BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig5474
         (889 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AF378125_1793344 Vitis vinifera GAI-like protein 1 (GAI1) gen...   140   3e-32   
gb:AY326306_1599657 Cucurbita maxima gibberellic acid insensitiv...   127   2e-28   
gb:AY326307_1599658 Cucurbita maxima gibberellic acid insensitiv...   123   4e-27   
gb:AY269087_1594027 Lycopersicon esculentum GAI-like protein mRN...   120   3e-26   
gb:ATY15194_1557522 Arabidopsis thaliana mRNA for GRS protein.        111   2e-23   
gb:ATRGA1_1554045 A.thaliana mRNA for RGA1 gene.                      111   2e-23   
pir|D84426|D84426 hypothetical protein At2g01570 [imported] - Ar...   110   3e-23   Arabidopsis thaliana [mouse-ear cress]
gb:AY208992_1589641 Gossypium hirsutum GIA/RGA-like gibberellin ...   109   8e-23   
gb:AY052239_1562612 Arabidopsis thaliana At2g01570/F2I9.19 mRNA,...   109   8e-23   
gb:ATY15193_1557521 Arabidopsis thaliana GAI gene.                    106   7e-22   
gb:ATRGA2_1554046 A.thaliana mRNA for RGA2 gene.                      106   7e-22   
pir|H86282|H86282 protein F10B6.34 [imported] - Arabidopsis thal...   106   7e-22   Arabidopsis thaliana [mouse-ear cress]
gb:ATA224957_1542702 Arabidopsis thaliana RGAL gene.                  105   2e-21   
pir|G96688|G96688 hypothetical protein T27F4.10 [imported] - Ara...   105   2e-21   Arabidopsis thaliana [mouse-ear cress]
gb:AX081278_1460756 Sequence 3 from Patent WO0109356.                 101   2e-20   
gb:AX081276_1460755 Sequence 1 from Patent WO0109356.                 101   2e-20   
gb:AK118009_1816011 Arabidopsis thaliana At3g03450 mRNA for puta...   100   6e-20   
gb:ATAC009895_1543077 Arabidopsis thaliana chromosome III BAC T2...   100   6e-20   
gb:AF413192_1797483 Zea mays cultivar EP1 DWARF8 gene, partial cds.    95   2e-18   
gb:AF413189_1797480 Zea mays cultivar B103 DWARF8 gene, partial ...    95   2e-18   
gb:AF413186_1797477 Zea mays cultivar M37W DWARF8 gene, partial ...    95   2e-18   
gb:AF413176_1797467 Zea mays cultivar MO24W DWARF8 gene, partial...    95   2e-18   
gb:AF413171_1797462 Zea mays cultivar GT112 DWARF8 gene, partial...    95   2e-18   
gb:AF413168_1797459 Zea mays cultivar NC250 DWARF8 gene, partial...    95   2e-18   
gb:AF413158_1797449 Zea mays cultivar NC320 DWARF8 gene, partial...    95   2e-18   
gb:AF413145_1797436 Zea mays cultivar F2 DWARF8 gene, partial cds.     95   2e-18   
gb:AF413141_1797432 Zea mays cultivar NC260 DWARF8 gene, partial...    95   2e-18   
gb:AF413138_1797429 Zea mays cultivar Q6199 DWARF8 gene, partial...    95   2e-18   
gb:AF413135_1797426 Zea mays cultivar H99 DWARF8 gene, partial cds.    95   2e-18   
gb:AF413129_1797420 Zea mays cultivar WF9 DWARF8 gene, partial c...    95   2e-18   
gb:AF413128_1797419 Zea mays cultivar KUI43 DWARF8 gene, partial...    95   2e-18   
gb:AF413117_1797408 Zea mays cultivar CMV3 DWARF8 gene, partial ...    95   2e-18   
gb:AF413114_1797405 Zea mays cultivar CM7 DWARF8 gene, partial cds.    95   2e-18   
gb:AF413113_1797404 Zea mays cultivar I29 DWARF8 gene, partial c...    95   2e-18   
gb:AF413112_1797403 Zea mays cultivar A619 DWARF8 gene, partial ...    95   2e-18   
gb:ZMA242530_1731466 Zea mays partial d8 gene for gibberellin re...    95   2e-18   
gb:AF460219_1801797 Hordeum vulgare subsp. vulgare nuclear trans...    94   5e-18   
gb:AF492563_1804923 Dubautia arborea clone DaBcopy2 GIA/RGA-like...    93   6e-18   
gb:AF492566_1804926 Dubautia menziesii clone DmeBcopy GIA/RGA-li...    93   8e-18   
gb:AF492565_1804925 Dubautia ciliolata subsp. glutinosa clone Dc...    93   8e-18   
gb:AB030956_1518584 Oryza sativa (japonica cultivar-group) mRNA ...    93   8e-18   
gb:AF492564_1804924 Dubautia ciliolata subsp. glutinosa clone Dc...    92   1e-17   
gb:TAE242531_1724288 Triticum aestivum rht-D1a gene for gibberel...    92   1e-17   
gb:AF492578_1804937 Calycadenia multiglandulosa clone CLmCod7 GI...    91   2e-17   
gb:AF492584_1804943 Argyroxiphium kauense clone AkAcopy2 GIA/RGA...    91   3e-17   
gb:AF492579_1804938 Anisocarpus madioides clone ANm2a GIA/RGA-li...    91   3e-17   
gb:AF492590_1804949 Dubautia microcephala clone DmiAcopy1 GIA/RG...    91   4e-17   
gb:AF492586_1804945 Dubautia arborea clone DaAcopy1 GIA/RGA-like...    91   4e-17   
gb:AF492583_1804942 Argyroxiphium kauense clone AkAcopy1 GIA/RGA...    91   4e-17   
gb:AF492581_1804940 Argyroxiphium sandwicense subsp. macrocephal...    91   4e-17   
gb:AF492572_1804932 Argyroxiphium sandwicense subsp. macrocephal...    90   5e-17   
gb:AF492567_1804927 Dubautia raillardioides clone DrBcopy GIA/RG...    90   7e-17   
gb:AF492562_1804922 Dubautia arborea clone DaBcopy1 GIA/RGA-like...    90   7e-17   
gb:AF492587_1804946 Dubautia knudsenii clone DkAcopy1 GIA/RGA-li...    89   9e-17   
gb:AF492577_1804936 Calycadenia multiglandulosa clone CLm1Comb G...    89   9e-17   
gb:AF492571_1804931 Argyroxiphium sandwicense subsp. macrocephal...    89   9e-17   
gb:AF492570_1804930 Argyroxiphium kauense clone AkBcopy1n GIA/RG...    89   9e-17   
gb:AF492568_1804928 Wilkesia gymnoxiphium clone WgBcopy2 GIA/RGA...    89   9e-17   
gb:AF492582_1804941 Argyroxiphium sandwicense subsp. macrocephal...    89   1e-16   
gb:AF492573_1804933 Madia sativa clone MsCod1 GIA/RGA-like gibbe...    88   2e-16   
gb:AF492589_1804948 Dubautia raillardioides clone DrAcopy1 GIA/R...    88   3e-16   
gb:AF492588_1804947 Dubautia menziesii clone DmeAcopy1 GIA/RGA-l...    88   3e-16   
gb:AF492585_1804944 Dubautia arborea clone DaAcopyPro GIA/RGA-li...    87   6e-16   
gb:AF492576_1804935 Carlquistia muirii clone Cm2 GIA/RGA-like gi...    86   7e-16   
gb:AF492575_1804934 Carlquistia muirii clone Cm1 GIA/RGA-like gi...    86   7e-16   
pir|T51475|T51475 RGA-like protein - Arabidopsis thaliana>gb:ATK...    85   2e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AY269089_1594029 Glycine max GAI2 mRNA, partial cds.                81   3e-14   
gb:AY707921_1623845 Cucumis sativus gibberellin acid insensitive...    80   4e-14   
gb:AY269088_1594028 Glycine max GAI1 mRNA, partial cds.                71   3e-11   
gb:AY163162_1585960 Arabidopsis thaliana CAX-interacting protein...    34   3.3     
gb:AY088773_1573785 Arabidopsis thaliana clone 948 mRNA, complet...    34   3.3     
pir|D84690|D84690 hypothetical protein At2g28910 [imported] - Ar...    34   3.3     Arabidopsis thaliana [mouse-ear cress]
gb:AE017346_1757539 Cryptococcus neoformans var. neoformans JEC2...    33   7.3     
sp|Q7M443|CHI2_TULBA|CHI2_TULBA Chitinase 2 (EC 3.2.1.14) (Tulip bulb chiti...    33   7.3     Tulipa saxatilis subsp. bakeri
gb:AY194047_2307910 HIV-1 isolate UGMED5 from Uganda tat protein...    33   9.6     


>gb:AF378125_1793344 Vitis vinifera GAI-like protein 1 (GAI1) gene,
           complete cds.
          Length = 590

 Score =  140 bits (353), Expect = 3e-32
 Identities = 82/139 (58%), Positives = 94/139 (67%), Gaps = 14/139 (10%)
 Frame = +3

Query: 375 KMWE-ESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVH 551
           KMW+ + +QDAGMDELLAVLGY VKASDMAEVAQKLEQLEEV+ + Q D LS LASETVH
Sbjct: 22  KMWDADPQQDAGMDELLAVLGYNVKASDMAEVAQKLEQLEEVIVNAQEDGLSHLASETVH 81

Query: 552 YNPSDLSSWVDSMISELN------LGDPFLSS----QTESSSAITRNSTQIFDDSSFDSD 701
           YNPSDLS+W+ SM+SE N      L +PFL         + S   +    IFD  S D D
Sbjct: 82  YNPSDLSNWLGSMLSEFNPTPNCALDNPFLPPISPLDYTNCSTQPKQEPSIFDSPSLDYD 141

Query: 702 LTAIPGKAAY---PQPPSK 749
           L AIPGKA Y    QPP +
Sbjct: 142 LKAIPGKALYSHIEQPPQQ 160



>gb:AY326306_1599657 Cucurbita maxima gibberellic acid insensitive
           phloem (GAIP) mRNA, complete cds.
          Length = 579

 Score =  127 bits (320), Expect = 2e-28
 Identities = 78/145 (53%), Positives = 95/145 (65%), Gaps = 15/145 (10%)
 Frame = +3

Query: 375 KMWEESEQ-DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVH 551
           K+WEE  Q D GMDELLAVLGYKVK+SDMAEVAQKLEQLEE M  VQ   LS LA +TVH
Sbjct: 33  KLWEEEVQLDGGMDELLAVLGYKVKSSDMAEVAQKLEQLEEAMCQVQDTGLSHLAFDTVH 92

Query: 552 YNPSDLSSWVDSMISEL------NLGDPFLSSQTESSSAIT-------RNSTQIFDD-SS 689
           YNPSDLS+WV+SM++EL      +L D    +  ESS+          + S++IF++ SS
Sbjct: 93  YNPSDLSTWVESMLTELHPPPTSHLDDSSFLAPAESSTIANVDYEPQLQTSSRIFEESSS 152

Query: 690 FDSDLTAIPGKAAYPQPPSKRFRTA 764
            D DL AI   A Y    SKR + +
Sbjct: 153 SDYDLKAITDSAIYSPRESKRLKAS 177



>gb:AY326307_1599658 Cucurbita maxima gibberellic acid insensitive
           phloem B (GAIP-B) mRNA, complete cds.
          Length = 587

 Score =  123 bits (309), Expect = 4e-27
 Identities = 79/149 (53%), Positives = 94/149 (63%), Gaps = 21/149 (14%)
 Frame = +3

Query: 375 KMWEESEQ-DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVH 551
           K+WEE  Q D GMDELLAVLGYKVK+SDMAEVAQKLEQLEE M  VQ   LS LA +TVH
Sbjct: 33  KLWEEDAQLDGGMDELLAVLGYKVKSSDMAEVAQKLEQLEEAMCQVQDTGLSHLAFDTVH 92

Query: 552 YNPSDLSSWVDSMISEL----NLGDPFLSSQTES-------SSAIT--------RNSTQI 674
           YNPSDLS+W++SMI+EL    +   P  S   +S       SS IT        + S+ I
Sbjct: 93  YNPSDLSTWLESMITELHPPPSFPQPHPSQMNDSSFLAPAESSTITSIDYDPQRQTSSLI 152

Query: 675 FDD-SSFDSDLTAIPGKAAYPQPPSKRFR 758
           F++ SS D DL AI   A Y    +KR +
Sbjct: 153 FEESSSSDYDLKAITSSAIYSPRENKRLK 181



>gb:AY269087_1594027 Lycopersicon esculentum GAI-like protein mRNA,
           complete cds.
          Length = 588

 Score =  120 bits (302), Expect = 3e-26
 Identities = 76/181 (41%), Positives = 99/181 (54%), Gaps = 10/181 (5%)
 Frame = +3

Query: 375 KMWEESEQ---DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASET 545
           K+WEE E+   DAGMDELLAVLGYKVK+SDMA+VAQKLEQLE  MG+   D ++ L+++T
Sbjct: 27  KIWEEDEEEKPDAGMDELLAVLGYKVKSSDMADVAQKLEQLEMAMGTTMEDGITHLSTDT 86

Query: 546 VHYNPSDLSSWVDSMISEL-------NLGDPFLSSQTESSSAITRNSTQIFDDSSFDSDL 704
           VH NPSD++ WV SM+S +       N  +  L S   SSS+I   S      +  D DL
Sbjct: 87  VHKNPSDMAGWVQSMLSSISTNFDMCNQENDVLVSGCGSSSSIIDFSQNHRTSTISDDDL 146

Query: 705 TAIPGKAAYPQPPSKRFRTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXISPSESTRSVVL 884
            AIPG A +    +KR R+                             ++ S +TR VVL
Sbjct: 147 RAIPGGAVFNSDSNKRHRS-----------------TTSSFSTTSSSMVTDSSATRPVVL 189

Query: 885 V 887
           V
Sbjct: 190 V 190



>gb:ATY15194_1557522 Arabidopsis thaliana mRNA for GRS protein.
          Length = 587

 Score =  111 bits (277), Expect = 2e-23
 Identities = 75/188 (39%), Positives = 99/188 (52%), Gaps = 16/188 (8%)
 Frame = +3

Query: 372 KKMWEESEQDAGM---DELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASE 542
           K M  + E+D G    DELLAVLGYKV++S+MAEVA KLEQLE +M +VQ D LS LA++
Sbjct: 28  KMMMVKKEEDGGGNMDDELLAVLGYKVRSSEMAEVALKLEQLETMMSNVQEDGLSHLAAD 87

Query: 543 TVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNSTQIFDDSSFDSDLTAIPGK 722
           TVHYNPS+L SW+D+M+SELN   P L + +     +   S +I    + D DL  IPG 
Sbjct: 88  TVHYNPSELYSWLDNMLSELN--PPPLPASSNGLDPVL-PSPEICGFPASDYDLEVIPGN 144

Query: 723 AAYPQP----------PSKRFRTAX---XXXXXXXXXXXXXXXXXXXXXXXXXXXISPSE 863
           A Y  P           +KR ++                                 + +E
Sbjct: 145 AIYQFPAIDSSSSSNNQNKRLKSCSSPDSMVTSTSTGTQIGGVIGTTVTTTTTTTTAAAE 204

Query: 864 STRSVVLV 887
           STRSV+LV
Sbjct: 205 STRSVILV 212



>gb:ATRGA1_1554045 A.thaliana mRNA for RGA1 gene.
          Length = 587

 Score =  111 bits (277), Expect = 2e-23
 Identities = 75/188 (39%), Positives = 99/188 (52%), Gaps = 16/188 (8%)
 Frame = +3

Query: 372 KKMWEESEQDAGM---DELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASE 542
           K M  + E+D G    DELLAVLGYKV++S+MAEVA KLEQLE +M +VQ D LS LA++
Sbjct: 28  KMMMVKKEEDGGGNMDDELLAVLGYKVRSSEMAEVALKLEQLETMMSNVQEDGLSHLATD 87

Query: 543 TVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNSTQIFDDSSFDSDLTAIPGK 722
           TVHYNPS+L SW+D+M+SELN   P L + +     +   S +I    + D DL  IPG 
Sbjct: 88  TVHYNPSELYSWLDNMLSELN--PPPLPASSNGLDPVL-PSPEICGFPASDYDLKVIPGN 144

Query: 723 AAYPQP----------PSKRFRTAX---XXXXXXXXXXXXXXXXXXXXXXXXXXXISPSE 863
           A Y  P           +KR ++                                 + +E
Sbjct: 145 AIYQFPAIDSSSSSNNQNKRLKSCSSPDSMVTSTSTGTQIGGVIGTTVTTTTTTTTAAAE 204

Query: 864 STRSVVLV 887
           STRSV+LV
Sbjct: 205 STRSVILV 212



>pir|D84426|D84426 hypothetical protein At2g01570 [imported] -
           Arabidopsis thaliana>gb:AC005560_1532823 Arabidopsis
           thaliana chromosome 2 clone F2I9 map rga, complete
           sequence.>gb:AY054160_1562982 Arabidopsis thaliana
           At2g01570/F2I9.19 mRNA, complete
           cds.>gb:BT010467_1640413 Arabidopsis thaliana
           At2g01570/F2I9.19 gene, complete cds.
          Length = 587

 Score =  110 bits (276), Expect = 3e-23
 Identities = 75/188 (39%), Positives = 98/188 (52%), Gaps = 16/188 (8%)
 Frame = +3

Query: 372 KKMWEESEQDAGM---DELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASE 542
           K M  + E+D G    DELLAVLGYKV++S+MAEVA KLEQLE +M +VQ D LS LA++
Sbjct: 28  KMMMVKKEEDGGGNMDDELLAVLGYKVRSSEMAEVALKLEQLETMMSNVQEDGLSHLATD 87

Query: 543 TVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNSTQIFDDSSFDSDLTAIPGK 722
           TVHYNPS+L SW+D+M+SELN   P L + +     +   S +I    + D DL  IPG 
Sbjct: 88  TVHYNPSELYSWLDNMLSELN--PPPLPASSNGLDPVL-PSPEICGFPASDYDLKVIPGN 144

Query: 723 AAYPQP----------PSKRFRTAX---XXXXXXXXXXXXXXXXXXXXXXXXXXXISPSE 863
           A Y  P           +KR ++                                 +  E
Sbjct: 145 AIYQFPAIDSSSSSNNQNKRLKSCSSPDSMVTSTSTGTQIGGVIGTTVTTTTTTTTAAGE 204

Query: 864 STRSVVLV 887
           STRSV+LV
Sbjct: 205 STRSVILV 212



>gb:AY208992_1589641 Gossypium hirsutum GIA/RGA-like gibberellin
           response modulator (GAI) mRNA, GAI-Dwarf8 allele,
           complete cds.
          Length = 537

 Score =  109 bits (272), Expect = 8e-23
 Identities = 63/121 (52%), Positives = 77/121 (63%), Gaps = 1/121 (0%)
 Frame = +3

Query: 375 KMWEESEQDAGMD-ELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVH 551
           K+WEE     GMD ELLAVLGYKV++SDMA+VAQKLE LE+VMG+ Q D +S L  +TVH
Sbjct: 24  KLWEEDPDAGGMDDELLAVLGYKVRSSDMADVAQKLEMLEKVMGTAQEDGISQL-GDTVH 82

Query: 552 YNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNSTQIFDDSSFDSDLTAIPGKAAY 731
           +NPSDLS WV +++ E N              + T       DDS +  DL AIPG AAY
Sbjct: 83  FNPSDLSGWVQNLLIEFN-------------GSTTTPDPNFNDDSEY--DLRAIPGVAAY 127

Query: 732 P 734
           P
Sbjct: 128 P 128



>gb:AY052239_1562612 Arabidopsis thaliana At2g01570/F2I9.19 mRNA,
           complete cds.
          Length = 587

 Score =  109 bits (272), Expect = 8e-23
 Identities = 65/126 (51%), Positives = 83/126 (65%), Gaps = 3/126 (2%)
 Frame = +3

Query: 372 KKMWEESEQDAGM---DELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASE 542
           K M  + E+D G    DELLAVLGYKV++S+MAEVA KLEQLE +M +VQ D LS LA++
Sbjct: 28  KMMMVKKEEDGGGNMDDELLAVLGYKVRSSEMAEVALKLEQLETMMSNVQEDGLSHLATD 87

Query: 543 TVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNSTQIFDDSSFDSDLTAIPGK 722
           TVHYNPS+L SW+D+M+SELN   P L + +     +   S +I    + D DL  IPG 
Sbjct: 88  TVHYNPSELYSWLDNMLSELN--PPPLPASSNGLDPVL-PSPEICGFPASDYDLKVIPGN 144

Query: 723 AAYPQP 740
           A Y  P
Sbjct: 145 AIYQFP 150



>gb:ATY15193_1557521 Arabidopsis thaliana GAI gene.
          Length = 532

 Score =  106 bits (264), Expect = 7e-22
 Identities = 50/76 (65%), Positives = 65/76 (85%)
 Frame = +3

Query: 378 MWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYN 557
           M  E +   GMDELLAVLGYKV++S+MA+VAQKLEQLE +M +VQ DDLS LA+ETVHYN
Sbjct: 16  MMNEEDDGNGMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSNVQEDDLSQLATETVHYN 75

Query: 558 PSDLSSWVDSMISELN 605
           P++L +W+DSM+++LN
Sbjct: 76  PAELYTWLDSMLTDLN 91



>gb:ATRGA2_1554046 A.thaliana mRNA for RGA2 gene.
          Length = 532

 Score =  106 bits (264), Expect = 7e-22
 Identities = 50/76 (65%), Positives = 65/76 (85%)
 Frame = +3

Query: 378 MWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYN 557
           M  E +   GMDELLAVLGYKV++S+MA+VAQKLEQLE +M +VQ DDLS LA+ETVHYN
Sbjct: 16  MMNEEDDGNGMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSNVQEDDLSQLATETVHYN 75

Query: 558 PSDLSSWVDSMISELN 605
           P++L +W+DSM+++LN
Sbjct: 76  PAELYTWLDSMLTDLN 91



>pir|H86282|H86282 protein F10B6.34 [imported] - Arabidopsis
           thaliana>gb:AE005172_890491 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC006917_1534694 Genomic sequence for
           Arabidopsis thaliana BAC F10B6 from chromosome I,
           complete sequence.>gb:AY058194_1564329 Arabidopsis
           thaliana At1g14920/F10B6_15 mRNA, complete
           cds.>gb:AY142002_1582839 Arabidopsis thaliana
           At1g14920/F10B6_15 mRNA, complete cds.
          Length = 533

 Score =  106 bits (264), Expect = 7e-22
 Identities = 50/76 (65%), Positives = 65/76 (85%)
 Frame = +3

Query: 378 MWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYN 557
           M  E +   GMDELLAVLGYKV++S+MA+VAQKLEQLE +M +VQ DDLS LA+ETVHYN
Sbjct: 17  MMNEEDDGNGMDELLAVLGYKVRSSEMADVAQKLEQLEVMMSNVQEDDLSQLATETVHYN 76

Query: 558 PSDLSSWVDSMISELN 605
           P++L +W+DSM+++LN
Sbjct: 77  PAELYTWLDSMLTDLN 92



>gb:ATA224957_1542702 Arabidopsis thaliana RGAL gene.
          Length = 662

 Score =  105 bits (261), Expect = 2e-21
 Identities = 60/115 (52%), Positives = 76/115 (66%)
 Frame = +3

Query: 393 EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLS 572
           E+ AG+DELL VLGYKV++SDMA+VA KLEQLE V+    GD +S+L+ ETVHYNPSDLS
Sbjct: 177 EEAAGVDELLVVLGYKVRSSDMADVAHKLEQLEMVL----GDGISNLSDETVHYNPSDLS 232

Query: 573 SWVDSMISELNLGDPFLSSQTESSSAITRNSTQIFDDSSFDSDLTAIPGKAAYPQ 737
            WV+SM+S+L   DP                T+I +    + DL AIPG A YP+
Sbjct: 233 GWVESMLSDL---DP----------------TRIQEKPDSEYDLRAIPGSAVYPR 268



>pir|G96688|G96688 hypothetical protein T27F4.10 [imported] -
           Arabidopsis thaliana>gb:AE005173_894283 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC020665_1538587 Arabidopsis thaliana
           chromosome 1 BAC T27F4 genomic sequence, complete
           sequence.>gb:AY048749_1561789 Arabidopsis thaliana RGL1
           protein mRNA, complete cds.>gb:AY070035_1566678
           Arabidopsis thaliana putative gibberellin regulatory
           protein (At1g66350) mRNA, complete
           cds.>gb:AY096506_1576048 Arabidopsis thaliana putative
           gibberellin regulatory protein (At1g66350) mRNA,
           complete cds.
          Length = 511

 Score =  105 bits (261), Expect = 2e-21
 Identities = 60/115 (52%), Positives = 76/115 (66%)
 Frame = +3

Query: 393 EQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLS 572
           E+ AG+DELL VLGYKV++SDMA+VA KLEQLE V+    GD +S+L+ ETVHYNPSDLS
Sbjct: 26  EEAAGVDELLVVLGYKVRSSDMADVAHKLEQLEMVL----GDGISNLSDETVHYNPSDLS 81

Query: 573 SWVDSMISELNLGDPFLSSQTESSSAITRNSTQIFDDSSFDSDLTAIPGKAAYPQ 737
            WV+SM+S+L   DP                T+I +    + DL AIPG A YP+
Sbjct: 82  GWVESMLSDL---DP----------------TRIQEKPDSEYDLRAIPGSAVYPR 117



>gb:AX081278_1460756 Sequence 3 from Patent WO0109356.
          Length = 572

 Score =  101 bits (251), Expect = 2e-20
 Identities = 57/118 (48%), Positives = 75/118 (63%)
 Frame = +3

Query: 372 KKMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVH 551
           K M  + E+D   DELL VLGYKV++S+MAEVA KLEQLE +MG+ Q D L+ LA++TVH
Sbjct: 32  KMMMVKEEED---DELLGVLGYKVRSSEMAEVALKLEQLETMMGNAQEDGLAHLATDTVH 88

Query: 552 YNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNSTQIFDDSSFDSDLTAIPGKA 725
           YNP++L SW+D+M++ELN       S   +      N+   F       DL AIPG A
Sbjct: 89  YNPAELYSWLDNMLTELNPPAATTGSNALNPEINNNNNNSFFT----GGDLKAIPGNA 142



>gb:AX081276_1460755 Sequence 1 from Patent WO0109356.
          Length = 572

 Score =  101 bits (251), Expect = 2e-20
 Identities = 57/118 (48%), Positives = 75/118 (63%)
 Frame = +3

Query: 372 KKMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVH 551
           K M  + E+D   DELL VLGYKV++S+MAEVA KLEQLE +MG+ Q D L+ LA++TVH
Sbjct: 32  KMMMVKEEED---DELLGVLGYKVRSSEMAEVALKLEQLETMMGNAQEDGLAHLATDTVH 88

Query: 552 YNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNSTQIFDDSSFDSDLTAIPGKA 725
           YNP++L SW+D+M++ELN       S   +      N+   F       DL AIPG A
Sbjct: 89  YNPAELYSWLDNMLTELNPPAATTGSNALNPEINNNNNNSFFT----GGDLKAIPGNA 142



>gb:AK118009_1816011 Arabidopsis thaliana At3g03450 mRNA for
           putative RGA1, complete cds, clone: RAFL19-21-I19.
          Length = 547

 Score = 99.8 bits (247), Expect = 6e-20
 Identities = 60/124 (48%), Positives = 86/124 (69%), Gaps = 2/124 (1%)
 Frame = +3

Query: 372 KKMWEESEQDAGMD-ELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDL-SSLASET 545
           KK  ++   ++ MD ELLAVLGYKV++S+MAEVAQKLEQLE V+ +   DD+ S++ +++
Sbjct: 30  KKKADDDNNNSNMDDELLAVLGYKVRSSEMAEVAQKLEQLEMVLSN---DDVGSTVLNDS 86

Query: 546 VHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNSTQIFDDSSFDSDLTAIPGKA 725
           VHYNPSDLS+WV+SM+SELN  +P  S    + S + R+          + DL AIPG +
Sbjct: 87  VHYNPSDLSNWVESMLSELN--NPASSDLDTTRSCVDRS----------EYDLRAIPGLS 134

Query: 726 AYPQ 737
           A+P+
Sbjct: 135 AFPK 138



>gb:ATAC009895_1543077 Arabidopsis thaliana chromosome III BAC T21P5
           genomic sequence, complete sequence.
          Length = 547

 Score = 99.8 bits (247), Expect = 6e-20
 Identities = 60/124 (48%), Positives = 86/124 (69%), Gaps = 2/124 (1%)
 Frame = +3

Query: 372 KKMWEESEQDAGMD-ELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDL-SSLASET 545
           KK  ++   ++ MD ELLAVLGYKV++S+MAEVAQKLEQLE V+ +   DD+ S++ +++
Sbjct: 30  KKKADDDNNNSNMDDELLAVLGYKVRSSEMAEVAQKLEQLEMVLSN---DDVGSTVLNDS 86

Query: 546 VHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNSTQIFDDSSFDSDLTAIPGKA 725
           VHYNPSDLS+WV+SM+SELN  +P  S    + S + R+          + DL AIPG +
Sbjct: 87  VHYNPSDLSNWVESMLSELN--NPASSDLDTTRSCVDRS----------EYDLRAIPGLS 134

Query: 726 AYPQ 737
           A+P+
Sbjct: 135 AFPK 138



>gb:AF413192_1797483 Zea mays cultivar EP1 DWARF8 gene, partial cds.
          Length = 581

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 56/104 (53%), Positives = 70/104 (67%), Gaps = 9/104 (8%)
 Frame = +3

Query: 384 EESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG-------SVQGDD--LSSLA 536
           E+ E+D  +DELLA LGYKV++SDMA+VAQKLEQLE  MG           DD  +S LA
Sbjct: 31  EQEEED--VDELLAALGYKVRSSDMADVAQKLEQLEMAMGMGGVGGAGATADDGFVSHLA 88

Query: 537 SETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNST 668
           ++TVHYNPSDLSSWV+SM+SELN     L   T +    + +ST
Sbjct: 89  TDTVHYNPSDLSSWVESMLSELNAPPAPLPPATPAPRLASTSST 132



>gb:AF413189_1797480 Zea mays cultivar B103 DWARF8 gene, partial
           cds.
          Length = 581

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 56/104 (53%), Positives = 70/104 (67%), Gaps = 9/104 (8%)
 Frame = +3

Query: 384 EESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG-------SVQGDD--LSSLA 536
           E+ E+D  +DELLA LGYKV++SDMA+VAQKLEQLE  MG           DD  +S LA
Sbjct: 31  EQEEED--VDELLAALGYKVRSSDMADVAQKLEQLEMAMGMGGVGGAGATADDGFVSHLA 88

Query: 537 SETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNST 668
           ++TVHYNPSDLSSWV+SM+SELN     L   T +    + +ST
Sbjct: 89  TDTVHYNPSDLSSWVESMLSELNAPPAPLPPATPAPRLASTSST 132



>gb:AF413186_1797477 Zea mays cultivar M37W DWARF8 gene, partial
           cds.>gb:AF413187_1797478 Zea mays cultivar Tzi10 DWARF8
           gene, partial cds.
          Length = 581

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 56/104 (53%), Positives = 70/104 (67%), Gaps = 9/104 (8%)
 Frame = +3

Query: 384 EESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG-------SVQGDD--LSSLA 536
           E+ E+D  +DELLA LGYKV++SDMA+VAQKLEQLE  MG           DD  +S LA
Sbjct: 31  EQEEED--VDELLAALGYKVRSSDMADVAQKLEQLEMAMGMGGVGGAGATADDGFVSHLA 88

Query: 537 SETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNST 668
           ++TVHYNPSDLSSWV+SM+SELN     L   T +    + +ST
Sbjct: 89  TDTVHYNPSDLSSWVESMLSELNAPPAPLPPATPAPRLASTSST 132



>gb:AF413176_1797467 Zea mays cultivar MO24W DWARF8 gene, partial
           cds.
          Length = 581

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 56/104 (53%), Positives = 70/104 (67%), Gaps = 9/104 (8%)
 Frame = +3

Query: 384 EESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG-------SVQGDD--LSSLA 536
           E+ E+D  +DELLA LGYKV++SDMA+VAQKLEQLE  MG           DD  +S LA
Sbjct: 31  EQEEED--VDELLAALGYKVRSSDMADVAQKLEQLEMAMGMGGVGGAGATADDGFVSHLA 88

Query: 537 SETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNST 668
           ++TVHYNPSDLSSWV+SM+SELN     L   T +    + +ST
Sbjct: 89  TDTVHYNPSDLSSWVESMLSELNAPPAPLPPATPAPRLASTSST 132



>gb:AF413171_1797462 Zea mays cultivar GT112 DWARF8 gene, partial
           cds.
          Length = 581

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 56/104 (53%), Positives = 70/104 (67%), Gaps = 9/104 (8%)
 Frame = +3

Query: 384 EESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG-------SVQGDD--LSSLA 536
           E+ E+D  +DELLA LGYKV++SDMA+VAQKLEQLE  MG           DD  +S LA
Sbjct: 31  EQEEED--VDELLAALGYKVRSSDMADVAQKLEQLEMAMGMGGVGGAGATADDGFVSHLA 88

Query: 537 SETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNST 668
           ++TVHYNPSDLSSWV+SM+SELN     L   T +    + +ST
Sbjct: 89  TDTVHYNPSDLSSWVESMLSELNAPPAPLPPATPAPRLASTSST 132



>gb:AF413168_1797459 Zea mays cultivar NC250 DWARF8 gene, partial
           cds.
          Length = 581

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 56/104 (53%), Positives = 70/104 (67%), Gaps = 9/104 (8%)
 Frame = +3

Query: 384 EESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG-------SVQGDD--LSSLA 536
           E+ E+D  +DELLA LGYKV++SDMA+VAQKLEQLE  MG           DD  +S LA
Sbjct: 31  EQEEED--VDELLAALGYKVRSSDMADVAQKLEQLEMAMGMGGVGGAGATADDGFVSHLA 88

Query: 537 SETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNST 668
           ++TVHYNPSDLSSWV+SM+SELN     L   T +    + +ST
Sbjct: 89  TDTVHYNPSDLSSWVESMLSELNAPPAPLPPATPAPRLASTSST 132



>gb:AF413158_1797449 Zea mays cultivar NC320 DWARF8 gene, partial
           cds.
          Length = 581

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 56/104 (53%), Positives = 70/104 (67%), Gaps = 9/104 (8%)
 Frame = +3

Query: 384 EESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG-------SVQGDD--LSSLA 536
           E+ E+D  +DELLA LGYKV++SDMA+VAQKLEQLE  MG           DD  +S LA
Sbjct: 31  EQEEED--VDELLAALGYKVRSSDMADVAQKLEQLEMAMGMGGVGGAGATADDGFVSHLA 88

Query: 537 SETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNST 668
           ++TVHYNPSDLSSWV+SM+SELN     L   T +    + +ST
Sbjct: 89  TDTVHYNPSDLSSWVESMLSELNAPPAPLPPATPAPRLASTSST 132



>gb:AF413145_1797436 Zea mays cultivar F2 DWARF8 gene, partial cds.
          Length = 581

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 56/104 (53%), Positives = 70/104 (67%), Gaps = 9/104 (8%)
 Frame = +3

Query: 384 EESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG-------SVQGDD--LSSLA 536
           E+ E+D  +DELLA LGYKV++SDMA+VAQKLEQLE  MG           DD  +S LA
Sbjct: 31  EQEEED--VDELLAALGYKVRSSDMADVAQKLEQLEMAMGMGGVGGAGATADDGFVSHLA 88

Query: 537 SETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNST 668
           ++TVHYNPSDLSSWV+SM+SELN     L   T +    + +ST
Sbjct: 89  TDTVHYNPSDLSSWVESMLSELNAPPAPLPPATPAPRLASTSST 132



>gb:AF413141_1797432 Zea mays cultivar NC260 DWARF8 gene, partial
           cds.
          Length = 581

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 56/104 (53%), Positives = 70/104 (67%), Gaps = 9/104 (8%)
 Frame = +3

Query: 384 EESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG-------SVQGDD--LSSLA 536
           E+ E+D  +DELLA LGYKV++SDMA+VAQKLEQLE  MG           DD  +S LA
Sbjct: 31  EQEEED--VDELLAALGYKVRSSDMADVAQKLEQLEMAMGMGGVGGAGATADDGFVSHLA 88

Query: 537 SETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNST 668
           ++TVHYNPSDLSSWV+SM+SELN     L   T +    + +ST
Sbjct: 89  TDTVHYNPSDLSSWVESMLSELNAPPAPLPPATPAPRLASTSST 132



>gb:AF413138_1797429 Zea mays cultivar Q6199 DWARF8 gene, partial
           cds.>gb:AF413139_1797430 Zea mays cultivar NC354 DWARF8
           gene, partial cds.>gb:AF413140_1797431 Zea mays cultivar
           CML258 DWARF8 gene, partial cds.>gb:AF413159_1797450 Zea
           mays cultivar CML5 DWARF8 gene, partial cds.
          Length = 582

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 56/104 (53%), Positives = 70/104 (67%), Gaps = 9/104 (8%)
 Frame = +3

Query: 384 EESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG-------SVQGDD--LSSLA 536
           E+ E+D  +DELLA LGYKV++SDMA+VAQKLEQLE  MG           DD  +S LA
Sbjct: 32  EQEEED--VDELLAALGYKVRSSDMADVAQKLEQLEMAMGMGGVGGAGATADDGFVSHLA 89

Query: 537 SETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNST 668
           ++TVHYNPSDLSSWV+SM+SELN     L   T +    + +ST
Sbjct: 90  TDTVHYNPSDLSSWVESMLSELNAPPAPLPPATPAPRLASTSST 133



>gb:AF413135_1797426 Zea mays cultivar H99 DWARF8 gene, partial cds.
          Length = 581

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 56/104 (53%), Positives = 70/104 (67%), Gaps = 9/104 (8%)
 Frame = +3

Query: 384 EESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG-------SVQGDD--LSSLA 536
           E+ E+D  +DELLA LGYKV++SDMA+VAQKLEQLE  MG           DD  +S LA
Sbjct: 31  EQEEED--VDELLAALGYKVRSSDMADVAQKLEQLEMAMGMGGVGGAGATADDGFVSHLA 88

Query: 537 SETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNST 668
           ++TVHYNPSDLSSWV+SM+SELN     L   T +    + +ST
Sbjct: 89  TDTVHYNPSDLSSWVESMLSELNAPPAPLPPATPAPRLASTSST 132



>gb:AF413129_1797420 Zea mays cultivar WF9 DWARF8 gene, partial
           cds.>gb:AF413130_1797421 Zea mays cultivar U267Y DWARF8
           gene, partial cds.>gb:AF413133_1797424 Zea mays cultivar
           PA91 DWARF8 gene, partial cds.>gb:AF413134_1797425 Zea
           mays cultivar W64A DWARF8 gene, partial cds.
          Length = 581

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 56/104 (53%), Positives = 70/104 (67%), Gaps = 9/104 (8%)
 Frame = +3

Query: 384 EESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG-------SVQGDD--LSSLA 536
           E+ E+D  +DELLA LGYKV++SDMA+VAQKLEQLE  MG           DD  +S LA
Sbjct: 31  EQEEED--VDELLAALGYKVRSSDMADVAQKLEQLEMAMGMGGVGGAGATADDGFVSHLA 88

Query: 537 SETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNST 668
           ++TVHYNPSDLSSWV+SM+SELN     L   T +    + +ST
Sbjct: 89  TDTVHYNPSDLSSWVESMLSELNAPPAPLPPATPAPRLASTSST 132



>gb:AF413128_1797419 Zea mays cultivar KUI43 DWARF8 gene, partial
           cds.
          Length = 581

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 56/104 (53%), Positives = 70/104 (67%), Gaps = 9/104 (8%)
 Frame = +3

Query: 384 EESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG-------SVQGDD--LSSLA 536
           E+ E+D  +DELLA LGYKV++SDMA+VAQKLEQLE  MG           DD  +S LA
Sbjct: 31  EQEEED--VDELLAALGYKVRSSDMADVAQKLEQLEMAMGMGGVGGAGATADDGFVSHLA 88

Query: 537 SETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNST 668
           ++TVHYNPSDLSSWV+SM+SELN     L   T +    + +ST
Sbjct: 89  TDTVHYNPSDLSSWVESMLSELNAPPAPLPPATPAPRLASTSST 132



>gb:AF413117_1797408 Zea mays cultivar CMV3 DWARF8 gene, partial
           cds.
          Length = 579

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 56/104 (53%), Positives = 70/104 (67%), Gaps = 9/104 (8%)
 Frame = +3

Query: 384 EESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG-------SVQGDD--LSSLA 536
           E+ E+D  +DELLA LGYKV++SDMA+VAQKLEQLE  MG           DD  +S LA
Sbjct: 31  EQEEED--VDELLAALGYKVRSSDMADVAQKLEQLEMAMGMGGVGGAGATADDGFVSHLA 88

Query: 537 SETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNST 668
           ++TVHYNPSDLSSWV+SM+SELN     L   T +    + +ST
Sbjct: 89  TDTVHYNPSDLSSWVESMLSELNAPPAPLPPATPAPRLASTSST 132



>gb:AF413114_1797405 Zea mays cultivar CM7 DWARF8 gene, partial cds.
          Length = 578

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 56/104 (53%), Positives = 70/104 (67%), Gaps = 9/104 (8%)
 Frame = +3

Query: 384 EESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG-------SVQGDD--LSSLA 536
           E+ E+D  +DELLA LGYKV++SDMA+VAQKLEQLE  MG           DD  +S LA
Sbjct: 31  EQEEED--VDELLAALGYKVRSSDMADVAQKLEQLEMAMGMGGVGGAGATADDGFVSHLA 88

Query: 537 SETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNST 668
           ++TVHYNPSDLSSWV+SM+SELN     L   T +    + +ST
Sbjct: 89  TDTVHYNPSDLSSWVESMLSELNAPPAPLPPATPAPRLASTSST 132



>gb:AF413113_1797404 Zea mays cultivar I29 DWARF8 gene, partial
           cds.>gb:AF413122_1797413 Zea mays cultivar OH7B DWARF8
           gene, partial cds.>gb:AF413123_1797414 Zea mays cultivar
           C103 DWARF8 gene, partial cds.>gb:AF413124_1797415 Zea
           mays cultivar W182B DWARF8 gene, partial
           cds.>gb:AF413125_1797416 Zea mays cultivar 38-11 DWARF8
           gene, partial cds.>gb:AF413126_1797417 Zea mays cultivar
           Mo17 DWARF8 gene, partial cds.>gb:AF413127_1797418 Zea
           mays cultivar M162W DWARF8 gene, partial
           cds.>gb:AF413131_1797422 Zea mays cultivar TX601 DWARF8
           gene, partial cds.>gb:AF413132_1797423 Zea mays cultivar
           SC213 DWARF8 gene, partial cds.>gb:AF413136_1797427 Zea
           mays cultivar KUI21 DWARF8 gene, partial
           cds.>gb:AF413137_1797428 Zea mays cultivar I137TN DWARF8
           gene, partial cds.>gb:AF413142_1797433 Zea mays cultivar
           MS153 DWARF8 gene, partial cds.>gb:AF413143_1797434 Zea
           mays cultivar ND246 DWARF8 gene, partial
           cds.>gb:AF413144_1797435 Zea mays cultivar NC304 DWARF8
           gene, partial cds.>gb:AF413146_1797437 Zea mays cultivar
           NC352 DWARF8 gene, partial cds.>gb:AF413147_1797438 Zea
           mays cultivar NC350 DWARF8 gene, partial
           cds.>gb:AF413148_1797439 Zea mays cultivar SG18 DWARF8
           gene, partial cds.>gb:AF413149_1797440 Zea mays cultivar
           W117HT DWARF8 gene, partial cds.>gb:AF413150_1797441 Zea
           mays cultivar T232 DWARF8 gene, partial
           cds.>gb:AF413151_1797442 Zea mays cultivar SA24 DWARF8
           gene, partial cds.>gb:AF413152_1797443 Zea mays cultivar
           KUI3 DWARF8 gene, partial cds.>gb:AF413153_1797444 Zea
           mays cultivar B68 DWARF8 gene, partial
           cds.>gb:AF413154_1797445 Zea mays cultivar B104 DWARF8
           gene, partial cds.>gb:AF413155_1797446 Zea mays cultivar
           A632 DWARF8 gene, partial cds.>gb:AF413156_1797447 Zea
           mays cultivar NC348 DWARF8 gene, partial
           cds.>gb:AF413157_1797448 Zea mays cultivar Tzi18 DWARF8
           gene, partial cds.>gb:AF413160_1797451 Zea mays cultivar
           A272 DWARF8 gene, partial cds.>gb:AF413161_1797452 Zea
           mays cultivar B37 DWARF8 gene, partial
           cds.>gb:AF413162_1797453 Zea mays cultivar B73 DWARF8
           gene, partial cds.>gb:AF413163_1797454 Zea mays cultivar
           CML281 DWARF8 gene, partial cds.>gb:AF413164_1797455 Zea
           mays cultivar B84 DWARF8 gene, partial
           cds.>gb:AF413165_1797456 Zea mays cultivar CML277 DWARF8
           gene, partial cds.>gb:AF413166_1797457 Zea mays cultivar
           KUI2007 DWARF8 gene, partial cds.>gb:AF413167_1797458
           Zea mays cultivar CML333 DWARF8 gene, partial
           cds.>gb:AF413169_1797460 Zea mays cultivar N28HT DWARF8
           gene, partial cds.>gb:AF413170_1797461 Zea mays cultivar
           K55 DWARF8 gene, partial cds.>gb:AF413172_1797463 Zea
           mays cultivar F44 DWARF8 gene, partial
           cds.>gb:AF413173_1797464 Zea mays cultivar A441 DWARF8
           gene, partial cds.>gb:AF413174_1797465 Zea mays cultivar
           CML10 DWARF8 gene, partial cds.>gb:AF413175_1797466 Zea
           mays cultivar CML261 DWARF8 gene, partial
           cds.>gb:AF413177_1797468 Zea mays cultivar SC55 DWARF8
           gene, partial cds.>gb:AF413178_1797469 Zea mays cultivar
           NC298 DWARF8 gene, partial cds.>gb:AF413179_1797470 Zea
           mays cultivar IL677A DWARF8 gene, partial
           cds.>gb:AF413180_1797471 Zea mays cultivar TZI8 DWARF8
           gene, partial cds.>gb:AF413181_1797472 Zea mays cultivar
           IA2132 DWARF8 gene, partial cds.>gb:AF413182_1797473 Zea
           mays cultivar D940Y DWARF8 gene, partial
           cds.>gb:AF413183_1797474 Zea mays cultivar W153R DWARF8
           gene, partial cds.>gb:AF413184_1797475 Zea mays cultivar
           B97 DWARF8 gene, partial cds.>gb:AF413185_1797476 Zea
           mays cultivar NC300 DWARF8 gene, partial
           cds.>gb:AF413188_1797479 Zea mays cultivar KUI11 DWARF8
           gene, partial cds.>gb:AF413190_1797481 Zea mays cultivar
           CML254 DWARF8 gene, partial cds.>gb:AF413191_1797482 Zea
           mays cultivar CML247 DWARF8 gene, partial
           cds.>gb:AF413193_1797484 Zea mays cultivar CI187 DWARF8
           gene, partial cds.>gb:AF413194_1797485 Zea mays cultivar
           NC338 DWARF8 gene, partial cds.>gb:AF413195_1797486 Zea
           mays cultivar NC296 DWARF8 gene, partial
           cds.>gb:AF413196_1797487 Zea mays cultivar KUI44 DWARF8
           gene, partial cds.>gb:AF413197_1797488 Zea mays cultivar
           CML287 DWARF8 gene, partial cds.>gb:AF413198_1797489 Zea
           mays cultivar B14A DWARF8 gene, partial
           cds.>gb:AF413199_1797490 Zea mays cultivar IDS28 DWARF8
           gene, partial cds.>gb:AF413200_1797491 Zea mays cultivar
           Ky21 DWARF8 gene, partial cds.>gb:AF413201_1797492 Zea
           mays cultivar A6 DWARF8 gene, partial
           cds.>gb:AF413203_1797494 Zea mays cultivar A554 DWARF8
           gene, partial cds.
          Length = 581

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 56/104 (53%), Positives = 70/104 (67%), Gaps = 9/104 (8%)
 Frame = +3

Query: 384 EESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG-------SVQGDD--LSSLA 536
           E+ E+D  +DELLA LGYKV++SDMA+VAQKLEQLE  MG           DD  +S LA
Sbjct: 31  EQEEED--VDELLAALGYKVRSSDMADVAQKLEQLEMAMGMGGVGGAGATADDGFVSHLA 88

Query: 537 SETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNST 668
           ++TVHYNPSDLSSWV+SM+SELN     L   T +    + +ST
Sbjct: 89  TDTVHYNPSDLSSWVESMLSELNAPPAPLPPATPAPRLASTSST 132



>gb:AF413112_1797403 Zea mays cultivar A619 DWARF8 gene, partial
           cds.>gb:AF413115_1797406 Zea mays cultivar CM174 DWARF8
           gene, partial cds.>gb:AF413116_1797407 Zea mays cultivar
           F7 DWARF8 gene, partial cds.>gb:AF413118_1797409 Zea
           mays cultivar F2834T DWARF8 gene, partial
           cds.>gb:AF413119_1797410 Zea mays cultivar P39 DWARF8
           gene, partial cds.>gb:AF413120_1797411 Zea mays cultivar
           OH43 DWARF8 gene, partial cds.>gb:AF413121_1797412 Zea
           mays cultivar CM105 DWARF8 gene, partial
           cds.>gb:AF413202_1797493 Zea mays cultivar N192 DWARF8
           gene, partial cds.
          Length = 579

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 56/104 (53%), Positives = 70/104 (67%), Gaps = 9/104 (8%)
 Frame = +3

Query: 384 EESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG-------SVQGDD--LSSLA 536
           E+ E+D  +DELLA LGYKV++SDMA+VAQKLEQLE  MG           DD  +S LA
Sbjct: 31  EQEEED--VDELLAALGYKVRSSDMADVAQKLEQLEMAMGMGGVGGAGATADDGFVSHLA 88

Query: 537 SETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNST 668
           ++TVHYNPSDLSSWV+SM+SELN     L   T +    + +ST
Sbjct: 89  TDTVHYNPSDLSSWVESMLSELNAPPAPLPPATPAPRLASTSST 132



>gb:ZMA242530_1731466 Zea mays partial d8 gene for gibberellin
           response modulator.
          Length = 630

 Score = 95.1 bits (235), Expect = 2e-18
 Identities = 56/104 (53%), Positives = 70/104 (67%), Gaps = 9/104 (8%)
 Frame = +3

Query: 384 EESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG-------SVQGDD--LSSLA 536
           E+ E+D  +DELLA LGYKV++SDMA+VAQKLEQLE  MG           DD  +S LA
Sbjct: 31  EQEEED--VDELLAALGYKVRSSDMADVAQKLEQLEMAMGMGGVGGAGATADDGFVSHLA 88

Query: 537 SETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNST 668
           ++TVHYNPSDLSSWV+SM+SELN     L   T +    + +ST
Sbjct: 89  TDTVHYNPSDLSSWVESMLSELNAPPAPLPPATPAPRLASTSST 132



>gb:AF460219_1801797 Hordeum vulgare subsp. vulgare nuclear
           transcription factor SLN1 gene, complete cds.
          Length = 618

 Score = 93.6 bits (231), Expect = 5e-18
 Identities = 57/104 (54%), Positives = 69/104 (66%), Gaps = 6/104 (5%)
 Frame = +3

Query: 372 KKMWEESEQDAG--MDELLAVLGYKVKASDMAEVAQKLEQLEEV--MGSVQGDD--LSSL 533
           K M   SE   G  +DELLA LGYKV+ASDMA+VAQKLEQLE    MG    DD   + L
Sbjct: 24  KMMVSSSEAGEGEEVDELLAALGYKVRASDMADVAQKLEQLEMAMGMGGPAPDDGFATHL 83

Query: 534 ASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNS 665
           A++TVHYNP+DLSSWV+SM+SELN   P L       +A T ++
Sbjct: 84  ATDTVHYNPTDLSSWVESMLSELNAPPPPLPPAPPQLNASTSST 127



>gb:AF492563_1804923 Dubautia arborea clone DaBcopy2 GIA/RGA-like
           gibberellin response modulator (GAI-B) gene, partial
           cds.
          Length = 538

 Score = 93.2 bits (230), Expect = 6e-18
 Identities = 61/122 (50%), Positives = 72/122 (59%), Gaps = 13/122 (10%)
 Frame = +3

Query: 405 GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVD 584
           GMDELL VLGYKVK++DMA+VAQKLEQLE VM    G+D     S+TVHYNPSDLS WV 
Sbjct: 22  GMDELLEVLGYKVKSTDMADVAQKLEQLEMVM----GEDGVLQLSDTVHYNPSDLSGWVQ 77

Query: 585 SMISELNLGDP-----FLSSQTESSSAITRNSTQIFDDSSFDS--------DLTAIPGKA 725
           SM+S LN   P      LS  + ++     NS++I       S        DL AI G A
Sbjct: 78  SMLSVLNENTPPSDHIVLSGDSSTTMIDFSNSSEIVVHGKQGSKMHEDDPYDLRAIAGGA 137

Query: 726 AY 731
            Y
Sbjct: 138 IY 139



>gb:AF492566_1804926 Dubautia menziesii clone DmeBcopy GIA/RGA-like
           gibberellin response modulator (GAI-B) gene, partial
           cds.
          Length = 536

 Score = 92.8 bits (229), Expect = 8e-18
 Identities = 61/122 (50%), Positives = 72/122 (59%), Gaps = 13/122 (10%)
 Frame = +3

Query: 405 GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVD 584
           GMDELL VLGYKVK++DMA+VAQKLEQLE VM    G+D     S+TVHYNPSDLS WV 
Sbjct: 22  GMDELLEVLGYKVKSTDMADVAQKLEQLEMVM----GEDGVLQLSDTVHYNPSDLSGWVQ 77

Query: 585 SMISELNLGDP-----FLSSQTESSSAITRNSTQIFDDSSFDS--------DLTAIPGKA 725
           SM+S LN   P      LS  + ++     NS++I       S        DL AI G A
Sbjct: 78  SMLSVLNDNTPPSDHIVLSGDSSTTMIDFSNSSEIVVHGKQGSKMHEDDPYDLRAIAGGA 137

Query: 726 AY 731
            Y
Sbjct: 138 IY 139



>gb:AF492565_1804925 Dubautia ciliolata subsp. glutinosa clone
           DcK20B GIA/RGA-like gibberellin response modulator
           (GAI-B) gene, partial cds.
          Length = 536

 Score = 92.8 bits (229), Expect = 8e-18
 Identities = 61/122 (50%), Positives = 72/122 (59%), Gaps = 13/122 (10%)
 Frame = +3

Query: 405 GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVD 584
           GMDELL VLGYKVK++DMA+VAQKLEQLE VM    G+D     S+TVHYNPSDLS WV 
Sbjct: 22  GMDELLEVLGYKVKSTDMADVAQKLEQLEMVM----GEDGVLQLSDTVHYNPSDLSGWVQ 77

Query: 585 SMISELNLGDP-----FLSSQTESSSAITRNSTQIFDDSSFDS--------DLTAIPGKA 725
           SM+S LN   P      LS  + ++     NS++I       S        DL AI G A
Sbjct: 78  SMLSVLNDNTPPSDHMVLSGDSSTTMIDFSNSSEIVVHGKQGSKMHEDDPYDLRAIAGGA 137

Query: 726 AY 731
            Y
Sbjct: 138 IY 139



>gb:AB030956_1518584 Oryza sativa (japonica cultivar-group) mRNA for
           OsGAI, complete cds.>gb:AC087797_1734173 Oryza sativa
           chromosome 3 BAC OSJNBb0022E02 genomic sequence,
           complete sequence.
          Length = 625

 Score = 92.8 bits (229), Expect = 8e-18
 Identities = 56/107 (52%), Positives = 73/107 (68%), Gaps = 8/107 (7%)
 Frame = +3

Query: 372 KKMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMG----SVQG--DD--LS 527
           K M   + ++  +DELLA LGYKV++SDMA+VAQKLEQLE  MG    S  G  DD  +S
Sbjct: 26  KVMAGAAGEEEDVDELLAALGYKVRSSDMADVAQKLEQLEMAMGMGGVSAPGAADDGFVS 85

Query: 528 SLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITRNST 668
            LA++TVHYNPSDLSSWV+SM+SELN   P +     ++   + +ST
Sbjct: 86  HLATDTVHYNPSDLSSWVESMLSELNAPLPPIPPAPPAARHASTSST 132



>gb:AF492564_1804924 Dubautia ciliolata subsp. glutinosa clone
           DcK05B GIA/RGA-like gibberellin response modulator
           (GAI-B) gene, partial cds.
          Length = 536

 Score = 92.4 bits (228), Expect = 1e-17
 Identities = 61/122 (50%), Positives = 72/122 (59%), Gaps = 13/122 (10%)
 Frame = +3

Query: 405 GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVD 584
           GMDELL VLGYKVK++DMA+VAQKLEQLE VM    G+D     S+TVHYNPSDLS WV 
Sbjct: 22  GMDELLEVLGYKVKSTDMADVAQKLEQLEMVM----GEDGVLQLSDTVHYNPSDLSGWVQ 77

Query: 585 SMISELNLGDP-----FLSSQTESSSAITRNSTQIFDDSSFDS--------DLTAIPGKA 725
           SM+S LN   P      LS  + ++     NS++I       S        DL AI G A
Sbjct: 78  SMLSVLNDNTPPSDHMVLSGDSSTTMIDFSNSSKIVVHGKQGSKMHEDDPYDLRAIAGGA 137

Query: 726 AY 731
            Y
Sbjct: 138 IY 139



>gb:TAE242531_1724288 Triticum aestivum rht-D1a gene for gibberellin
           response modulator.
          Length = 623

 Score = 92.0 bits (227), Expect = 1e-17
 Identities = 63/128 (49%), Positives = 75/128 (58%), Gaps = 17/128 (13%)
 Frame = +3

Query: 408 MDELLAVLGYKVKASDMAEVAQKLEQLEEVMG------SVQGDD--LSSLASETVHYNPS 563
           +DELLA LGYKV+ASDMA+VAQKLEQLE  MG          DD   + LA++TVHYNP+
Sbjct: 37  VDELLAALGYKVRASDMADVAQKLEQLEMAMGMGGVGAGAAPDDSFATHLATDTVHYNPT 96

Query: 564 DLSSWVDSMISELNLGDPFLSSQTE---SSSAITRNSTQIFD-DSSFDSD-----LTAIP 716
           DLSSWV+SM+SELN   P L    +   S+S+    S   FD   S DS      L  IP
Sbjct: 97  DLSSWVESMLSELNAPPPPLPPAPQLNASTSSTVTGSGGYFDLPPSVDSSSSIYALRPIP 156

Query: 717 GKAAYPQP 740
             A    P
Sbjct: 157 SPAGATAP 164



>gb:AF492578_1804937 Calycadenia multiglandulosa clone CLmCod7
           GIA/RGA-like gibberellin response modulator (GAI) gene,
           partial cds.
          Length = 540

 Score = 91.3 bits (225), Expect = 2e-17
 Identities = 61/115 (53%), Positives = 71/115 (61%), Gaps = 6/115 (5%)
 Frame = +3

Query: 405 GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVD 584
           GMDELL VLGYKVK++DM +VAQKLEQLE VMG    D +  L S+TVHYNPSDLS WV 
Sbjct: 33  GMDELLEVLGYKVKSTDMDDVAQKLEQLEMVMGE---DGILQL-SDTVHYNPSDLSGWVQ 88

Query: 585 SMISELNL--GDPFLS----SQTESSSAITRNSTQIFDDSSFDSDLTAIPGKAAY 731
           SM+SELN   GD  +     +  ESS+ +   S           DL AI G A Y
Sbjct: 89  SMLSELNNSGGDSDIGIGIPAGGESSTTMIDFSNNKEKQPEDPYDLRAIAGGAIY 143



>gb:AF492584_1804943 Argyroxiphium kauense clone AkAcopy2
           GIA/RGA-like gibberellin response modulator (GAI-A)
           gene, partial cds.
          Length = 544

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 61/124 (49%), Positives = 74/124 (59%), Gaps = 15/124 (12%)
 Frame = +3

Query: 405 GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVD 584
           GMDELL VLGYKVK++DMA+VAQKLEQLE VMG    D +  L S+TVHYNPSDLS WV 
Sbjct: 22  GMDELLEVLGYKVKSTDMADVAQKLEQLEMVMGE---DGILQL-SDTVHYNPSDLSGWVQ 77

Query: 585 SMISELNLGDPFLSSQTESSSAIT--RNSTQIFDDSS-------------FDSDLTAIPG 719
           SM+  LN  +   ++  +S   +    +ST + D SS              D DL AI G
Sbjct: 78  SMLLVLNDNNNNNNTAHDSGHILLPGDSSTTMIDFSSEIVVHGKPGSKIHLDDDLRAIAG 137

Query: 720 KAAY 731
            A Y
Sbjct: 138 GAIY 141



>gb:AF492579_1804938 Anisocarpus madioides clone ANm2a GIA/RGA-like
           gibberellin response modulator (GAI) gene, partial cds.
          Length = 380

 Score = 90.9 bits (224), Expect = 3e-17
 Identities = 65/136 (47%), Positives = 76/136 (55%), Gaps = 16/136 (11%)
 Frame = +3

Query: 372 KKMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVH 551
           KK         GMDELL VLGYKVK++DMA+VAQKLEQLE VMG    D +  L S+TVH
Sbjct: 8   KKEASSVPDSGGMDELLEVLGYKVKSTDMADVAQKLEQLEMVMGE---DGILQL-SDTVH 63

Query: 552 YNPSDLSSWVDSMISELNLGDPFLSSQTESSSAIT---RNSTQIFDDSS----------- 689
           YNPSDLS WV SM+  LN  D   ++  + S  I     +ST + D SS           
Sbjct: 64  YNPSDLSGWVQSMLLVLN--DNNTTTTADDSGHILLPGDSSTTMIDFSSETVVHGKPGSK 121

Query: 690 --FDSDLTAIPGKAAY 731
              D DL AI G A Y
Sbjct: 122 IHQDDDLRAIAGGAIY 137



>gb:AF492590_1804949 Dubautia microcephala clone DmiAcopy1
           GIA/RGA-like gibberellin response modulator (GAI-A)
           gene, partial cds.
          Length = 537

 Score = 90.5 bits (223), Expect = 4e-17
 Identities = 62/124 (50%), Positives = 75/124 (60%), Gaps = 15/124 (12%)
 Frame = +3

Query: 405 GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVD 584
           GMDELL VLGYKVK++DMA+VAQKLEQLE VMG    D +  L S+TVHYNPSDLS WV 
Sbjct: 17  GMDELLEVLGYKVKSTDMADVAQKLEQLEMVMGE---DGILQL-SDTVHYNPSDLSGWVQ 72

Query: 585 SMISELNLGDPFLSSQTESSSAIT--RNSTQIFDDSS-------------FDSDLTAIPG 719
           +M+  LN  D   ++  +SS  +    +ST + D SS              D DL AI G
Sbjct: 73  TMLLVLN--DDNNNAADDSSHILLPGDSSTTMIDFSSEIVVHGKPGSKIHLDDDLRAIAG 130

Query: 720 KAAY 731
            A Y
Sbjct: 131 GAIY 134



>gb:AF492586_1804945 Dubautia arborea clone DaAcopy1 GIA/RGA-like
           gibberellin response modulator (GAI-A) gene, partial
           cds.
          Length = 534

 Score = 90.5 bits (223), Expect = 4e-17
 Identities = 63/125 (50%), Positives = 73/125 (58%), Gaps = 16/125 (12%)
 Frame = +3

Query: 405 GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVD 584
           GMDELL VLGYKVK++DMA+VAQKLEQLE VMG    D +  L S+TVHYNPSDLS WV 
Sbjct: 17  GMDELLEVLGYKVKSTDMADVAQKLEQLEMVMGE---DGILQL-SDTVHYNPSDLSGWVQ 72

Query: 585 SMISELNLGDPFLSSQTESSSAIT---RNSTQIFDDSS-------------FDSDLTAIP 716
           SM+  LN  D   ++    S  I     +ST + D SS              D DL AI 
Sbjct: 73  SMLLVLN--DNNTNNTAHDSGHILLPGDSSTTMIDFSSEIVVHGKPGSKIHLDDDLRAIA 130

Query: 717 GKAAY 731
           G A Y
Sbjct: 131 GGAIY 135



>gb:AF492583_1804942 Argyroxiphium kauense clone AkAcopy1
           GIA/RGA-like gibberellin response modulator (GAI-A)
           gene, partial cds.
          Length = 542

 Score = 90.5 bits (223), Expect = 4e-17
 Identities = 60/122 (49%), Positives = 71/122 (58%), Gaps = 13/122 (10%)
 Frame = +3

Query: 405 GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVD 584
           GMDELL VLGYKVK++DMA+VAQKLEQLE VMG    D +  L S+TVHYNPSDLS WV 
Sbjct: 22  GMDELLEVLGYKVKSTDMADVAQKLEQLEMVMGE---DGILQL-SDTVHYNPSDLSGWVQ 77

Query: 585 SMISELNLGDPFLSSQTESSSAITRNSTQIFDDSS-------------FDSDLTAIPGKA 725
           SM+  LN  +   +  +        +ST + D SS              D DL AI G A
Sbjct: 78  SMLLVLNDNNNNTAHDSGHILLPGDSSTTMIDFSSEIVVHGKPGSKIHLDDDLRAIAGGA 137

Query: 726 AY 731
            Y
Sbjct: 138 IY 139



>gb:AF492581_1804940 Argyroxiphium sandwicense subsp. macrocephalum
           clone AsAcopy1 GIA/RGA-like gibberellin response
           modulator (GAI-A) gene, partial cds.
          Length = 542

 Score = 90.5 bits (223), Expect = 4e-17
 Identities = 60/122 (49%), Positives = 71/122 (58%), Gaps = 13/122 (10%)
 Frame = +3

Query: 405 GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVD 584
           GMDELL VLGYKVK++DMA+VAQKLEQLE VMG    D +  L S+TVHYNPSDLS WV 
Sbjct: 22  GMDELLEVLGYKVKSTDMADVAQKLEQLEMVMGE---DGILQL-SDTVHYNPSDLSGWVQ 77

Query: 585 SMISELNLGDPFLSSQTESSSAITRNSTQIFDDSS-------------FDSDLTAIPGKA 725
           SM+  LN  +   +  +        +ST + D SS              D DL AI G A
Sbjct: 78  SMLLVLNDNNNNTAHDSGHILLPGDSSTTMIDFSSEIVVHGKPGSKIHLDDDLRAIAGGA 137

Query: 726 AY 731
            Y
Sbjct: 138 IY 139



>gb:AF492572_1804932 Argyroxiphium sandwicense subsp. macrocephalum
           clone AsBcopy2 GIA/RGA-like gibberellin response
           modulator (GAI-B) gene, partial cds.
          Length = 537

 Score = 90.1 bits (222), Expect = 5e-17
 Identities = 60/123 (48%), Positives = 72/123 (58%), Gaps = 14/123 (11%)
 Frame = +3

Query: 405 GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVD 584
           GMDELL VLGYKVK++DMA+VAQKLEQLE VM    G+D     S+TVHYNPSDLS WV 
Sbjct: 22  GMDELLEVLGYKVKSTDMADVAQKLEQLEMVM----GEDGVLQLSDTVHYNPSDLSGWVQ 77

Query: 585 SMISELNLGDP------FLSSQTESSSAITRNSTQIFDDSSFDS--------DLTAIPGK 722
           SM+S LN  +        LS  + ++     NS++I       S        DL AI G 
Sbjct: 78  SMLSVLNDNNTPPSDHIVLSGDSSTTMIDFSNSSEIVVHGKQGSKMHEDDPYDLRAIAGG 137

Query: 723 AAY 731
           A Y
Sbjct: 138 AIY 140



>gb:AF492567_1804927 Dubautia raillardioides clone DrBcopy
           GIA/RGA-like gibberellin response modulator (GAI-B)
           gene, partial cds.
          Length = 538

 Score = 89.7 bits (221), Expect = 7e-17
 Identities = 63/134 (47%), Positives = 75/134 (55%), Gaps = 15/134 (11%)
 Frame = +3

Query: 375 KMWEESEQDAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHY 554
           K+        GMDELL VLGYKVK++DMA+VAQKLEQLE VM    G+D     S+TVHY
Sbjct: 12  KITSSVPDSGGMDELLEVLGYKVKSTDMADVAQKLEQLEMVM----GEDGVLQLSDTVHY 67

Query: 555 NPSDLSSWVDSMISELN------LGDPFLSSQTESSSAIT-RNSTQIFDDSSFDS----- 698
           NPSDLS WV SM+S LN        D  + S   S++ I   NS++I       S     
Sbjct: 68  NPSDLSGWVQSMLSVLNDYNNTPPSDHIVLSGDSSTTMIDFSNSSEIVVHGKQGSKMHED 127

Query: 699 ---DLTAIPGKAAY 731
              DL AI G A Y
Sbjct: 128 DPYDLRAIAGGAIY 141



>gb:AF492562_1804922 Dubautia arborea clone DaBcopy1 GIA/RGA-like
           gibberellin response modulator (GAI-B) gene, partial
           cds.
          Length = 540

 Score = 89.7 bits (221), Expect = 7e-17
 Identities = 60/124 (48%), Positives = 72/124 (58%), Gaps = 15/124 (12%)
 Frame = +3

Query: 405 GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVD 584
           GMDELL VLGYKVK++DMA+VAQKLEQLE VM    G+D     S+TVHYNPSDLS WV 
Sbjct: 22  GMDELLEVLGYKVKSTDMADVAQKLEQLEMVM----GEDGVLQLSDTVHYNPSDLSGWVQ 77

Query: 585 SMISELNLGDP-------FLSSQTESSSAITRNSTQIFDDSSFDS--------DLTAIPG 719
           SM+S LN  +         LS  + ++     NS++I       S        DL AI G
Sbjct: 78  SMLSVLNENNNTPPSDHIVLSGDSSTTMIDFSNSSEIVVHGKQGSKMHEDDPYDLRAIAG 137

Query: 720 KAAY 731
            A Y
Sbjct: 138 GAIY 141



>gb:AF492587_1804946 Dubautia knudsenii clone DkAcopy1 GIA/RGA-like
           gibberellin response modulator (GAI) gene, partial cds.
          Length = 537

 Score = 89.4 bits (220), Expect = 9e-17
 Identities = 59/122 (48%), Positives = 71/122 (58%), Gaps = 13/122 (10%)
 Frame = +3

Query: 405 GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVD 584
           GMDELL VLGYKVK++DMA+VAQKLEQLE VMG    D +  L S+TVHYNPSDLS WV 
Sbjct: 17  GMDELLEVLGYKVKSTDMADVAQKLEQLEMVMGE---DGILQL-SDTVHYNPSDLSGWVQ 72

Query: 585 SMISELNLGDPFLSSQTESSSAITRNSTQIFDDSS-------------FDSDLTAIPGKA 725
           +M+  LN  +   +  +        +ST + D SS              D DL AI G A
Sbjct: 73  TMLLVLNDDNNNTADDSGHILLPGDSSTTMIDFSSEIVVHGKPGSKIHLDDDLRAIAGGA 132

Query: 726 AY 731
            Y
Sbjct: 133 IY 134



>gb:AF492577_1804936 Calycadenia multiglandulosa clone CLm1Comb
           GIA/RGA-like gibberellin response modulator (GAI) gene,
           partial cds.
          Length = 137

 Score = 89.4 bits (220), Expect = 9e-17
 Identities = 48/67 (71%), Positives = 54/67 (80%)
 Frame = +3

Query: 405 GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVD 584
           GMDELL VLGYKVK++DM +VAQKLEQLE VMG    D +  L S+TVHYNPSDLS WV 
Sbjct: 38  GMDELLEVLGYKVKSTDMDDVAQKLEQLEMVMGE---DGILQL-SDTVHYNPSDLSGWVQ 93

Query: 585 SMISELN 605
           SM+SELN
Sbjct: 94  SMLSELN 100



>gb:AF492571_1804931 Argyroxiphium sandwicense subsp. macrocephalum
           clone AsBcopy1 GIA/RGA-like gibberellin response
           modulator (GAI-B) gene, partial cds.
          Length = 538

 Score = 89.4 bits (220), Expect = 9e-17
 Identities = 60/124 (48%), Positives = 72/124 (58%), Gaps = 15/124 (12%)
 Frame = +3

Query: 405 GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVD 584
           GMDELL VLGYKVK++DMA+VAQKLEQLE VM    G+D     S+TVHYNPSDLS WV 
Sbjct: 22  GMDELLEVLGYKVKSTDMADVAQKLEQLEMVM----GEDGVLQLSDTVHYNPSDLSGWVQ 77

Query: 585 SMISELNLGDP-------FLSSQTESSSAITRNSTQIFDDSSFDS--------DLTAIPG 719
           SM+S LN  +         LS  + ++     NS++I       S        DL AI G
Sbjct: 78  SMLSVLNDNNNTPPSDHIVLSGDSSTTMIDFSNSSEIVVHGKQGSKMHEDDPYDLRAIAG 137

Query: 720 KAAY 731
            A Y
Sbjct: 138 GAIY 141



>gb:AF492570_1804930 Argyroxiphium kauense clone AkBcopy1n
           GIA/RGA-like gibberellin response modulator (GAI-B)
           gene, partial cds.
          Length = 538

 Score = 89.4 bits (220), Expect = 9e-17
 Identities = 60/124 (48%), Positives = 72/124 (58%), Gaps = 15/124 (12%)
 Frame = +3

Query: 405 GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVD 584
           GMDELL VLGYKVK++DMA+VAQKLEQLE VM    G+D     S+TVHYNPSDLS WV 
Sbjct: 22  GMDELLEVLGYKVKSTDMADVAQKLEQLEMVM----GEDGVLQLSDTVHYNPSDLSGWVQ 77

Query: 585 SMISELNLGDP-------FLSSQTESSSAITRNSTQIFDDSSFDS--------DLTAIPG 719
           SM+S LN  +         LS  + ++     NS++I       S        DL AI G
Sbjct: 78  SMLSVLNDNNNTPPSDHIVLSGDSSTTMIDFSNSSEIVVHGKQGSKMHEDDPYDLRAIAG 137

Query: 720 KAAY 731
            A Y
Sbjct: 138 GAIY 141



>gb:AF492568_1804928 Wilkesia gymnoxiphium clone WgBcopy2
           GIA/RGA-like gibberellin response modulator (GAI-B)
           gene, partial cds.>gb:AF492569_1804929 Wilkesia
           gymnoxiphium clone WgBcopy1 GIA/RGA-like gibberellin
           response modulator (GAI-B) gene, partial cds.
          Length = 538

 Score = 89.4 bits (220), Expect = 9e-17
 Identities = 60/124 (48%), Positives = 72/124 (58%), Gaps = 15/124 (12%)
 Frame = +3

Query: 405 GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVD 584
           GMDELL VLGYKVK++DMA+VAQKLEQLE VM    G+D     S+TVHYNPSDLS WV 
Sbjct: 22  GMDELLEVLGYKVKSTDMADVAQKLEQLEMVM----GEDGVLQLSDTVHYNPSDLSGWVQ 77

Query: 585 SMISELNLGDP-------FLSSQTESSSAITRNSTQIFDDSSFDS--------DLTAIPG 719
           SM+S LN  +         LS  + ++     NS++I       S        DL AI G
Sbjct: 78  SMLSVLNDNNNTPPSDHIVLSGDSSTTMIDFSNSSEIVVHGKQGSKMHEDDPYDLRAIAG 137

Query: 720 KAAY 731
            A Y
Sbjct: 138 GAIY 141



>gb:AF492582_1804941 Argyroxiphium sandwicense subsp. macrocephalum
           clone AsAcopy2 GIA/RGA-like gibberellin response
           modulator (GAI-A) gene, partial cds.
          Length = 541

 Score = 88.6 bits (218), Expect = 1e-16
 Identities = 61/124 (49%), Positives = 74/124 (59%), Gaps = 15/124 (12%)
 Frame = +3

Query: 405 GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVD 584
           GMDELL VLGYKVK++DMA+VAQKLEQLE VMG    D +  L S+TVHYNPSDLS WV 
Sbjct: 22  GMDELLEVLGYKVKSTDMADVAQKLEQLEMVMGE---DGILQL-SDTVHYNPSDLSGWVQ 77

Query: 585 SMISELNLGDPFLSSQTESSSAIT--RNSTQIFDDSS-------------FDSDLTAIPG 719
           SM+  LN  +   ++  +S   +    +ST + D SS              D DL AI G
Sbjct: 78  SMLLVLNDNN---NTAHDSGHILLPGDSSTTMIDFSSEIVVHGKPGSKIHLDDDLRAIAG 134

Query: 720 KAAY 731
            A Y
Sbjct: 135 GAIY 138



>gb:AF492573_1804933 Madia sativa clone MsCod1 GIA/RGA-like
           gibberellin response modulator (GAI) gene, partial cds.
          Length = 535

 Score = 88.2 bits (217), Expect = 2e-16
 Identities = 61/132 (46%), Positives = 77/132 (58%), Gaps = 23/132 (17%)
 Frame = +3

Query: 405 GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVD 584
           GMDELL VLGYKVK++DMA+VAQKLEQLE VM    G+D     S+TVHYNPSDLS WV 
Sbjct: 17  GMDELLEVLGYKVKSTDMADVAQKLEQLEMVM----GEDGVLQLSDTVHYNPSDLSGWVQ 72

Query: 585 SMISELN------LGD-----------------PFLSSQTESSSAITRNSTQIFDDSSFD 695
           SM+  LN      L D                  F SS+TE+ +   ++ +++ +D  + 
Sbjct: 73  SMLLVLNEDNNNTLDDDVSDHILLPGNSSTTMIDFSSSRTETVN--RKHGSKMLEDDPY- 129

Query: 696 SDLTAIPGKAAY 731
            DL AI G A Y
Sbjct: 130 -DLRAIAGGAIY 140



>gb:AF492589_1804948 Dubautia raillardioides clone DrAcopy1
           GIA/RGA-like gibberellin response modulator (GAI-A)
           gene, partial cds.
          Length = 539

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 58/124 (46%), Positives = 71/124 (57%), Gaps = 15/124 (12%)
 Frame = +3

Query: 405 GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVD 584
           GMDELL VLGYKVK++DMA+VAQKLEQLE VMG    D +  L S+TVHYNPSDLS WV 
Sbjct: 17  GMDELLEVLGYKVKSTDMADVAQKLEQLEMVMGE---DGILQL-SDTVHYNPSDLSGWVQ 72

Query: 585 SMISELNLGDPFLSSQTESSSAITRNSTQIFDDSS---------------FDSDLTAIPG 719
           +M+  LN  +   +  +        +ST + D S+                D DL AI G
Sbjct: 73  TMLLVLNDDNNTTADDSGHILLPGDSSTTMIDFSNSSETVVHGKPGSKIHLDDDLRAIAG 132

Query: 720 KAAY 731
            A Y
Sbjct: 133 GAIY 136



>gb:AF492588_1804947 Dubautia menziesii clone DmeAcopy1 GIA/RGA-like
           gibberellin response modulator (GAI-A) gene, partial
           cds.
          Length = 537

 Score = 87.8 bits (216), Expect = 3e-16
 Identities = 59/122 (48%), Positives = 70/122 (57%), Gaps = 13/122 (10%)
 Frame = +3

Query: 405 GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVD 584
           GMD LL VLGYKVK++DMA+VAQKLEQLE VMG    D +  L S+TVHYNPSDLS WV 
Sbjct: 17  GMDVLLEVLGYKVKSTDMADVAQKLEQLEMVMGE---DGILQL-SDTVHYNPSDLSGWVQ 72

Query: 585 SMISELNLGDPFLSSQTESSSAITRNSTQIFDDSS-------------FDSDLTAIPGKA 725
           SM+  LN  +   +  +        +ST + D SS              D DL AI G A
Sbjct: 73  SMLLVLNDNNNNTAHDSGHILLPGDSSTTMIDFSSEIVVHGKPGSKIHLDDDLRAIAGGA 132

Query: 726 AY 731
            Y
Sbjct: 133 IY 134



>gb:AF492585_1804944 Dubautia arborea clone DaAcopyPro GIA/RGA-like
           gibberellin response modulator (GAI-A) gene, partial
           cds.
          Length = 136

 Score = 86.7 bits (213), Expect = 6e-16
 Identities = 47/67 (70%), Positives = 53/67 (79%)
 Frame = +3

Query: 405 GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVD 584
           GMDELL VLGYKVK++DMA+VAQKLEQLE VMG    D +  L S+TVHYNPSDLS WV 
Sbjct: 22  GMDELLEVLGYKVKSTDMADVAQKLEQLEMVMGE---DGILQL-SDTVHYNPSDLSGWVQ 77

Query: 585 SMISELN 605
           SM+  LN
Sbjct: 78  SMLLVLN 84



>gb:AF492576_1804935 Carlquistia muirii clone Cm2 GIA/RGA-like
           gibberellin response modulator (GAI) gene, partial cds.
          Length = 548

 Score = 86.3 bits (212), Expect = 7e-16
 Identities = 46/67 (68%), Positives = 52/67 (77%)
 Frame = +3

Query: 405 GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVD 584
           GMDELL VLGYKVK++DMA+VAQKLEQLE VM    G+D     S+TVHYNPSDLS WV 
Sbjct: 22  GMDELLEVLGYKVKSTDMADVAQKLEQLEMVM----GEDGVLQLSDTVHYNPSDLSGWVQ 77

Query: 585 SMISELN 605
           SM+  LN
Sbjct: 78  SMLLVLN 84



>gb:AF492575_1804934 Carlquistia muirii clone Cm1 GIA/RGA-like
           gibberellin response modulator (GAI) gene, partial cds.
          Length = 548

 Score = 86.3 bits (212), Expect = 7e-16
 Identities = 46/67 (68%), Positives = 52/67 (77%)
 Frame = +3

Query: 405 GMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVD 584
           GMDELL VLGYKVK++DMA+VAQKLEQLE VM    G+D     S+TVHYNPSDLS WV 
Sbjct: 22  GMDELLEVLGYKVKSTDMADVAQKLEQLEMVM----GEDGVLQLSDTVHYNPSDLSGWVQ 77

Query: 585 SMISELN 605
           SM+  LN
Sbjct: 78  SMLLVLN 84



>pir|T51475|T51475 RGA-like protein - Arabidopsis
           thaliana>gb:ATK3M16_1553522 Arabidopsis thaliana DNA
           chromosome 5, BAC clone K3M16 (ESSA
           project).>gb:BT005905_1638827 Arabidopsis thaliana
           At5g17490 gene, complete cds.>gb:AK117226_1815271
           Arabidopsis thaliana At5g17490 mRNA for RGA-like
           protein, complete cds, clone: RAFL16-78-A02.
          Length = 523

 Score = 84.7 bits (208), Expect = 2e-15
 Identities = 43/69 (62%), Positives = 53/69 (76%)
 Frame = +3

Query: 399 DAGMDELLAVLGYKVKASDMAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSW 578
           D  MDE LAVLGYKV++SDMA+VAQKLEQLE V+ +      S+  ++TVHYNPSDLS W
Sbjct: 30  DDNMDEFLAVLGYKVRSSDMADVAQKLEQLEMVLSNDIASS-SNAFNDTVHYNPSDLSGW 88

Query: 579 VDSMISELN 605
             SM+S+LN
Sbjct: 89  AQSMLSDLN 97



>gb:AY269089_1594029 Glycine max GAI2 mRNA, partial cds.
          Length = 222

 Score = 80.9 bits (198), Expect = 3e-14
 Identities = 48/95 (50%), Positives = 63/95 (66%), Gaps = 5/95 (5%)
 Frame = +3

Query: 471 QKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVDSMISELNLG-----DPFLSSQT 635
           QKLEQLE VMG  Q   +S LAS+TVHY+P+DL SWV SM++ELN       DP  S   
Sbjct: 1   QKLEQLEMVMGCAQEVGISHLASDTVHYDPTDLYSWVQSMLTELNSEPNNNLDP-SSFLM 59

Query: 636 ESSSAITRNSTQIFDDSSFDSDLTAIPGKAAYPQP 740
           ++++ I  ++  +F+D S + DL AIPG AAYP P
Sbjct: 60  DNNNNIINSTAPVFNDDS-EYDLRAIPGIAAYPPP 93



>gb:AY707921_1623845 Cucumis sativus gibberellin acid insensitive
           mRNA, partial cds.
          Length = 117

 Score = 80.5 bits (197), Expect = 4e-14
 Identities = 52/111 (46%), Positives = 67/111 (60%), Gaps = 21/111 (18%)
 Frame = +3

Query: 456 MAEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVDSMISELN---------- 605
           MAEVAQKLEQLEE M  VQ   LS LA +TVHYNPSDLS+W++SM++EL+          
Sbjct: 1   MAEVAQKLEQLEEAMCQVQDTGLSHLAFDTVHYNPSDLSTWLESMLTELHPMPNFATPPP 60

Query: 606 ---LGDPFLSSQTESSSAIT-------RNSTQIFDD-SSFDSDLTAIPGKA 725
              L DP   +  ESS+  +       + S++IF++ SS D DL AI   A
Sbjct: 61  PSQLDDPSFLAPAESSTITSIDYDPQRQTSSRIFEESSSSDYDLKAITSSA 111



>gb:AY269088_1594028 Glycine max GAI1 mRNA, partial cds.
          Length = 181

 Score = 70.9 bits (172), Expect = 3e-11
 Identities = 45/99 (45%), Positives = 56/99 (56%), Gaps = 5/99 (5%)
 Frame = +3

Query: 480 EQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTESSSAITR 659
           E LEE MG+VQ DDL+ L+++ VHYNPSD+S+W+ +M+S     DP  S + E  SA   
Sbjct: 1   EHLEEAMGNVQ-DDLTDLSNDAVHYNPSDISNWLQTMLSNF---DPLPSEEPEKDSA--- 53

Query: 660 NSTQIFDDSSFDSDLTAIPGKAAY-----PQPPSKRFRT 761
                    S D DL AIPGKA Y       P  KR RT
Sbjct: 54  ---------SSDYDLKAIPGKAIYGGGSDALPNPKRVRT 83



>gb:AY163162_1585960 Arabidopsis thaliana CAX-interacting protein 4
           mRNA, complete cds.
          Length = 332

 Score = 34.3 bits (77), Expect = 3.3
 Identities = 21/81 (25%), Positives = 42/81 (51%)
 Frame = +3

Query: 459 AEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTE 638
           A V   LE++   +G  + +++SS   E    + SD+ S ++ +I+E   G     S  +
Sbjct: 115 AAVLSGLEKIRRGVGKGEVEEVSSEEEEESESSDSDVDSEMERIIAE-RFGKKKGGSSVK 173

Query: 639 SSSAITRNSTQIFDDSSFDSD 701
            +S++ +   ++ D+S  DSD
Sbjct: 174 KTSSVRKKKKRVSDESDSDSD 194



>gb:AY088773_1573785 Arabidopsis thaliana clone 948 mRNA, complete
           sequence.
          Length = 332

 Score = 34.3 bits (77), Expect = 3.3
 Identities = 21/81 (25%), Positives = 42/81 (51%)
 Frame = +3

Query: 459 AEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTE 638
           A V   LE++   +G  + +++SS   E    + SD+ S ++ +I+E   G     S  +
Sbjct: 115 AAVLSGLEKIRRGVGKGEVEEVSSEEEEESESSDSDVDSEMERIIAE-RFGKKKGGSSVK 173

Query: 639 SSSAITRNSTQIFDDSSFDSD 701
            +S++ +   ++ D+S  DSD
Sbjct: 174 KTSSVRKKKKRVSDESDSDSD 194



>pir|D84690|D84690 hypothetical protein At2g28910 [imported] -
           Arabidopsis thaliana>gb:AC005727_1532981 Arabidopsis
           thaliana chromosome 2 clone F8N16 map mi54, complete
           sequence.>gb:AY142061_1582898 Arabidopsis thaliana
           At2g28910/F8N16.20 mRNA, complete
           cds.>gb:AF428457_1799387 Arabidopsis thaliana
           At2g28910/F8N16.20 mRNA, complete cds.
          Length = 332

 Score = 34.3 bits (77), Expect = 3.3
 Identities = 21/81 (25%), Positives = 42/81 (51%)
 Frame = +3

Query: 459 AEVAQKLEQLEEVMGSVQGDDLSSLASETVHYNPSDLSSWVDSMISELNLGDPFLSSQTE 638
           A V   LE++   +G  + +++SS   E    + SD+ S ++ +I+E   G     S  +
Sbjct: 115 AAVLSGLEKIRRGVGKGEVEEVSSEEEEESESSDSDVDSEMERIIAE-RFGKKKGGSSVK 173

Query: 639 SSSAITRNSTQIFDDSSFDSD 701
            +S++ +   ++ D+S  DSD
Sbjct: 174 KTSSVRKKKKRVSDESDSDSD 194



>gb:AE017346_1757539 Cryptococcus neoformans var. neoformans JEC21
           chromosome 6, complete sequence.
          Length = 598

 Score = 33.1 bits (74), Expect = 7.3
 Identities = 22/54 (40%), Positives = 28/54 (51%)
 Frame = -2

Query: 648 RRRIRFGTTKTGRPG*ARKSWSPPRRRDPTGCNEPSPTPSSTGRLPERSPSLPL 487
           RRR  +  + + R   A +S SPPR R P     PSP+P S  R   RSP  P+
Sbjct: 424 RRRTAYDRSSSPRRRYASRSRSPPRHRHP-----PSPSPKS--RSISRSPPAPV 470



>sp|Q7M443|CHI2_TULBA Chitinase 2 (EC 3.2.1.14) (Tulip bulb
           chitinase-2) (TBC-2).>pir|JE0184|JE0184 chitinase (EC
           3.2.1.14) 2 - cone shell (Conus tulipa)
          Length = 275

 Score = 33.1 bits (74), Expect = 7.3
 Identities = 13/26 (50%), Positives = 19/26 (73%)
 Frame = +3

Query: 525 SSLASETVHYNPSDLSSWVDSMISEL 602
           +S+  E V +NPS +SSWVD+ +S L
Sbjct: 83  NSVGGERVFFNPSSVSSWVDNAVSSL 108



>gb:AY194047_2307910 HIV-1 isolate UGMED5 from Uganda tat protein
           (tat) gene, partial cds.
          Length = 86

 Score = 32.7 bits (73), Expect = 9.6
 Identities = 14/36 (38%), Positives = 16/36 (44%)
 Frame = -2

Query: 597 RKSWSPPRRRDPTGCNEPSPTPSSTGRLPERSPSLP 490
           RK W P RR  P G N   P P+     P   P+ P
Sbjct: 49  RKKWRPRRRSHPDGPNHQDPIPNQPSSQPRGDPTGP 84


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 602,918,826
Number of Sequences: 1806583
Number of extensions: 9655622
Number of successful extensions: 36757
Number of sequences better than 10.0: 75
Number of HSP's better than 10.0 without gapping: 33809
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 36511
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 61201187793
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)