     KLWD+ +    +T +GH S   A+ F P G  FA+GS D   +++D
Sbjct: 195 DTRLFVSGACDASAKLWDIREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFD 254

Query: 581 IR--KKGCIHTYKGHTRGISTIRFTPDGR 661
           +R  ++  ++++     GI+++ F+  GR
Sbjct: 255 LRADQELMVYSHDNIICGITSVAFSKSGR 283



 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 44/152 (28%), Positives = 64/152 (42%), Gaps = 2/152 (1%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +   F  H+G+V  L     T R+F++G  D S  LW I +     T +GH S + +I
Sbjct: 174 GQQTTTFAGHTGDVMSLSLAPDT-RLFVSGACDASAKLWDIREGMCRQTFTGHESDINAI 232

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYC--TALEFHPFGEFFASGSMDT 562
            F       A GS     +L+DL   + +   S     C  T++ F   G    +G  D 
Sbjct: 233 CFFPNGNAFATGSDDATCRLFDLRADQELMVYSHDNIICGITSVAFSKSGRLLLAGYDDF 292

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           N  +WD  K        GH   +S +  T DG
Sbjct: 293 NCNVWDTLKADRAGVLAGHDNRVSCLGVTDDG 324



 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 33/149 (22%), Positives = 62/149 (41%), Gaps = 4/149 (2%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H   +  + +G  + R+ ++   D  + +W          +   +S V + A+  +   V
Sbjct: 54  HLAKIYAMHWGTDS-RLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYV 112

Query: 416 AAGSSSGLIKLWDLE----DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
           A G    +  ++ L+    + ++ R L+GH  Y +   F    +   S S DT   +WDI
Sbjct: 113 ACGGLDNICSIYSLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTS-SGDTTCALWDI 171

Query: 584 RKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
                  T+ GHT  + ++   PD R  V
Sbjct: 172 ETGQQTTTFAGHTGDVMSLSLAPDTRLFV 200



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 26/109 (23%), Positives = 51/109 (46%), Gaps = 4/109 (3%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           TL GH + + ++ + +   L+ + S  G + +WD   T  +  +    S+     + P G
Sbjct: 50  TLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSG 109

Query: 533 EFFASGSMDTNLKIWDIR-KKGCIHTYK---GHTRGISTIRFTPDGRWV 667
            + A G +D    I+ ++ ++G +   +   GHT  +S  RF  D + V
Sbjct: 110 NYVACGGLDNICSIYSLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIV 158



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 19/61 (31%), Positives = 30/61 (49%)
 Frame = +2

Query: 272 KTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLW 451
           K+ R+ L G DD + N+W   K      L+GH + V  +      + VA GS    +K+W
Sbjct: 280 KSGRLLLAGYDDFNCNVWDTLKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIW 339

Query: 452 D 454
           +
Sbjct: 340 N 340



 Score = 34.3 bits (77), Expect = 2.0
 Identities = 18/64 (28%), Positives = 26/64 (40%)
 Frame = +2

Query: 476 RTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
           RTL GH +   A+ +        S S D  L IWD      +H     +  + T  + P 
Sbjct: 49  RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 656 GRWV 667
           G +V
Sbjct: 109 GNYV 112



>gb:HUMTRNB1_2037888 Human transducin beta-1 subunit mRNA, 3' end.
          Length = 247

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 46/149 (30%), Positives = 73/149 (48%), Gaps = 2/149 (1%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           +E   H+G ++C RF        +T   D +  LW I     T+T +GHT  V S++   
Sbjct: 44  RELAGHTGYLSCCRFLDDN--QIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAP 101

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
              L  +G+     KLWD+ +    +T +GH S   A+ F P G  FA+GS D   +++D
Sbjct: 102 DTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFD 161

Query: 581 IRKKGCIHTYKGHT--RGISTIRFTPDGR 661
           +R    + TY       GI+++ F+  GR
Sbjct: 162 LRADQELMTYSHDNIICGITSVSFSKSGR 190



 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 44/152 (28%), Positives = 65/152 (42%), Gaps = 2/152 (1%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +   F  H+G+V  L     T R+F++G  D S  LW + +     T +GH S + +I
Sbjct: 81  GQQTTTFTGHTGDVMSLSLAPDT-RLFVSGACDASAKLWDVREGMCRQTFTGHESDINAI 139

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYC--TALEFHPFGEFFASGSMDT 562
            F       A GS     +L+DL   + + T S     C  T++ F   G    +G  D 
Sbjct: 140 CFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDF 199

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           N  +WD  K        GH   +S +  T DG
Sbjct: 200 NCNVWDALKADRAGVLAGHDNRVSCLGVTDDG 231



 Score = 42.4 bits (98), Expect = 0.007
 Identities = 28/105 (26%), Positives = 48/105 (45%), Gaps = 4/105 (3%)
 Frame = +2

Query: 368 TSPVESIAFDSAEILVAAGSSSGLIKLWDLE----DTKMIRTLSGHRSYCTALEFHPFGE 535
           +S V + A+  +   VA G    +  +++L+    + ++ R L+GH  Y +   F    +
Sbjct: 4   SSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQ 63

Query: 536 FFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
              S S DT   +WDI       T+ GHT  + ++   PD R  V
Sbjct: 64  IVTS-SGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFV 107



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 19/61 (31%), Positives = 30/61 (49%)
 Frame = +2

Query: 272 KTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLW 451
           K+ R+ L G DD + N+W   K      L+GH + V  +      + VA GS    +K+W
Sbjct: 187 KSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIW 246

Query: 452 D 454
           +
Sbjct: 247 N 247



>gb:AY358182_1947061 Homo sapiens clone DNA178573 SSGL9393 (UNQ9393)
           mRNA, complete cds.
          Length = 470

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 45/126 (35%), Positives = 66/126 (52%), Gaps = 2/126 (1%)
 Frame = +2

Query: 227 FVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSI--GKPTSTSTLSGHTSPVESIAFDS 400
           F AH G VN ++F   + R+  TGG D  V LW +   K     +LSG  + + SI FDS
Sbjct: 318 FDAHDGEVNAVQFSPGS-RLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDS 376

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
           A   + A S+    ++W ++D ++  TL+GH     + +F        SGS D  LK+WD
Sbjct: 377 AGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWD 436

Query: 581 IRKKGC 598
           +R K C
Sbjct: 437 LRSKVC 442



 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 29/112 (25%), Positives = 50/112 (44%), Gaps = 2/112 (1%)
 Frame = +2

Query: 341 TSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDL--EDTKMIRTLSGHRSYCTAL 514
           T+      H   V ++ F     L+A G     +KLW++  E  +   +LSG  +  T++
Sbjct: 313 TALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSI 372

Query: 515 EFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           EF   G +  + S D   +IW +      HT  GH+  + + +F  D   +V
Sbjct: 373 EFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIV 424



>gb:AF070603_1880754 Homo sapiens clone 24584 beta-subunit signal
           transducing proteins GS/GI mRNA, partial cds.
          Length = 207

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 46/149 (30%), Positives = 73/149 (48%), Gaps = 2/149 (1%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           +E   H+G ++C RF        +T   D +  LW I     T+T +GHT  V S++   
Sbjct: 4   RELAGHTGYLSCCRFLDDN--QIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAP 61

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
              L  +G+     KLWD+ +    +T +GH S   A+ F P G  FA+GS D   +++D
Sbjct: 62  DTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFD 121

Query: 581 IRKKGCIHTYKGHT--RGISTIRFTPDGR 661
           +R    + TY       GI+++ F+  GR
Sbjct: 122 LRADQELMTYSHDNIICGITSVSFSKSGR 150



 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 44/152 (28%), Positives = 65/152 (42%), Gaps = 2/152 (1%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +   F  H+G+V  L     T R+F++G  D S  LW + +     T +GH S + +I
Sbjct: 41  GQQTTTFTGHTGDVMSLSLAPDT-RLFVSGACDASAKLWDVREGMCRQTFTGHESDINAI 99

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYC--TALEFHPFGEFFASGSMDT 562
            F       A GS     +L+DL   + + T S     C  T++ F   G    +G  D 
Sbjct: 100 CFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDF 159

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           N  +WD  K        GH   +S +  T DG
Sbjct: 160 NCNVWDALKADRAGVLAGHDNRVSCLGVTDDG 191



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 19/61 (31%), Positives = 30/61 (49%)
 Frame = +2

Query: 272 KTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLW 451
           K+ R+ L G DD + N+W   K      L+GH + V  +      + VA GS    +K+W
Sbjct: 147 KSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIW 206

Query: 452 D 454
           +
Sbjct: 207 N 207



 Score = 38.1 bits (87), Expect = 0.14
 Identities = 21/68 (30%), Positives = 31/68 (45%)
 Frame = +2

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
           ++ R L+GH  Y +   F    +   S S DT   +WDI       T+ GHT  + ++  
Sbjct: 1   RVSRELAGHTGYLSCCRFLDDNQIVTS-SGDTTCALWDIETGQQTTTFTGHTGDVMSLSL 59

Query: 647 TPDGRWVV 670
            PD R  V
Sbjct: 60  APDTRLFV 67



>gb:AB071106_1871172 Macaca fascicularis testis cDNA
           clone:QtsA-18134, full insert sequence.
          Length = 309

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 46/149 (30%), Positives = 73/149 (48%), Gaps = 2/149 (1%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           +E   H+G ++C RF        +T   D +  LW I     T+T +GHT  V S++   
Sbjct: 106 RELAGHTGYLSCCRFLDDN--QIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAP 163

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
              L  +G+     KLWD+ +    +T +GH S   A+ F P G  FA+GS D   +++D
Sbjct: 164 DTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFD 223

Query: 581 IRKKGCIHTYKGHT--RGISTIRFTPDGR 661
           +R    + TY       GI+++ F+  GR
Sbjct: 224 LRADQELMTYSHDNIICGITSVSFSKSGR 252



 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 44/152 (28%), Positives = 65/152 (42%), Gaps = 2/152 (1%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +   F  H+G+V  L     T R+F++G  D S  LW + +     T +GH S + +I
Sbjct: 143 GQQTTTFTGHTGDVMSLSLAPDT-RLFVSGACDASAKLWDVREGMCRQTFTGHESDINAI 201

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYC--TALEFHPFGEFFASGSMDT 562
            F       A GS     +L+DL   + + T S     C  T++ F   G    +G  D 
Sbjct: 202 CFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDF 261

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           N  +WD  K        GH   +S +  T DG
Sbjct: 262 NCNVWDALKADRAGVLAGHDNRVSCLGVTDDG 293



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 33/149 (22%), Positives = 63/149 (42%), Gaps = 4/149 (2%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H   +  + +G  + R+ ++   D  + +W          +   +S V + A+  +   V
Sbjct: 23  HLAKIYAMHWGTDS-RLLVSASQDGKLIIWDSYTANKVHAIPLRSSWVMTCAYAPSGNYV 81

Query: 416 AAGSSSGLIKLWDLE----DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
           A G    +  +++L+    + ++ R L+GH  Y +   F    +   S S DT   +WDI
Sbjct: 82  ACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTS-SGDTTCALWDI 140

Query: 584 RKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
                  T+ GHT  + ++   PD R  V
Sbjct: 141 ETGQQTTTFTGHTGDVMSLSLAPDTRLFV 169



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 25/109 (22%), Positives = 51/109 (46%), Gaps = 4/109 (3%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           TL GH + + ++ + +   L+ + S  G + +WD      +  +    S+     + P G
Sbjct: 19  TLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTANKVHAIPLRSSWVMTCAYAPSG 78

Query: 533 EFFASGSMDTNLKIWDIR-KKGCIHTYK---GHTRGISTIRFTPDGRWV 667
            + A G +D    I++++ ++G +   +   GHT  +S  RF  D + V
Sbjct: 79  NYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIV 127



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 19/61 (31%), Positives = 30/61 (49%)
 Frame = +2

Query: 272 KTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLW 451
           K+ R+ L G DD + N+W   K      L+GH + V  +      + VA GS    +K+W
Sbjct: 249 KSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIW 308

Query: 452 D 454
           +
Sbjct: 309 N 309



 Score = 34.3 bits (77), Expect = 2.0
 Identities = 18/64 (28%), Positives = 26/64 (40%)
 Frame = +2

Query: 476 RTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
           RTL GH +   A+ +        S S D  L IWD      +H     +  + T  + P 
Sbjct: 18  RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTANKVHAIPLRSSWVMTCAYAPS 77

Query: 656 GRWV 667
           G +V
Sbjct: 78  GNYV 81



>gb:AB071095_1871161 Macaca fascicularis testis cDNA
           clone:QtsA-17843, full insert sequence.
          Length = 296

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 46/149 (30%), Positives = 73/149 (48%), Gaps = 2/149 (1%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           +E   H+G ++C RF        +T   D +  LW I     T+T +GHT  V S++   
Sbjct: 93  RELAGHTGYLSCCRFLDDN--QIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAP 150

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
              L  +G+     KLWD+ +    +T +GH S   A+ F P G  FA+GS D   +++D
Sbjct: 151 DTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFD 210

Query: 581 IRKKGCIHTYKGHT--RGISTIRFTPDGR 661
           +R    + TY       GI+++ F+  GR
Sbjct: 211 LRADQELMTYSHDNIICGITSVSFSKSGR 239



 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 44/152 (28%), Positives = 65/152 (42%), Gaps = 2/152 (1%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +   F  H+G+V  L     T R+F++G  D S  LW + +     T +GH S + +I
Sbjct: 130 GQQTTTFTGHTGDVMSLSLAPDT-RLFVSGACDASAKLWDVREGMCRQTFTGHESDINAI 188

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYC--TALEFHPFGEFFASGSMDT 562
            F       A GS     +L+DL   + + T S     C  T++ F   G    +G  D 
Sbjct: 189 CFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDF 248

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           N  +WD  K        GH   +S +  T DG
Sbjct: 249 NCNVWDALKADRAGVLAGHDNRVSCLGVTDDG 280



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 33/149 (22%), Positives = 63/149 (42%), Gaps = 4/149 (2%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H   +  + +G  + R+ ++   D  + +W          +   +S V + A+  +   V
Sbjct: 10  HLAKIYAMHWGTDS-RLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYV 68

Query: 416 AAGSSSGLIKLWDLE----DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
           A G    +  +++L+    + ++ R L+GH  Y +   F    +   S S DT   +WDI
Sbjct: 69  ACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTS-SGDTTCALWDI 127

Query: 584 RKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
                  T+ GHT  + ++   PD R  V
Sbjct: 128 ETGQQTTTFTGHTGDVMSLSLAPDTRLFV 156



 Score = 45.4 bits (106), Expect = 9e-04
 Identities = 26/109 (23%), Positives = 52/109 (47%), Gaps = 4/109 (3%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           TL GH + + ++ + +   L+ + S  G + +WD   T  +  +    S+     + P G
Sbjct: 6   TLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSG 65

Query: 533 EFFASGSMDTNLKIWDIR-KKGCIHTYK---GHTRGISTIRFTPDGRWV 667
            + A G +D    I++++ ++G +   +   GHT  +S  RF  D + V
Sbjct: 66  NYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIV 114



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 19/61 (31%), Positives = 30/61 (49%)
 Frame = +2

Query: 272 KTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLW 451
           K+ R+ L G DD + N+W   K      L+GH + V  +      + VA GS    +K+W
Sbjct: 236 KSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIW 295

Query: 452 D 454
           +
Sbjct: 296 N 296



 Score = 34.3 bits (77), Expect = 2.0
 Identities = 18/64 (28%), Positives = 26/64 (40%)
 Frame = +2

Query: 476 RTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
           RTL GH +   A+ +        S S D  L IWD      +H     +  + T  + P 
Sbjct: 5   RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 64

Query: 656 GRWV 667
           G +V
Sbjct: 65  GNYV 68



>gb:AB070162_1871033 Macaca fascicularis testis cDNA
           clone:QtsA-15604, full insert sequence.
          Length = 276

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 46/149 (30%), Positives = 73/149 (48%), Gaps = 2/149 (1%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           +E   H+G ++C RF        +T   D +  LW I     T+T +GHT  V S++   
Sbjct: 106 RELAGHTGYLSCCRFLDDN--QIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAP 163

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
              L  +G+     KLWD+ +    +T +GH S   A+ F P G  FA+GS D   +++D
Sbjct: 164 DTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFD 223

Query: 581 IRKKGCIHTYKGHT--RGISTIRFTPDGR 661
           +R    + TY       GI+++ F+  GR
Sbjct: 224 LRADQELMTYSHDNIICGITSVSFSKSGR 252



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 33/149 (22%), Positives = 63/149 (42%), Gaps = 4/149 (2%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H   +  + +G  + R+ ++   D  + +W          +   +S V + A+  +   V
Sbjct: 23  HLAKIYAMHWGTDS-RLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYV 81

Query: 416 AAGSSSGLIKLWDLE----DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
           A G    +  +++L+    + ++ R L+GH  Y +   F    +   S S DT   +WDI
Sbjct: 82  ACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTS-SGDTTCALWDI 140

Query: 584 RKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
                  T+ GHT  + ++   PD R  V
Sbjct: 141 ETGQQTTTFTGHTGDVMSLSLAPDTRLFV 169



 Score = 45.4 bits (106), Expect = 9e-04
 Identities = 26/109 (23%), Positives = 52/109 (47%), Gaps = 4/109 (3%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           TL GH + + ++ + +   L+ + S  G + +WD   T  +  +    S+     + P G
Sbjct: 19  TLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSG 78

Query: 533 EFFASGSMDTNLKIWDIR-KKGCIHTYK---GHTRGISTIRFTPDGRWV 667
            + A G +D    I++++ ++G +   +   GHT  +S  RF  D + V
Sbjct: 79  NYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIV 127



 Score = 34.3 bits (77), Expect = 2.0
 Identities = 18/64 (28%), Positives = 26/64 (40%)
 Frame = +2

Query: 476 RTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
           RTL GH +   A+ +        S S D  L IWD      +H     +  + T  + P 
Sbjct: 18  RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 77

Query: 656 GRWV 667
           G +V
Sbjct: 78  GNYV 81



>gb:AE016817_1747461 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 1204

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 48/180 (26%), Positives = 82/180 (45%), Gaps = 30/180 (16%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           + G  L  F  H G V  + F   T  +F++ GDD+S+ +WS+       TL+GH   V 
Sbjct: 41  RMGVLLHRFEEHEGPVRGVDF-HPTQPLFVSAGDDYSIKVWSLSTHKCLFTLNGHLDYVR 99

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
           ++ F +    + + S    I++W+ ++ + I  L+GH  +    +FHP  +   S S+D 
Sbjct: 100 TVFFHTELPWIISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFHPTEDLVVSASLDE 159

Query: 563 NLKIWDI---RKK-------------------------GCIHTY--KGHTRGISTIRFTP 652
            ++IWDI   RK+                          C+  +  +GHTRG++   F P
Sbjct: 160 TVRIWDISGLRKRHSAPGSQSFEEQMITQQNLFDGGFGDCVVKFILEGHTRGVNWASFHP 219



 Score = 56.2 bits (134), Expect = 5e-07
 Identities = 30/102 (29%), Positives = 49/102 (48%), Gaps = 2/102 (1%)
 Frame = +2

Query: 356 LSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM--IRTLSGHRSYCTALEFHPF 529
           L GHT  V   +F     L+ +GS    +KLW +  TK   + T  GH +   ++ FHPF
Sbjct: 205 LEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPF 264

Query: 530 GEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
                S   D+ +++WD+ K+  +  +K       +IR  P+
Sbjct: 265 QNLIISVGEDSTIRVWDLDKRTPVKQFKREQDRFWSIRAHPN 306



 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 31/120 (25%), Positives = 48/120 (40%)
 Frame = +2

Query: 311 SVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSG 490
           ++ LW             H  PV  + F   + L  +      IK+W L   K + TL+G
Sbjct: 34  TIQLWDYRMGVLLHRFEEHEGPVRGVDFHPTQPLFVSAGDDYSIKVWSLSTHKCLFTLNG 93

Query: 491 HRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           H  Y   + FH    +  S S D  ++IW+ + +  I    GH   +   +F P    VV
Sbjct: 94  HLDYVRTVFFHTELPWIISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFHPTEDLVV 153



 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 25/97 (25%), Positives = 43/97 (44%)
 Frame = +2

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
           ++IAF  +   V     S  I+LWD     ++     H      ++FHP    F S   D
Sbjct: 15  KAIAFHPSRPWVLVALFSSTIQLWDYRMGVLLHRFEEHEGPVRGVDFHPTQPLFVSAGDD 74

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
            ++K+W +    C+ T  GH   + T+ F  +  W++
Sbjct: 75  YSIKVWSLSTHKCLFTLNGHLDYVRTVFFHTELPWII 111



 Score = 49.3 bits (116), Expect = 6e-05
 Identities = 31/113 (27%), Positives = 50/113 (44%), Gaps = 6/113 (5%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIG--KPTSTSTLSGHTSPVESIAFDSAEI 409
           H+  VN   F   T  + ++G DD  V LW +   K     T  GHT+ V+S+ F   + 
Sbjct: 208 HTRGVNWASF-HPTLPLIVSGSDDRQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHPFQN 266

Query: 410 LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHP----FGEFFASGSM 556
           L+ +      I++WDL+    ++     +    ++  HP    FG    SG M
Sbjct: 267 LIISVGEDSTIRVWDLDKRTPVKQFKREQDRFWSIRAHPNVNLFGAAHDSGIM 319



 Score = 48.9 bits (115), Expect = 8e-05
 Identities = 35/153 (22%), Positives = 58/153 (37%), Gaps = 32/153 (20%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE--- 460
           ++  DD ++ +W+       + L+GH   V    F   E LV + S    +++WD+    
Sbjct: 111 ISASDDQTIRIWNWQNRREIACLTGHNHFVMCAQFHPTEDLVVSASLDETVRIWDISGLR 170

Query: 461 -----------DTKMIR----------------TLSGHRSYCTALEFHPFGEFFASGSMD 559
                      + +MI                  L GH        FHP      SGS D
Sbjct: 171 KRHSAPGSQSFEEQMITQQNLFDGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDD 230

Query: 560 TNLKIWDI--RKKGCIHTYKGHTRGISTIRFTP 652
             +K+W +   K   + T +GHT  + ++ F P
Sbjct: 231 RQVKLWRMSSTKAWEVDTCRGHTNNVDSVIFHP 263



>gb:SCYDL144C_1711717 S.cerevisiae chromosome IV reading frame ORF
           YDL144c.
          Length = 1075

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 49/180 (27%), Positives = 81/180 (45%), Gaps = 30/180 (16%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           + G  L  F  H G V  L F   T  +F++ GDD+++ +WS+       TL+GH   V 
Sbjct: 41  RMGTLLHRFEDHEGPVRGLDF-HPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVR 99

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
           ++ F      + + S    I++W+ ++ K I  L+GH  +    +FHP  +   S S+D 
Sbjct: 100 TVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLDE 159

Query: 563 NLKIWDI---RKK-------------------------GCIHTY--KGHTRGISTIRFTP 652
            ++IWDI   RK+                          C+  +  +GHTRG++   F P
Sbjct: 160 TIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHP 219



 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 30/120 (25%), Positives = 50/120 (41%)
 Frame = +2

Query: 311 SVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSG 490
           ++ LW     T       H  PV  + F   + +  +      IK+W L+  K + TL+G
Sbjct: 34  TIQLWDYRMGTLLHRFEDHEGPVRGLDFHPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTG 93

Query: 491 HRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           H  Y   + FH    +  S S D  ++IW+ + +  I    GH   +   +F P    +V
Sbjct: 94  HLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIV 153



 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 26/97 (26%), Positives = 42/97 (43%)
 Frame = +2

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
           + IAF  +   V     S  I+LWD     ++     H      L+FHP    F S   D
Sbjct: 15  KGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGLDFHPTQPIFVSAGDD 74

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
             +K+W +    C++T  GH   + T+ F  +  W++
Sbjct: 75  YTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWII 111



 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 29/98 (29%), Positives = 45/98 (45%), Gaps = 2/98 (2%)
 Frame = +2

Query: 326 SIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM--IRTLSGHRS 499
           S+G       L GHT  V   +F     L+ +GS    +KLW +  TK   + T  GH +
Sbjct: 195 SLGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTN 254

Query: 500 YCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYK 613
              ++ FHP      S   D  L++WD+ K+  +  +K
Sbjct: 255 NVDSVIFHPHQNLIISVGEDKTLRVWDLDKRTPVKQFK 292



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 34/159 (21%), Positives = 57/159 (35%), Gaps = 32/159 (20%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD----- 454
           ++  DD ++ +W+       + L+GH   V    F   + L+ + S    I++WD     
Sbjct: 111 ISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIRIWDISGLR 170

Query: 455 -------------------------LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
                                    L D  +   L GH        FHP      SGS D
Sbjct: 171 KRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDD 230

Query: 560 TNLKIW--DIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
             +K+W     K   + T +GHT  + ++ F P    ++
Sbjct: 231 RQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLII 269



 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 30/124 (24%), Positives = 56/124 (45%), Gaps = 3/124 (2%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLW--SIGKPTSTSTLSGHTSPVESIAFDSAEI 409
           H+  VN   F   T  + ++G DD  V LW  S  K     T  GHT+ V+S+ F   + 
Sbjct: 208 HTRGVNWASF-HPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQN 266

Query: 410 LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI-R 586
           L+ +      +++WDL+    ++           +  HP    F + + D+ + ++ + R
Sbjct: 267 LIISVGEDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPHINLFGA-AHDSGIMVFKLDR 325

Query: 587 KKGC 598
           ++ C
Sbjct: 326 ERPC 329



>gb:SCASCOPI_1706528 S.cerevisiae DNA for alpha subunit of coatomer
           complex.>gb:SCGACOP_1708353 S.cerevisiae alpha-COP gene.
          Length = 1201

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 49/180 (27%), Positives = 81/180 (45%), Gaps = 30/180 (16%)
 Frame = +2

Query: 203 KRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           + G  L  F  H G V  L F   T  +F++ GDD+++ +WS+       TL+GH   V 
Sbjct: 41  RMGTLLHRFEDHEGPVRGLDF-HPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTGHLDYVR 99

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
           ++ F      + + S    I++W+ ++ K I  L+GH  +    +FHP  +   S S+D 
Sbjct: 100 TVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLDE 159

Query: 563 NLKIWDI---RKK-------------------------GCIHTY--KGHTRGISTIRFTP 652
            ++IWDI   RK+                          C+  +  +GHTRG++   F P
Sbjct: 160 TIRIWDISGLRKRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHP 219



 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 30/120 (25%), Positives = 50/120 (41%)
 Frame = +2

Query: 311 SVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSG 490
           ++ LW     T       H  PV  + F   + +  +      IK+W L+  K + TL+G
Sbjct: 34  TIQLWDYRMGTLLHRFEDHEGPVRGLDFHPTQPIFVSAGDDYTIKVWSLDTNKCLYTLTG 93

Query: 491 HRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
           H  Y   + FH    +  S S D  ++IW+ + +  I    GH   +   +F P    +V
Sbjct: 94  HLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIV 153



 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 26/97 (26%), Positives = 42/97 (43%)
 Frame = +2

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
           + IAF  +   V     S  I+LWD     ++     H      L+FHP    F S   D
Sbjct: 15  KGIAFHPSRPWVLVALFSSTIQLWDYRMGTLLHRFEDHEGPVRGLDFHPTQPIFVSAGDD 74

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
             +K+W +    C++T  GH   + T+ F  +  W++
Sbjct: 75  YTIKVWSLDTNKCLYTLTGHLDYVRTVFFHRELPWII 111



 Score = 52.0 bits (123), Expect = 9e-06
 Identities = 29/98 (29%), Positives = 45/98 (45%), Gaps = 2/98 (2%)
 Frame = +2

Query: 326 SIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKM--IRTLSGHRS 499
           S+G       L GHT  V   +F     L+ +GS    +KLW +  TK   + T  GH +
Sbjct: 195 SLGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTN 254

Query: 500 YCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYK 613
              ++ FHP      S   D  L++WD+ K+  +  +K
Sbjct: 255 NVDSVIFHPHQNLIISVGEDKTLRVWDLDKRTPVKQFK 292



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 34/159 (21%), Positives = 57/159 (35%), Gaps = 32/159 (20%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWD----- 454
           ++  DD ++ +W+       + L+GH   V    F   + L+ + S    I++WD     
Sbjct: 111 ISASDDQTIRIWNWQNRKEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIRIWDISGLR 170

Query: 455 -------------------------LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
                                    L D  +   L GH        FHP      SGS D
Sbjct: 171 KRHSAPGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLPLIVSGSDD 230

Query: 560 TNLKIW--DIRKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
             +K+W     K   + T +GHT  + ++ F P    ++
Sbjct: 231 RQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQNLII 269



 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 30/124 (24%), Positives = 56/124 (45%), Gaps = 3/124 (2%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLW--SIGKPTSTSTLSGHTSPVESIAFDSAEI 409
           H+  VN   F   T  + ++G DD  V LW  S  K     T  GHT+ V+S+ F   + 
Sbjct: 208 HTRGVNWASF-HPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQN 266

Query: 410 LVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI-R 586
           L+ +      +++WDL+    ++           +  HP    F + + D+ + ++ + R
Sbjct: 267 LIISVGEDKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPHINLFGA-AHDSGIMVFKLDR 325

Query: 587 KKGC 598
           ++ C
Sbjct: 326 ERPC 329



>gb:CR382135_1668127 Debaryomyces hansenii chromosome C of strain
           CBS767 of Debaryomyces hansenii.
          Length = 519

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 40/146 (27%), Positives = 68/146 (46%), Gaps = 8/146 (5%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H   + C  F         +G  D +  +W     T   TLSGH++ V  +++     ++
Sbjct: 142 HGSTILCCLFAPNDSGRMCSGAGDSTARIWDCNTQTPMHTLSGHSNWVLCVSYSPCGSMI 201

Query: 416 AAGSSSGLIKLWDLEDTKMI-RTLSGHRSYCTALEFHPF-------GEFFASGSMDTNLK 571
           A GS    ++LWD +  K +   LS H  + ++L + P            ASGS D  +K
Sbjct: 202 ATGSMDSTVRLWDADLGKPLGSALSSHTKWISSLAWEPLHLVQPGSKPRLASGSKDGTVK 261

Query: 572 IWDIRKKGCIHTYKGHTRGISTIRFT 649
           +WD  ++ C+ T  GHT  +S +++T
Sbjct: 262 VWDTTRRVCLLTMSGHTNAVSCVKWT 287



 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 48/151 (31%), Positives = 76/151 (50%), Gaps = 11/151 (7%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTC-RMFLTGGDDHSVNLWS--IGKPTSTSTLSGHTSPVESIAFDSAE 406
           HS  V C+ +    C  M  TG  D +V LW   +GKP   S LS HT  + S+A++   
Sbjct: 185 HSNWVLCVSYSP--CGSMIATGSMDSTVRLWDADLGKPLG-SALSSHTKWISSLAWEPLH 241

Query: 407 IL-------VAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTN 565
           ++       +A+GS  G +K+WD      + T+SGH +  + +++      + SGS D  
Sbjct: 242 LVQPGSKPRLASGSKDGTVKVWDTTRRVCLLTMSGHTNAVSCVKWTGSNIVY-SGSHDKT 300

Query: 566 LKIWDIRKKG-CIHTYKGHTRGISTIRFTPD 655
           +K+WDI   G CI T K H   ++ +  + D
Sbjct: 301 IKVWDILAGGKCIQTLKSHAHWVNHLSTSTD 331



 Score = 57.4 bits (137), Expect = 2e-07
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 4/107 (3%)
 Frame = +2

Query: 344 STSTLSGHTSPVESIAF---DSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTAL 514
           S + ++GH S +    F   DS  +   AG S+   ++WD      + TLSGH ++   +
Sbjct: 135 SNAAIAGHGSTILCCLFAPNDSGRMCSGAGDSTA--RIWDCNTQTPMHTLSGHSNWVLCV 192

Query: 515 EFHPFGEFFASGSMDTNLKIWDI-RKKGCIHTYKGHTRGISTIRFTP 652
            + P G   A+GSMD+ +++WD    K        HT+ IS++ + P
Sbjct: 193 SYSPCGSMIATGSMDSTVRLWDADLGKPLGSALSSHTKWISSLAWEP 239



 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 28/91 (30%), Positives = 46/91 (50%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D+S+ +W   K T   TL GH +PV   A+ +   L+   S    +K+WD+   K+   L
Sbjct: 427 DNSIKIWDGIKGTFIGTLRGHVAPVYQSAWSADNRLLVTCSKDTTLKVWDIRTRKLSVDL 486

Query: 485 SGHRSYCTALEFHPFGEFFASGSMDTNLKIW 577
            GH     A+++   G+  ASG  D  +++W
Sbjct: 487 PGHADEVYAVDWSMDGKRVASGGKDKMIRLW 517



 Score = 52.8 bits (125), Expect = 5e-06
 Identities = 34/127 (26%), Positives = 55/127 (43%), Gaps = 1/127 (0%)
 Frame = +2

Query: 290 LTGGDDHSVNLWSIGKPTST-STLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDT 466
           +T  DD ++ LW   K +     ++GH   V  ++F      + + S    IK+WD    
Sbjct: 379 VTASDDFTMYLWEPLKSSKPICRMTGHQKLVNHVSFSPDGRYIVSCSFDNSIKIWDGIKG 438

Query: 467 KMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
             I TL GH +      +        + S DT LK+WDIR +       GH   +  + +
Sbjct: 439 TFIGTLRGHVAPVYQSAWSADNRLLVTCSKDTTLKVWDIRTRKLSVDLPGHADEVYAVDW 498

Query: 647 TPDGRWV 667
           + DG+ V
Sbjct: 499 SMDGKRV 505



 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 1/87 (1%)
 Frame = +2

Query: 413 VAAGSSSGLIKLWD-LEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRK 589
           +   S    + LW+ L+ +K I  ++GH+     + F P G +  S S D ++KIWD  K
Sbjct: 378 IVTASDDFTMYLWEPLKSSKPICRMTGHQKLVNHVSFSPDGRYIVSCSFDNSIKIWDGIK 437

Query: 590 KGCIHTYKGHTRGISTIRFTPDGRWVV 670
              I T +GH   +    ++ D R +V
Sbjct: 438 GTFIGTLRGHVAPVYQSAWSADNRLLV 464



 Score = 35.0 bits (79), Expect = 1.2
 Identities = 18/69 (26%), Positives = 32/69 (46%), Gaps = 1/69 (1%)
 Frame = +2

Query: 464 TKMIRTLSGHRSYCTALEFHPFGEF-FASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTI 640
           T+    ++GH S      F P       SG+ D+  +IWD   +  +HT  GH+  +  +
Sbjct: 133 TRSNAAIAGHGSTILCCLFAPNDSGRMCSGAGDSTARIWDCNTQTPMHTLSGHSNWVLCV 192

Query: 641 RFTPDGRWV 667
            ++P G  +
Sbjct: 193 SYSPCGSMI 201



>gb:CQ782448_1451984 Sequence 2588 from Patent
           EP1396543.>gb:AL451070_1928151 Human DNA sequence from
           clone RP11-266K22 on chromosome 1 Contains the 5' end of
           the gene for U5 snRNP-specific 40 kDa protein
           (hPrp8-binding) (HPRP8BP), the gene for putative S1 RNA
           binding domain protein (PS1D), a novel gene and the
           FABP3 gene for fatty acid binding protein 3 muscle and
           heart (mammary-derived growth inhibitor), complete
           sequence.>gb:BC001494_1967633 Homo sapiens U5
           snRNP-specific 40 kDa protein (hPrp8-binding), mRNA
           (cDNA clone MGC:1910 IMAGE:3504573), complete cds.
          Length = 357

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 42/161 (26%), Positives = 78/161 (48%), Gaps = 8/161 (4%)
 Frame = +2

Query: 200 AKRGYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPV 379
           ++ G +++    H+  VN     ++  ++  TG DD +V LW I K  +  T   +T  V
Sbjct: 138 SETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQ-NTYQV 196

Query: 380 ESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
            ++ F+     + +G     IK+WDL   K+  T+ GH    T L     G +  S +MD
Sbjct: 197 LAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTGLSLSSEGSYLLSNAMD 256

Query: 560 TNLKIWDIR----KKGCIHTYKGHT----RGISTIRFTPDG 658
             +++WD+R    K+ C+  ++G+     + +    ++PDG
Sbjct: 257 NTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDG 297



 Score = 66.6 bits (161), Expect = 4e-10
 Identities = 40/146 (27%), Positives = 68/146 (46%), Gaps = 1/146 (0%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI-AFDSAEIL 412
           HSG V  L +      +F +   D +V +W          L GHTS V S         L
Sbjct: 108 HSGAVMELHYNTDGSMLF-SASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQL 166

Query: 413 VAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKK 592
           V  GS  G +KLWD+     I+T   +     A+ F+   +   SG +D ++K+WD+R+ 
Sbjct: 167 VCTGSDDGTVKLWDIRKKAAIQTFQ-NTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQN 225

Query: 593 GCIHTYKGHTRGISTIRFTPDGRWVV 670
              +T +GH   ++ +  + +G +++
Sbjct: 226 KLTYTMRGHADSVTGLSLSSEGSYLL 251



 Score = 64.7 bits (156), Expect = 1e-09
 Identities = 37/130 (28%), Positives = 66/130 (50%), Gaps = 4/130 (3%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSI-GKPTSTSTLSGHTSPVESIAFDSAEIL 412
           H G V C +F      +  + G D  + LW++ G   + +TL GH+  V  + +++   +
Sbjct: 65  HEGEVYCCKFHPNGSTL-ASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSM 123

Query: 413 VAAGSSSGLIKLWDLEDTKMIRTLSGHRSY---CTALEFHPFGEFFASGSMDTNLKIWDI 583
           + + S+   + +WD E  + ++ L GH S+   C      P  +   +GS D  +K+WDI
Sbjct: 124 LFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGP--QLVCTGSDDGTVKLWDI 181

Query: 584 RKKGCIHTYK 613
           RKK  I T++
Sbjct: 182 RKKAAIQTFQ 191



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 27/95 (28%), Positives = 39/95 (41%), Gaps = 1/95 (1%)
 Frame = +2

Query: 356 LSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLE-DTKMIRTLSGHRSYCTALEFHPFG 532
           LSGH   V    F      +A+     LI LW++  D     TL GH      L ++  G
Sbjct: 62  LSGHEGEVYCCKFHPNGSTLASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDG 121

Query: 533 EFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIST 637
               S S D  + +WD      +   KGHT  +++
Sbjct: 122 SMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNS 156



 Score = 37.0 bits (84), Expect = 0.31
 Identities = 17/58 (29%), Positives = 28/58 (48%)
 Frame = +2

Query: 413 VAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIR 586
           +AAGS+   + +WD    +++  L GH      + FHP      S S D  L + +I+
Sbjct: 300 IAAGSADRFVYVWDTTSRRILYKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ 357



 Score = 37.0 bits (84), Expect = 0.31
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 2/64 (3%)
 Frame = +2

Query: 473 IRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIH--TYKGHTRGISTIRF 646
           I  LSGH       +FHP G   AS   D  + +W++    C +  T KGH+  +  + +
Sbjct: 59  IMLLSGHEGEVYCCKFHPNGSTLASAGFDRLILLWNV-YGDCDNYATLKGHSGAVMELHY 117

Query: 647 TPDG 658
             DG
Sbjct: 118 NTDG 121



>gb:BTTRDBR_1437413 Bovine retinal mRNA for transducin beta-subunit.
          Length = 340

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 46/149 (30%), Positives = 73/149 (48%), Gaps = 2/149 (1%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           +E   H+G ++C RF        +T   D +  LW I     T+T +GHT  V S++   
Sbjct: 137 RELAGHTGYLSCCRFLDDN--QIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAP 194

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
              L  +G+     KLWD+ +    +T +GH S   A+ F P G  FA+GS D   +++D
Sbjct: 195 DTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFD 254

Query: 581 IRKKGCIHTYKGHT--RGISTIRFTPDGR 661
           +R    + TY       GI+++ F+  GR
Sbjct: 255 LRADQELMTYSHDNIICGITSVSFSKSGR 283



 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 44/152 (28%), Positives = 65/152 (42%), Gaps = 2/152 (1%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +   F  H+G+V  L     T R+F++G  D S  LW + +     T +GH S + +I
Sbjct: 174 GQQTTTFTGHTGDVMSLSLAPDT-RLFVSGACDASAKLWDVREGMCRQTFTGHESDINAI 232

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYC--TALEFHPFGEFFASGSMDT 562
            F       A GS     +L+DL   + + T S     C  T++ F   G    +G  D 
Sbjct: 233 CFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDF 292

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           N  +WD  K        GH   +S +  T DG
Sbjct: 293 NCNVWDALKADRAGVLAGHDNRVSCLGVTDDG 324



 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 34/149 (22%), Positives = 63/149 (42%), Gaps = 4/149 (2%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H   +  + +G  + R+ L+   D  + +W          +   +S V + A+  +   V
Sbjct: 54  HLAKIYAMHWGTDS-RLLLSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYV 112

Query: 416 AAGSSSGLIKLWDLE----DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
           A G    +  +++L+    + ++ R L+GH  Y +   F    +   S S DT   +WDI
Sbjct: 113 ACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTS-SGDTTCALWDI 171

Query: 584 RKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
                  T+ GHT  + ++   PD R  V
Sbjct: 172 ETGQQTTTFTGHTGDVMSLSLAPDTRLFV 200



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 26/109 (23%), Positives = 52/109 (47%), Gaps = 4/109 (3%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           TL GH + + ++ + +   L+ + S  G + +WD   T  +  +    S+     + P G
Sbjct: 50  TLRGHLAKIYAMHWGTDSRLLLSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSG 109

Query: 533 EFFASGSMDTNLKIWDIR-KKGCIHTYK---GHTRGISTIRFTPDGRWV 667
            + A G +D    I++++ ++G +   +   GHT  +S  RF  D + V
Sbjct: 110 NYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIV 158



 Score = 41.2 bits (95), Expect = 0.017
 Identities = 19/61 (31%), Positives = 30/61 (49%)
 Frame = +2

Query: 272 KTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLW 451
           K+ R+ L G DD + N+W   K      L+GH + V  +      + VA GS    +K+W
Sbjct: 280 KSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIW 339

Query: 452 D 454
           +
Sbjct: 340 N 340



 Score = 33.9 bits (76), Expect = 2.6
 Identities = 18/64 (28%), Positives = 26/64 (40%)
 Frame = +2

Query: 476 RTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
           RTL GH +   A+ +        S S D  L IWD      +H     +  + T  + P 
Sbjct: 49  RTLRGHLAKIYAMHWGTDSRLLLSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 656 GRWV 667
           G +V
Sbjct: 109 GNYV 112



>gb:CEF55B12_1364502 Caenorhabditis elegans cosmid F55B12, complete
           sequence.
          Length = 585

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 42/149 (28%), Positives = 75/149 (50%), Gaps = 3/149 (2%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L     H   V C++F   T    ++GG D +V +W+        TL+GH + V S+
Sbjct: 366 GRHLATLHGHHAAVRCVQFDGTTV---VSGGYDFTVKIWNAHTGRCIRTLTGHNNRVYSL 422

Query: 389 AFDSAEILVAAGSSSGLIKLWDL---EDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMD 559
            F+S   +V +GS    I++WD    E  + +  L GH S  + ++    G    S + D
Sbjct: 423 LFESERSIVCSGSLDTSIRVWDFTRPEGQECVALLQGHTSLTSGMQLR--GNILVSCNAD 480

Query: 560 TNLKIWDIRKKGCIHTYKGHTRGISTIRF 646
           +++++WDI +  C+H   GH   I+++++
Sbjct: 481 SHVRVWDIHEGTCVHMLSGHRSAITSLQW 509



 Score = 73.9 bits (180), Expect = 2e-12
 Identities = 41/131 (31%), Positives = 64/131 (48%), Gaps = 2/131 (1%)
 Frame = +2

Query: 284 MFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLED 463
           + +TG DD+++ +W I K     TL GHT  V +         + +GS+   +K+W   D
Sbjct: 266 VLVTGSDDNTLKVWCIDKGEVMYTLVGHTGGVWTSQISQCGRYIVSGSTDRTVKVWSTVD 325

Query: 464 TKMIRTLSGHRS--YCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGIST 637
             ++ TL GH S   C A+     G    +GS DT L++WD+     + T  GH   +  
Sbjct: 326 GSLLHTLQGHTSTVRCMAMA----GSILVTGSRDTTLRVWDVESGRHLATLHGHHAAVRC 381

Query: 638 IRFTPDGRWVV 670
           ++F  DG  VV
Sbjct: 382 VQF--DGTTVV 390



 Score = 73.6 bits (179), Expect = 3e-12
 Identities = 38/141 (26%), Positives = 68/141 (48%), Gaps = 3/141 (2%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G  L     H+  V C+        + +TG  D ++ +W +      +TL GH + V  +
Sbjct: 326 GSLLHTLQGHTSTVRCMAMAGS---ILVTGSRDTTLRVWDVESGRHLATLHGHHAAVRCV 382

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNL 568
            FD   ++  +G     +K+W+    + IRTL+GH +   +L F        SGS+DT++
Sbjct: 383 QFDGTTVV--SGGYDFTVKIWNAHTGRCIRTLTGHNNRVYSLLFESERSIVCSGSLDTSI 440

Query: 569 KIWDIRK---KGCIHTYKGHT 622
           ++WD  +   + C+   +GHT
Sbjct: 441 RVWDFTRPEGQECVALLQGHT 461



 Score = 72.8 bits (177), Expect = 5e-12
 Identities = 44/148 (29%), Positives = 71/148 (47%), Gaps = 1/148 (0%)
 Frame = +2

Query: 206 RGYKLQEFVAHSGNVNCLRFGKKTC-RMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVE 382
           +G  +   V H+G V   +  +  C R  ++G  D +V +WS    +   TL GHTS V 
Sbjct: 283 KGEVMYTLVGHTGGVWTSQISQ--CGRYIVSGSTDRTVKVWSTVDGSLLHTLQGHTSTVR 340

Query: 383 SIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDT 562
            +A   A  ++  GS    +++WD+E  + + TL GH +    ++F   G    SG  D 
Sbjct: 341 CMAM--AGSILVTGSRDTTLRVWDVESGRHLATLHGHHAAVRCVQFD--GTTVVSGGYDF 396

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRF 646
            +KIW+     CI T  GH   + ++ F
Sbjct: 397 TVKIWNAHTGRCIRTLTGHNNRVYSLLF 424



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 23/60 (38%), Positives = 32/60 (53%)
 Frame = +2

Query: 305 DHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTL 484
           D  V +W I + T    LSGH S + S+ +     +VA  S  G +KLWD+E   +IR L
Sbjct: 480 DSHVRVWDIHEGTCVHMLSGHRSAITSLQWFGRN-MVATSSDDGTVKLWDIERGALIRDL 538



 Score = 42.7 bits (99), Expect = 0.006
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 1/77 (1%)
 Frame = +2

Query: 443 KLWDLEDTKMIRTLSGHRSYC-TALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGH 619
           K W+         L GH  +  T ++ H   +   +GS D  LK+W I K   ++T  GH
Sbjct: 236 KNWNANPIMGSAVLRGHEDHVITCMQIHD--DVLVTGSDDNTLKVWCIDKGEVMYTLVGH 293

Query: 620 TRGISTIRFTPDGRWVV 670
           T G+ T + +  GR++V
Sbjct: 294 TGGVWTSQISQCGRYIV 310



>gb:CR860734_1184787 Pongo pygmaeus mRNA; cDNA DKFZp459O1427 (from
           clone DKFZp459O1427).
          Length = 340

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 46/149 (30%), Positives = 73/149 (48%), Gaps = 2/149 (1%)
 Frame = +2

Query: 221 QEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDS 400
           +E   H+G ++C RF        +T   D +  LW I     T+T +GHT  V S++   
Sbjct: 137 RELAGHTGYLSCCRFLDDN--QIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAP 194

Query: 401 AEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWD 580
              L  +G+     KLWD+ +    +T +GH S   A+ F P G  FA+GS D   +++D
Sbjct: 195 DTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFD 254

Query: 581 IRKKGCIHTYKGHT--RGISTIRFTPDGR 661
           +R    + TY       GI+++ F+  GR
Sbjct: 255 LRADQELMTYSHDNIICGITSVSFSKSGR 283



 Score = 70.9 bits (172), Expect = 2e-11
 Identities = 44/152 (28%), Positives = 65/152 (42%), Gaps = 2/152 (1%)
 Frame = +2

Query: 209 GYKLQEFVAHSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESI 388
           G +   F  H+G+V  L     T R+F++G  D S  LW + +     T +GH S + +I
Sbjct: 174 GQQTTTFTGHTGDVMSLSLAPDT-RLFVSGACDASAKLWDVREGMCRQTFTGHESDINAI 232

Query: 389 AFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYC--TALEFHPFGEFFASGSMDT 562
            F       A GS     +L+DL   + + T S     C  T++ F   G    +G  D 
Sbjct: 233 CFFPNGNAFATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDF 292

Query: 563 NLKIWDIRKKGCIHTYKGHTRGISTIRFTPDG 658
           N  +WD  K        GH   +S +  T DG
Sbjct: 293 NCNVWDALKADRAGVLAGHDDRVSCLGVTDDG 324



 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 33/149 (22%), Positives = 63/149 (42%), Gaps = 4/149 (2%)
 Frame = +2

Query: 236 HSGNVNCLRFGKKTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILV 415
           H   +  + +G  + R+ ++   D  + +W          +   +S V + A+  +   V
Sbjct: 54  HLAKIYAMHWGTDS-RLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYV 112

Query: 416 AAGSSSGLIKLWDLE----DTKMIRTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDI 583
           A G    +  +++L+    + ++ R L+GH  Y +   F    +   S S DT   +WDI
Sbjct: 113 ACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTS-SGDTTCALWDI 171

Query: 584 RKKGCIHTYKGHTRGISTIRFTPDGRWVV 670
                  T+ GHT  + ++   PD R  V
Sbjct: 172 ETGQQTTTFTGHTGDVMSLSLAPDTRLFV 200



 Score = 45.4 bits (106), Expect = 9e-04
 Identities = 26/109 (23%), Positives = 52/109 (47%), Gaps = 4/109 (3%)
 Frame = +2

Query: 353 TLSGHTSPVESIAFDSAEILVAAGSSSGLIKLWDLEDTKMIRTLSGHRSYCTALEFHPFG 532
           TL GH + + ++ + +   L+ + S  G + +WD   T  +  +    S+     + P G
Sbjct: 50  TLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSG 109

Query: 533 EFFASGSMDTNLKIWDIR-KKGCIHTYK---GHTRGISTIRFTPDGRWV 667
            + A G +D    I++++ ++G +   +   GHT  +S  RF  D + V
Sbjct: 110 NYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIV 158



 Score = 40.8 bits (94), Expect = 0.022
 Identities = 19/61 (31%), Positives = 29/61 (47%)
 Frame = +2

Query: 272 KTCRMFLTGGDDHSVNLWSIGKPTSTSTLSGHTSPVESIAFDSAEILVAAGSSSGLIKLW 451
           K+ R+ L G DD + N+W   K      L+GH   V  +      + VA GS    +K+W
Sbjct: 280 KSGRLLLAGYDDFNCNVWDALKADRAGVLAGHDDRVSCLGVTDDGMAVATGSWDSFLKIW 339

Query: 452 D 454
           +
Sbjct: 340 N 340



 Score = 34.3 bits (77), Expect = 2.0
 Identities = 18/64 (28%), Positives = 26/64 (40%)
 Frame = +2

Query: 476 RTLSGHRSYCTALEFHPFGEFFASGSMDTNLKIWDIRKKGCIHTYKGHTRGISTIRFTPD 655
           RTL GH +   A+ +        S S D  L IWD      +H     +  + T  + P 
Sbjct: 49  RTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPS 108

Query: 656 GRWV 667
           G +V
Sbjct: 109 GNYV 112


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 753,869,351
Number of Sequences: 1806583
Number of extensions: 15378692
Number of successful extensions: 63704
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 44016
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 56567
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 37608185545
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)