BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig5391
         (809 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY140009_1582450 Arabidopsis thaliana expressed protein (At3g...    32   0.006   
gb:AB023041_1515454 Arabidopsis thaliana genomic DNA, chromosome...    32   0.006   
sp|P40021|YEM3_YEAST|YEM3_YEAST Hypothetical 119.3 kDa protein in PIP1-GLN3...    35   2.2     Saccharomyces cerevisiae [brewer's yeast]
gb:AF170726_2207831 Myxoma virus strain Lausanne, complete genome.     33   6.4     
gb:TC1604_1399514 T.cruzi FL-160-4 gene, partial 3'.                   33   8.3     
pir|PH1919|PH1919 FL-160-4 protein - Trypanosoma cruzi (fragment)      33   8.3     Trypanosoma cruzi


>gb:AY140009_1582450 Arabidopsis thaliana expressed protein
           (At3g26000) mRNA, complete cds.
          Length = 453

 Score = 32.3 bits (72), Expect(2) = 0.006
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 1/63 (1%)
 Frame = +2

Query: 227 INFQNRRFSEDRPDKNRDCFGKSWGLDCGKGNFQGNRKEEIRNASD-DVADLLPQDPFDM 403
           +NF +R FS    ++       +W   C   +F   RK    +AS  D+ D+LP DPF M
Sbjct: 3   LNFSHRPFSSHLSEEPMMIANGNW---CS--SFDNGRKNTGGDASSVDILDVLPSDPFGM 57

Query: 404 NID 412
           +I+
Sbjct: 58  DIN 60



 Score = 30.0 bits (66), Expect(2) = 0.006
 Identities = 35/136 (25%), Positives = 47/136 (34%), Gaps = 24/136 (17%)
 Frame = +3

Query: 465 QLFAGFDFVLNGSKRIHPESGAEKMNENSGVGAMDFGNGEFDGHVFSDCEMDET------ 626
           QLFAG  F  N + +          +     G+     G FDG +FS C+  E+      
Sbjct: 98  QLFAGLSFFWNNAMQFQ--------SSGYSYGSESLFGGAFDGSLFSTCKFPESSGENNG 149

Query: 627 ----MDFSYEKYWIF-----YDEI----NKRXXXXXXXXXXXXXXXXD-----ALPLALY 752
               +D     +  F      DE+    N R                D     A+   LY
Sbjct: 150 FGGALDGDGSCHGAFISASSVDEVLSHENARNGEVVGSSDRCNNGEEDAYVHPAIGFCLY 209

Query: 753 RLGVEDLLFVEQVCKS 800
            L  +DLL V  VCKS
Sbjct: 210 HLRGKDLLSVSMVCKS 225



>gb:AB023041_1515454 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MPE11.>gb:AY058077_1564216 Arabidopsis
           thaliana AT3g26000/MPE11_15 mRNA, complete
           cds.>gb:BT015945_1642563 Arabidopsis thaliana At3g26000
           mRNA, complete cds.
          Length = 453

 Score = 32.3 bits (72), Expect(2) = 0.006
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 1/63 (1%)
 Frame = +2

Query: 227 INFQNRRFSEDRPDKNRDCFGKSWGLDCGKGNFQGNRKEEIRNASD-DVADLLPQDPFDM 403
           +NF +R FS    ++       +W   C   +F   RK    +AS  D+ D+LP DPF M
Sbjct: 3   LNFSHRPFSSHLSEEPMMIANGNW---CS--SFDNGRKNTGGDASSVDILDVLPSDPFGM 57

Query: 404 NID 412
           +I+
Sbjct: 58  DIN 60



 Score = 30.0 bits (66), Expect(2) = 0.006
 Identities = 35/136 (25%), Positives = 47/136 (34%), Gaps = 24/136 (17%)
 Frame = +3

Query: 465 QLFAGFDFVLNGSKRIHPESGAEKMNENSGVGAMDFGNGEFDGHVFSDCEMDET------ 626
           QLFAG  F  N + +          +     G+     G FDG +FS C+  E+      
Sbjct: 98  QLFAGLSFFWNNAMQFQ--------SSGYSYGSESLFGGAFDGSLFSTCKFPESSGENNG 149

Query: 627 ----MDFSYEKYWIF-----YDEI----NKRXXXXXXXXXXXXXXXXD-----ALPLALY 752
               +D     +  F      DE+    N R                D     A+   LY
Sbjct: 150 FGGALDGDGSCHGAFISASSVDEVLSHENARNGEVVGSSDRCNNGEEDAYVHPAIGFCLY 209

Query: 753 RLGVEDLLFVEQVCKS 800
            L  +DLL V  VCKS
Sbjct: 210 HLRGKDLLSVSMVCKS 225



>sp|P40021|YEM3_YEAST Hypothetical 119.3 kDa protein in PIP1-GLN3
           intergenic region.>pir|S50536|S50536 hypothetical
           protein YER033c - yeast (Saccharomyces
           cerevisiae)>gb:SCE9379_1708081 Saccharomyces cerevisiae
           chromosome V cosmids 9379, 9581, and lambda clone 4678.
          Length = 1076

 Score = 34.7 bits (78), Expect = 2.2
 Identities = 15/33 (45%), Positives = 18/33 (54%)
 Frame = +2

Query: 320 NFQGNRKEEIRNASDDVADLLPQDPFDMNIDTI 418
           NF GN     + +SDD  D LP  P  MN D+I
Sbjct: 23  NFSGNTNNSSQRSSDDSLDFLPSTPSQMNYDSI 55



>gb:AF170726_2207831 Myxoma virus strain Lausanne, complete genome.
          Length = 215

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 2/55 (3%)
 Frame = +2

Query: 242 RRFSEDRPDKNRDCFGKSWGLDCGKGNFQGNRKEEIR--NASDDVADLLPQDPFD 400
           R  SE  PDK RD   K  G+D  K +   N ++ +R  NAS D+ +++    FD
Sbjct: 71  REISEILPDKERDALAKEIGIDLTKADDDPN-QDVVRNCNASSDINNVIDIQKFD 124



>gb:TC1604_1399514 T.cruzi FL-160-4 gene, partial 3'.
          Length = 641

 Score = 32.7 bits (73), Expect = 8.3
 Identities = 25/69 (36%), Positives = 31/69 (44%), Gaps = 6/69 (8%)
 Frame = +3

Query: 489 VLNGSKRI---HPESGAEKMNENSGVGAMDFGNGEF---DGHVFSDCEMDETMDFSYEKY 650
           + NGS+     H  +G E   +   V  MD+ NG F   DG    D E  E  D  YE Y
Sbjct: 222 IFNGSRLTLPAHENAGWEANTKYHVVLQMDYNNGLFVYVDGERICDTEDYEVED--YEDY 279

Query: 651 WIFYDEINK 677
             FYD + K
Sbjct: 280 KSFYDRLKK 288



>pir|PH1919|PH1919 FL-160-4 protein - Trypanosoma cruzi (fragment)
          Length = 641

 Score = 32.7 bits (73), Expect = 8.3
 Identities = 25/69 (36%), Positives = 31/69 (44%), Gaps = 6/69 (8%)
 Frame = +3

Query: 489 VLNGSKRI---HPESGAEKMNENSGVGAMDFGNGEF---DGHVFSDCEMDETMDFSYEKY 650
           + NGS+     H  +G E   +   V  MD+ NG F   DG    D E  E  D  YE Y
Sbjct: 222 IFNGSRLTLPAHENAGWEANTKYHVVLQMDYNNGLFVYVDGERICDTEDYEVED--YEDY 279

Query: 651 WIFYDEINK 677
             FYD + K
Sbjct: 280 KSFYDRLKK 288


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 869,267,850
Number of Sequences: 1806583
Number of extensions: 19490231
Number of successful extensions: 51538
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 48130
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 51497
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 53142682803
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)