BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig5372
         (896 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY227203_1591057 Lotus corniculatus aldehyde dehydrogenase 1 ...   384   e-105   
gb:AB084898_1524393 Sorghum bicolor ALDH2b mRNA for mitochondria...   382   e-105   
gb:AF269064_1782056 Zea mays T-cytoplasm male sterility restorer...   382   e-105   
pir|T03983|T03983 rf2 nuclear restorer protein - maize>gb:ZMU430...   382   e-105   Zea mays [maize]
gb:AF162665_1773537 Oryza sativa aldehyde dehydrogenase (Aldh) m...   379   e-104   
gb:AB044537_1520244 Oryza sativa (japonica cultivar-group) mRNA ...   379   e-104   
pir|T06683|T06683 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) T17F...   368   e-100   Arabidopsis thaliana [mouse-ear cress]
gb:AB055519_1521494 Hordeum vulgare mRNA for mitochondrial aldeh...   365   e-100   
pir|T02301|T02301 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 2A p...   364   1e-99   Nicotiana tabacum [American tobacco]
gb:AB084896_1524391 Secale cereale ALDH2b mRNA for mitochondrial...   363   2e-99   
gb:AF348416_1790093 Arabidopsis thaliana mitochondrial aldehyde ...   360   2e-98   
gb:AY035139_1559908 Arabidopsis thaliana putative aldehyde dehyd...   360   2e-98   
gb:AF465822S1_1802177 Allium cepa aldehyde dehydrogenase mRNA, p...   355   9e-97   
pir|C86372|C86372 hypothetical protein F5O8.35 [imported] - Arab...   349   5e-95   Arabidopsis thaliana [mouse-ear cress]
gb:AB084897_1524392 Sorghum bicolor ALDH2a mRNA for mitochondria...   347   2e-94   
gb:AF348417_1790094 Zea mays mitochondrial aldehyde dehydrogenas...   346   4e-94   
gb:AB030939_1518582 Oryza sativa (japonica cultivar-group) mRNA ...   343   3e-93   
gb:AP006627_562374 Bacillus clausii KSM-K16 DNA, complete genome.     241   2e-62   
sp|P20000|DHAM_BOVIN|DHAM_BOVIN Aldehyde dehydrogenase, mitochondrial precu...   241   2e-62   Bos taurus [bovine]
gb:AL135785_1918684 Human DNA sequence from clone RP11-113O24 on...   239   7e-62   
gb:BC081884_2108130 Rattus norvegicus aldehyde dehydrogenase 1 f...   238   2e-61   
gb:BT007781_2150713 Synthetic construct Homo sapiens aldehyde de...   237   2e-61   
gb:BC001619_1967717 Homo sapiens aldehyde dehydrogenase 1 family...   237   2e-61   
gb:CR860576_1184640 Pongo pygmaeus mRNA; cDNA DKFZp459D157 (from...   237   2e-61   
gb:BST458323_751290 Geobacillus stearothermophilus partial aldh ...   237   2e-61   
pir|A40872|A40872 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 5 pr...   237   2e-61   Homo sapiens [man]
gb:PSP417789_1702306 Polytomella sp. 'Pringsheim 198.80' mRNA fo...   236   4e-61   
pir|C83717|C83717 NADP-dependent aldehyde dehydrogenase dhaS [im...   236   4e-61   Bacillus halodurans
gb:AK012213_1156839 Mus musculus 11 days embryo whole body cDNA,...   236   6e-61   
gb:AF339837_2488543 Danio rerio retinaldehyde dehydrogenase type...   235   1e-60   
gb:BC075335_2558439 Xenopus tropicalis MGC89020 protein, mRNA (c...   233   3e-60   
gb:AF310252_2486808 Xenopus laevis RALDH2 mRNA, complete cds.         233   3e-60   
gb:AB015226_1864682 Homo sapiens mRNA for RALDH2, complete cds.       233   4e-60   
sp|O94788|DHA2_HUMAN|DHA2_HUMAN Aldehyde dehydrogenase 1A2 (EC 1.2.1.3) (Re...   233   4e-60   Homo sapiens [man]
sp|P30837|DHA5_HUMAN|DHA5_HUMAN Aldehyde dehydrogenase X, mitochondrial pre...   233   5e-60   Homo sapiens [man]
gb:AY621070_1957710 Homo sapiens mitochondrial aldehyde dehydrog...   232   6e-60   
gb:BT007942_2150874 Synthetic construct Homo sapiens aldehyde de...   232   8e-60   
gb:AY566469_2086589 Rattus norvegicus mitochondrial aldehyde deh...   232   8e-60   
gb:AY566468_2086588 Rattus norvegicus mitochondrial aldehyde deh...   232   8e-60   
gb:HUMALDH13_2029124 Human nucleus-encoded mitochondrial aldehyd...   232   8e-60   
gb:CR857362_1181605 Pongo pygmaeus mRNA; cDNA DKFZp469J1332 (fro...   232   8e-60   
sp|P47738|DHAM_MOUSE|DHAM_MOUSE Aldehyde dehydrogenase, mitochondrial precu...   232   8e-60   Mus musculus [mouse]
sp|P05091|DHAM_HUMAN|DHAM_HUMAN Aldehyde dehydrogenase, mitochondrial precu...   232   8e-60   Homo sapiens [man]
gb:AF315691_2487173 Danio rerio aldehyde dehydrogenase 1A2 mRNA,...   231   1e-59   
gb:AF288764_2485043 Danio rerio retinaldehyde dehydrogenase 2 (r...   231   1e-59   
gb:CR456991_1993198 Homo sapiens full open reading frame cDNA cl...   231   1e-59   
gb:BC077256_2559972 Xenopus laevis aldehyde dehydrogenase class ...   231   2e-59   
gb:AF061833_2471352 Xenopus laevis aldehyde dehydrogenase (ALDH1...   231   2e-59   
gb:AB016718_2460746 Xenopus laevis mRNA for aldehyde dehydrogena...   231   2e-59   
gb:AY566467_2086587 Rattus norvegicus mitochondrial aldehyde deh...   230   2e-59   
sp|P11884|DHAM_RAT|DHAM_RAT Aldehyde dehydrogenase, mitochondrial precurs...   230   2e-59   Rattus norvegicus [brown rat]
gb:BC077908_2560555 Xenopus laevis MGC80785 protein, mRNA (cDNA ...   230   3e-59   
gb:BX294151_770628 Pirellula sp. strain 1 complete genome; segme...   229   4e-59   
gb:BC087227_2565084 Xenopus laevis hypothetical LOC496110, mRNA ...   229   5e-59   
gb:BC075704_2106719 Mus musculus aldehyde dehydrogenase family 1...   229   5e-59   
gb:AF318139S1_1785597 Zea mays clone RXQ48.rev T cytoplasm male ...   229   5e-59   
sp|P81178|DHAM_MESAU|DHAM_MESAU Aldehyde dehydrogenase, mitochondrial (EC 1...   229   5e-59   Mesocricetus auratus [Syrian golden hamster]
sp|Q63639|DHA2_RAT|DHA2_RAT Aldehyde dehydrogenase 1A2 (EC 1.2.1.3) (Reti...   229   5e-59   Rattus norvegicus [brown rat]
sp|Q62148|DHA2_MOUSE|DHA2_MOUSE Aldehyde dehydrogenase 1A2 (EC 1.2.1.3) (Re...   229   5e-59   Mus musculus [mouse]
gb:AE017009_378445 Bacillus cereus ATCC 14579 section 12 of 18 o...   228   9e-59   
gb:AE017275_424773 Bacillus cereus ATCC 10987, section 12 of 18 ...   228   1e-58   
gb:AF348413_1790090 Zea mays cytosolic aldehyde dehydrogenase RF...   228   2e-58   
gb:AF348412_1790089 Zea mays cytosolic aldehyde dehydrogenase RF...   228   2e-58   
gb:AF529165_2067592 Rattus norvegicus mitochondrial aldehyde deh...   227   2e-58   
gb:AE017035_383607 Bacillus anthracis str. Ames section 12 of 18...   227   3e-58   
pir|S00364|S00364 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 2, m...   226   4e-58   Equus caballus [domestic horse]
sp|P12762|DHAM_HORSE|DHAM_HORSE Aldehyde dehydrogenase, mitochondrial (EC 1...   226   4e-58   Equus caballus [domestic horse]
gb:BC030589_1979857 Homo sapiens aldehyde dehydrogenase 1 family...   226   5e-58   
gb:AY398308_2531838 Danio rerio clone RK063A3D05 mitochondrial a...   225   8e-58   
gb:AE017273_424071 Bacillus cereus ATCC 10987, section 10 of 18 ...   225   8e-58   
gb:AF162770_2477781 Taeniopygia guttata class I aldehyde dehydro...   224   1e-57   
gb:AB037421_1519138 Oryza sativa (japonica cultivar-group) ALDH1...   224   1e-57   
sp|P27463|DHA1_CHICK|DHA1_CHICK Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Al...   224   1e-57   Gallus gallus [bantam]
gb:AP003617_1831493 Oryza sativa (japonica cultivar-group) genom...   224   2e-57   
gb:CSA549290_1673847 Crocus sativus mRNA for aldehyde dehydrogen...   224   2e-57   
sp|O93344|DHAS_CHICK|DHAS_CHICK Aldehyde dehydrogenase 1A2 (EC 1.2.1.3) (Re...   224   2e-57   Gallus gallus [bantam]
gb:AE017007_377739 Bacillus cereus ATCC 14579 section 10 of 18 o...   223   3e-57   
gb:AF003341_1875821 Homo sapiens aldehyde dehydrogenase 1 (ALDH1...   223   4e-57   
gb:BC076716_2559463 Xenopus laevis aldehyde dehydrogenase class ...   223   5e-57   
gb:S71509_2139106 Mus sp. aldehyde dehydrogenase AHD-M1 mRNA, co...   223   5e-57   
gb:AP003048_1824454 Oryza sativa (japonica cultivar-group) genom...   223   5e-57   
gb:AE017355_463892 Bacillus thuringiensis serovar konkukian str....   222   7e-57   
gb:AE017033_382905 Bacillus anthracis str. Ames section 10 of 18...   222   7e-57   
pir|JC5553|JC5553 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) - ra...   222   7e-57   Rattus norvegicus [brown rat]
sp|P51647|DHA1_RAT|DHA1_RAT Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Alde...   222   7e-57   Rattus norvegicus [brown rat]
gb:BT007808_2150740 Synthetic construct Homo sapiens aldehyde de...   222   9e-57   
gb:AL591031_1929964 Human DNA sequence from clone RP11-151D14 on...   222   9e-57   
gb:AL591031_1929963 Human DNA sequence from clone RP11-151D14 on...   222   9e-57   
pir|A33371|DEHUE1 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 1, c...   222   9e-57   
sp|P00352|DHA1_HUMAN|DHA1_HUMAN Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Al...   222   9e-57   Homo sapiens [man]
gb:CR860845_1184893 Pongo pygmaeus mRNA; cDNA DKFZp469B0514 (fro...   221   1e-56   
gb:AE017333_448092 Bacillus licheniformis DSM 13, complete genom...   221   1e-56   
gb:BC054386_2101670 Mus musculus aldehyde dehydrogenase family 1...   221   1e-56   
gb:BC044729_2099010 Mus musculus aldehyde dehydrogenase family 1...   221   1e-56   
gb:AP004888_1846660 Oryza sativa (japonica cultivar-group) genom...   221   1e-56   
sp|P24549|DHA1_MOUSE|DHA1_MOUSE Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Al...   221   1e-56   Mus musculus [mouse]
gb:BC055244_2551323 Danio rerio zgc:63786, mRNA (cDNA clone MGC:...   221   2e-56   
gb:AF260121_2483050 Danio rerio aldehyde dehydrogenase 2 precurs...   221   2e-56   
gb:CP000001_853165 Bacillus cereus ZK, complete genome.               220   3e-56   
gb:HSALDHI1_2010483 Human RNA for mitochondrial aldehyde dehydro...   220   3e-56   
gb:AF148508_1245135 Placopecten magellanicus aldehyde dehydrogen...   220   3e-56   
pir|JC4524|JC4524 aldehyde dehydrogenase [NAD(P)] (EC 1.2.1.5) -...   220   3e-56   Rattus norvegicus [brown rat]
gb:AF542418_1906474 Macaca fascicularis retinal dehydrogenase 1 ...   219   4e-56   
sp|Q8HYE4|DHA1_MACFA|DHA1_MACFA Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Al...   219   4e-56   Macaca fascicularis [crab eating macaque]
gb:HSALDHIR_2010484 Human mRNA for mitochondrial aldehyde dehydr...   219   7e-56   
sp|P15437|DHA1_HORSE|DHA1_HORSE Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Al...   218   1e-55   Equus caballus [domestic horse]
pir|JQ1004|JQ1004 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 1 pr...   218   1e-55   Mus musculus [mouse]
gb:AF348415_1790092 Zea mays cytosolic aldehyde dehydrogenase RF...   218   2e-55   
pir|S78582|S14752 aldehyde dehydrogenase (NAD) (EC 1.2.1.3), cyt...   217   3e-55   
sp|P51977|DHA1_SHEEP|DHA1_SHEEP Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Al...   217   3e-55   Ovis aries [domestic sheep]
gb:S75713_2139306 ahd-2=acetaldehyde dehydrogenase [mice, BALB/c...   216   4e-55   
gb:AE014134_1128355 Drosophila melanogaster chromosome 2L, compl...   216   4e-55   
gb:MMU96401_2124157 Mus musculus aldehyde dehydrogenase Ahd-2-li...   216   5e-55   
gb:BC046315_2099162 Mus musculus aldehyde dehydrogenase family 1...   216   5e-55   
pir|H69614|H69614 aldehyde dehydrogenase dhaS - Bacillus subtili...   216   5e-55   Bacillus subtilis
gb:BOVALDHYDA_1435150 Bos taurus aldehyde dehydrogenase mRNA, co...   215   1e-54   
sp|P48644|DHA1_BOVIN|DHA1_BOVIN Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Al...   215   1e-54   Bos taurus [bovine]
gb:U12966_1401766 Caenorhabditis elegans cosmid F54D8, complete ...   214   1e-54   
sp|Q8MI17|DHA1_RABIT|DHA1_RABIT Aldehyde dehydrogenase 1A1 (EC 1.2.1.3) (Al...   214   1e-54   Oryctolagus cuniculus [domestic rabbit]
gb:AY550122_1613293 Saussurea medusa cytosolic aldehyde dehydrog...   213   4e-54   
gb:BOR548846_1633873 Bixa orellana mRNA for aldehyde dehydrogena...   212   7e-54   
gb:AF152358_2477321 Gallus gallus aldehyde dehydrogenase-6 (ALDH...   209   4e-53   
gb:BC069274_1987897 Homo sapiens aldehyde dehydrogenase 1 family...   209   4e-53   
gb:AB020746_1514614 Arabidopsis thaliana genomic DNA, chromosome...   209   4e-53   
gb:AB176450_1411042 Oryctolagus cuniculus aldDH mRNA for aldehyd...   209   4e-53   
gb:PSP296087_161296 Pseudonocardia sp. K1 ORF y, thmS gene, thma...   209   4e-53   
pir|A32616|A32616 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) PB, ...   209   4e-53   Rattus norvegicus [brown rat]
sp|P13601|DHAC_RAT|DHAC_RAT Aldehyde dehydrogenase, cytosolic 1 (EC 1.2.1...   209   4e-53   Rattus norvegicus [brown rat]
sp|P47895|DHA6_HUMAN|DHA6_HUMAN Aldehyde dehydrogenase 6 (EC 1.2.1.5).>pir|...   209   4e-53   Homo sapiens [man]
gb:AL591031_1929965 Human DNA sequence from clone RP11-151D14 on...   209   8e-53   
gb:AF260125_1781465 Aspergillus nidulans aldehyde dehydrogenase ...   207   2e-52   
gb:AF260124_1781464 Aspergillus nidulans aldehyde dehydrogenase ...   207   2e-52   
gb:AF260123_1781463 Aspergillus nidulans aldehyde dehydrogenase ...   207   2e-52   
sp|Q29490|DHAE_MACPR|DHAE_MACPR Aldehyde dehydrogenase, cytosolic 1 (EC 1.2...   207   2e-52   Macroscelides proboscideus
gb:AF246711_2060468 Mus musculus retinaldehyde dehydrogenase 3 m...   206   4e-52   
gb:AF253409_2060655 Mus musculus retinaldehyde dehydrogenase 3 m...   206   6e-52   
gb:AF152359_2056754 Mus musculus aldehyde dehydrogenase-6 (Aldh6...   205   1e-51   
gb:AF434845_2065705 Rattus norvegicus aldehyde dehydrogenase 6 m...   204   1e-51   
sp|P08157|DHAL_EMENI|DHAL_EMENI Aldehyde dehydrogenase (EC 1.2.1.3) (ALDDH)...   203   3e-51   Aspergillus nidulans
sp|Q28399|DHAE_ELEED|DHAE_ELEED Aldehyde dehydrogenase, cytosolic 1 (EC 1.2...   203   4e-51   Elephantulus edwardii [Cape long-eared elephant shrew]
sp|Q27640|DHAL_ENCBU|DHAL_ENCBU Aldehyde dehydrogenase (EC 1.2.1.3) (Aldehy...   202   7e-51   Enchytraeus buchholzi
gb:AF106575_1241652 Caenorhabditis elegans cosmid K04F1, complet...   201   2e-50   
pir|A46725|A46725 omega-crystallin - giant octopus>gb:OCTOMEGCRY...   198   1e-49   Enteroctopus dofleini [giant octopus]
sp|P30841|CROM_OCTDO|CROM_OCTDO Omega-crystallin.                                198   1e-49   
gb:CR382129_1661437 Yarrowia lipolytica chromosome C of strain C...   197   2e-49   
sp|P41751|DHAL_ASPNG|DHAL_ASPNG Aldehyde dehydrogenase (EC 1.2.1.3) (ALDDH)...   197   3e-49   Aspergillus niger
gb:UMU74468_1726880 Ustilago maydis cytosolic indole-3-acetaldeh...   196   5e-49   
gb:BA000040_735867 Bradyrhizobium japonicum USDA 110 DNA, comple...   196   5e-49   
gb:CR382126_1658362 Kluyveromyces lactis strain NRRL Y-1140 chro...   195   9e-49   
gb:AE014297_1141634 Drosophila melanogaster chromosome 3R, compl...   193   3e-48   
gb:NCB11B23_1688984 Neurospora crassa DNA linkage group II BAC c...   192   7e-48   
gb:AF348414_1790091 Zea mays cytosolic aldehyde dehydrogenase RF...   192   1e-47   
gb:CR382123_1655809 Kluyveromyces lactis strain NRRL Y-1140 chro...   191   2e-47   
gb:AP006618_557598 Nocardia farcinica IFM 10152 DNA, complete ge...   191   2e-47   
gb:BC082822_2562898 Xenopus tropicalis hypothetical LOC496436, m...   190   3e-47   
gb:AY034137_2074207 Rattus norvegicus aldehyde dehydrogenase gen...   190   3e-47   
gb:PAU40996_1698911 Hansenula polymorpha aldehyde dehydrogenase ...   190   3e-47   
gb:AY249529_602362 Rhodococcus ruber aldh6-adh6 operon, complete...   190   3e-47   
gb:AE016816_1746648 Ashbya gossypii (= Eremothecium gossypii) AT...   190   4e-47   
pir|D88449|D88449 protein F54D8.3 [imported] - Caenorhabditis el...   189   5e-47   Caenorhabditis elegans [roundworm]
gb:AF275347_1782534 Cladosporium fulvum aldehyde dehydrogenase (...   188   1e-46   
gb:OMMOMEGCRY_1391246 Ommastrephes sloanei omega-crystallin gene...   187   2e-46   
sp|P30842|CROM_OMMSL|CROM_OMMSL Omega-crystallin.                                187   2e-46   Nototodarus sloanii [arrow squid]
gb:SCO939121_178585 Streptomyces coelicolor A3(2) complete genom...   187   3e-46   
gb:BC073490_2557326 Xenopus laevis MGC81015 protein, mRNA (cDNA ...   186   4e-46   
sp|Q25417|DHAM_LEITA|DHAM_LEITA Aldehyde dehydrogenase, mitochondrial precu...   186   4e-46   Leishmania tarentolae
gb:CR380956_1652119 Candida glabrata strain CBS138 chromosome J ...   186   7e-46   
gb:CR382131_1663463 Yarrowia lipolytica chromosome E of strain C...   185   9e-46   
gb:BA000040_732036 Bradyrhizobium japonicum USDA 110 DNA, comple...   184   2e-45   
sp|P46367|DHA4_YEAST|DHA4_YEAST Potassium-activated aldehyde dehydrogenase,...   184   2e-45   Saccharomyces cerevisiae [brewer's yeast]
gb:AE017346_1757528 Cryptococcus neoformans var. neoformans JEC2...   184   3e-45   
gb:BA000030_701233 Streptomyces avermitilis MA-4680 genomic DNA,...   184   3e-45   
gb:CR858605_1182772 Pongo pygmaeus mRNA; cDNA DKFZp469C068 (from...   183   3e-45   
gb:CR857124_1181376 Pongo pygmaeus mRNA; cDNA DKFZp469I2021 (fro...   183   3e-45   
gb:BC024055_2094353 Mus musculus formyltetrahydrofolate dehydrog...   183   4e-45   
sp|Q8R0Y6|FTDH_MOUSE|FTDH_MOUSE 10-formyltetrahydrofolate dehydrogenase (EC...   183   4e-45   Mus musculus [mouse]
gb:AB015227_1864683 Homo sapiens mRNA for RALDH2-T, complete cds...   182   6e-45   
gb:CR749807_1181269 Homo sapiens mRNA; cDNA DKFZp781N0997 (from ...   182   6e-45   
sp|O14293|YF19_SCHPO|YF19_SCHPO Hypothetical aldehyde-dehydrogenase like pr...   182   6e-45   Schizosaccharomyces pombe
sp|P28037|FTDH_RAT|FTDH_RAT 10-formyltetrahydrofolate dehydrogenase (EC 1...   182   8e-45   Rattus norvegicus [brown rat]
sp|O75891|FTDH_HUMAN|FTDH_HUMAN 10-formyltetrahydrofolate dehydrogenase (EC...   182   8e-45   Homo sapiens [man]
gb:BC089101_2110709 Rattus norvegicus formyltetrahydrofolate deh...   182   1e-44   
gb:BC034531_2097679 Mus musculus RIKEN cDNA D330038I09 gene, mRN...   181   2e-44   
gb:AK095827_1914446 Homo sapiens cDNA FLJ38508 fis, clone HCHON2...   180   3e-44   
gb:AX358538_1466223 Sequence 1 from Patent WO0200863.>gb:AX35854...   180   3e-44   
gb:BC026667_2095493 Mus musculus aldehyde dehydrogenase family 1...   180   4e-44   
pir|E95942|E95942 probable aldehyde dehydrogenase (NAD) (EC 1.2....   180   4e-44   Sinorhizobium meliloti
pir|S50576|S50576 probable aldehyde dehydrogenase (NAD) (EC 1.2....   179   8e-44   Saccharomyces cerevisiae [brewer's yeast]
gb:CR382139_1673028 Debaryomyces hansenii chromosome G of strain...   178   1e-43   
gb:CR382132_1665124 Yarrowia lipolytica chromosome F of strain C...   178   1e-43   
gb:CR380950_1649933 Candida glabrata strain CBS138 chromosome D ...   177   2e-43   
pir|C87638|C87638 aldehyde dehydrogenase [imported] - Caulobacte...   177   3e-43   Caulobacter vibrioides
gb:AE016817_1747800 Ashbya gossypii (= Eremothecium gossypii) AT...   176   5e-43   
gb:AL646068_547038 Ralstonia solanacearum GMI1000 chromosome, co...   176   5e-43   
gb:CP000010_866804 Burkholderia mallei ATCC 23344 chromosome 1, ...   175   1e-42   
gb:BA000031_707237 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...   174   2e-42   
pir|C83122|C83122 probable aldehyde dehydrogenase PA4189 [import...   173   4e-42   Pseudomonas aeruginosa
gb:BX571965_789822 Burkholderia pseudomallei strain K96243, chro...   173   5e-42   
gb:AX196064_1463889 Sequence 136 from Patent WO0151639.               172   6e-42   
gb:CR382135_1667771 Debaryomyces hansenii chromosome C of strain...   172   8e-42   
gb:AY574278_629531 Ralstonia sp. SJ98 putative aldehyde dehydrog...   172   8e-42   
gb:AE005674_70887 Shigella flexneri 2a str. 301, complete genome.     172   8e-42   
gb:BA000040_734582 Bradyrhizobium japonicum USDA 110 DNA, comple...   171   1e-41   
gb:PSSTYCATA_161537 Pseudomonas sp. Y2 DNA for styrene catabolis...   171   1e-41   
pir|E90863|E90863 aldehyde dehydrogenase [imported] - Escherichi...   171   1e-41   Escherichia coli O157:H7
gb:PFSTYABCD_158058 P.fluorescens styA, styB, styC and styD genes.    171   2e-41   
gb:ECOALDHQ3_128037 E.coli (clones lambda-ht5.3b and pEco4.1) al...   171   2e-41   
sp|P23883|DHAL_ECOLI|DHAL_ECOLI Putative aldehyde dehydrogenase (EC 1.2.1.3...   171   2e-41   Escherichia coli [E. coli]
gb:CR857757_1181970 Pongo pygmaeus mRNA; cDNA DKFZp469L0729 (fro...   171   2e-41   
gb:AY596297_631726 Haloarcula marismortui ATCC 43049 chromosome ...   171   2e-41   
gb:AE016982_371245 Shigella flexneri 2a str. 2457T section 5 of ...   171   2e-41   
gb:BX571859_785001 Photorhabdus luminescens subsp. laumondii TTO...   170   3e-41   
pir|H83136|H83136 probable aldehyde dehydrogenase PA4073 [import...   170   3e-41   Pseudomonas aeruginosa
pir|C83617|C83617 probable aldehyde dehydrogenase PA0219 [import...   170   3e-41   Pseudomonas aeruginosa
gb:AE017354_458631 Legionella pneumophila subsp. pneumophila str...   170   4e-41   
gb:BX571966_793717 Burkholderia pseudomallei strain K96243, chro...   169   5e-41   
gb:AF416331_509260 Ruegeria sp. PR1b plasmid pSD25, complete seq...   169   7e-41   
gb:AE017352_1759755 Cryptococcus neoformans var. neoformans JEC2...   168   1e-40   
gb:AP006618_557615 Nocardia farcinica IFM 10152 DNA, complete ge...   168   1e-40   
pir|AC3043|AC3043 aldehyde dehydrogenase dhaL [imported] - Agrob...   168   1e-40   Agrobacterium tumefaciens
pir|A98243|A98243 probable aldehyde dehydrogenase PA4189 [import...   168   1e-40   Agrobacterium tumefaciens
pir|B95411|B95411 probable aldehyde [imported] - Sinorhizobium m...   168   1e-40   Sinorhizobium meliloti
sp|O74187|DHAL_AGABI|DHAL_AGABI Aldehyde dehydrogenase (EC 1.2.1.3) (ALDDH)...   168   1e-40   Agaricus bisporus [button mushroom]
gb:CP000002_858867 Bacillus licheniformis ATCC 14580, complete g...   167   2e-40   
gb:AE017333_449068 Bacillus licheniformis DSM 13, complete genome.    167   2e-40   
gb:CP000032_88254 Silicibacter pomeroyi DSS-3 plasmid megaplasmi...   167   2e-40   
pir|AE3153|AE3153 NADP-dependent aldehyde dehydrogenase Atu4849 ...   167   2e-40   Agrobacterium tumefaciens
pir|F98134|F98134 hypothetical protein AGR_L_75 [imported] - Agr...   167   2e-40   Agrobacterium tumefaciens
sp|P42041|DHAL_ALTAL|DHAL_ALTAL Aldehyde dehydrogenase (EC 1.2.1.3) (ALDDH)...   167   2e-40   Alternaria alternata
sp|P71016|DHAB_BACSU|DHAB_BACSU Betaine aldehyde dehydrogenase (EC 1.2.1.8)...   167   2e-40   Bacillus subtilis
sp|P40047|DHA5_YEAST|DHA5_YEAST Aldehyde dehydrogenase, mitochondrial precu...   167   2e-40   Saccharomyces cerevisiae [brewer's yeast]
gb:BT011186_1357793 Drosophila melanogaster RE12154 full insert ...   167   3e-40   
gb:AE014134_1130036 Drosophila melanogaster chromosome 2L, compl...   167   3e-40   
gb:BA000043_738577 Geobacillus kaustophilus HTA426 DNA, complete...   167   3e-40   
gb:AE016867_352465 Pseudomonas syringae pv. tomato str. DC3000 s...   167   3e-40   
gb:CR380952_1650556 Candida glabrata strain CBS138 chromosome F ...   167   3e-40   
gb:CR628336_110420 Legionella pneumophila str. Paris complete ge...   167   3e-40   
gb:BC067563_2554740 Danio rerio aldehyde dehydrogenase 2, mRNA (...   166   4e-40   
gb:CR382138_1670689 Debaryomyces hansenii chromosome F of strain...   166   4e-40   
gb:PPU24215_159570 Pseudomonas putida p-cymene catabolism (cym) ...   166   4e-40   
gb:CR382139_1672150 Debaryomyces hansenii chromosome G of strain...   166   6e-40   
gb:AF440524_511253 Pseudomonas aeruginosa strain SG17M genomic s...   166   7e-40   
gb:CR628337_113487 Legionella pneumophila str. Lens complete gen...   166   7e-40   
gb:AY437859_617604 Brachymonas petroleovorans cyclohexanone gene...   165   1e-39   
gb:U12966_1401767 Caenorhabditis elegans cosmid F54D8, complete ...   164   2e-39   
gb:AP006618_559173 Nocardia farcinica IFM 10152 DNA, complete ge...   164   2e-39   
pir|T50272|T50272 probable aldehyde dehydrogenase [imported] - f...   164   2e-39   Schizosaccharomyces pombe
gb:AY316747_608952 Rhizobium sp. NGR234 megaplasmid 2 contig 1, ...   164   2e-39   
gb:AE016787_332879 Pseudomonas putida KT2440 section 14 of 21 of...   164   3e-39   
gb:CP000032_87994 Silicibacter pomeroyi DSS-3 plasmid megaplasmi...   164   3e-39   
gb:BX640436_812610 Bordetella parapertussis strain 12822, comple...   163   4e-39   
gb:BX640412_804908 Bordetella pertussis strain Tohama I, complet...   163   4e-39   
gb:AP006618_559448 Nocardia farcinica IFM 10152 DNA, complete ge...   163   4e-39   
gb:PSP311159_161316 Pseudomonas sp. KIE171 species isopropylamin...   163   4e-39   
gb:CR382124_1656769 Kluyveromyces lactis strain NRRL Y-1140 chro...   163   5e-39   
gb:AE016793_334657 Pseudomonas putida KT2440 section 20 of 21 of...   162   6e-39   
gb:AE016783_332011 Pseudomonas putida KT2440 section 10 of 21 of...   162   6e-39   
gb:CR382130_1662634 Yarrowia lipolytica chromosome D of strain C...   162   8e-39   
gb:AF323606_500550 Rhodococcus erythropolis picric acid degradat...   162   8e-39   
gb:BA000043_739605 Geobacillus kaustophilus HTA426 DNA, complete...   161   1e-38   
pir|PD0017|PD0017 fertility restore protein RF2 - rice (fragment)     161   1e-38   Oryza sativa [red rice]
gb:BA000043_738614 Geobacillus kaustophilus HTA426 DNA, complete...   160   2e-38   
pir|S70189|S54615 aldehyde dehydrogenase [NAD(P)] (EC 1.2.1.5) 2...   160   2e-38   
sp|P47771|DHA2_YEAST|DHA2_YEAST Aldehyde dehydrogenase [NAD(P)+] 1 (EC 1.2....   160   2e-38   Saccharomyces cerevisiae [brewer's yeast]
gb:AB016717_2460745 Xenopus laevis mRNA for aldehyde dehydrogena...   160   4e-38   
gb:CP000002_859555 Bacillus licheniformis ATCC 14580, complete g...   160   4e-38   
gb:AE017333_449769 Bacillus licheniformis DSM 13, complete genome.    160   4e-38   
gb:SCU56604_1710509 Saccharomyces cerevisiae cytosolic aldehyde ...   159   5e-38   
gb:BX640445_815294 Bordetella bronchiseptica strain RB50, comple...   159   9e-38   
gb:AL646073_548056 Ralstonia solanacearum GMI1000 chromosome, co...   159   9e-38   
pir|AG2849|AG2849 aldehyde dehydrogenase aldA [imported] - Agrob...   157   3e-37   Agrobacterium tumefaciens
pir|E97626|E97626 chloroacetaldehyde dehydrogenase (AF029733) [i...   157   3e-37   Agrobacterium tumefaciens
gb:BX640427_809823 Bordetella parapertussis strain 12822, comple...   157   3e-37   
gb:BC068965_2555457 Xenopus laevis hypothetical protein LOC41458...   156   6e-37   
gb:HUMALDH2_2029127 Human aldehyde dehydrogenase 2 mRNA.>gb:HUMA...   156   6e-37   
gb:CR380954_1651278 Candida glabrata strain CBS138 chromosome H ...   156   6e-37   
gb:AY596298_634762 Haloarcula marismortui ATCC 43049 chromosome ...   156   6e-37   
gb:SSP277295_190765 Sphingomonas sp. LB126 fluorene and protocat...   156   6e-37   
pir|S60929|S60929 probable aldehyde dehydrogenase (NAD) (EC 1.2....   156   6e-37   Saccharomyces cerevisiae [brewer's yeast]
sp|P54115|DHA6_YEAST|DHA6_YEAST Magnesium-activated aldehyde dehydrogenase,...   156   6e-37   
gb:BA000043_739349 Geobacillus kaustophilus HTA426 DNA, complete...   155   8e-37   
pir|B87693|B87693 aldehyde dehydrogenase B [imported] - Caulobac...   155   8e-37   
gb:AP006627_563303 Bacillus clausii KSM-K16 DNA, complete genome.     155   1e-36   
gb:CR382125_1658255 Kluyveromyces lactis strain NRRL Y-1140 chro...   155   1e-36   
gb:AF029733_470670 Xanthobacter autotrophicus linear plasmid pXA...   155   1e-36   
pir|T20866|T20866 hypothetical protein F36H1.6 - Caenorhabditis ...   155   1e-36   
gb:BA000043_737307 Geobacillus kaustophilus HTA426 DNA, complete...   154   2e-36   
sp|P32872|DHAY_YEAST|DHAY_YEAST Aldehyde dehydrogenase 2, mitochondrial pre...   154   2e-36   
gb:AE016917_356980 Chromobacterium violaceum ATCC 12472 section ...   154   2e-36   
sp|P54114|DHA3_YEAST|DHA3_YEAST Aldehyde dehydrogenase [NAD(P)+] 2 (EC 1.2....   154   2e-36   
gb:AE017271_423374 Bacillus cereus ATCC 10987, section 8 of 18 o...   154   3e-36   
gb:BA000012_667762 Mesorhizobium loti MAFF303099 DNA, complete g...   153   5e-36   
gb:AE016914_356183 Chromobacterium violaceum ATCC 12472 section ...   153   5e-36   
gb:AE016865_352087 Pseudomonas syringae pv. tomato str. DC3000 s...   153   5e-36   
gb:CP000031_86716 Silicibacter pomeroyi DSS-3, complete genome.       153   5e-36   
sp|P40108|DHAL_CLAHE|DHAL_CLAHE Aldehyde dehydrogenase (EC 1.2.1.3) (ALDDH)...   153   5e-36   
gb:CR543861_104403 Acinetobacter sp. ADP1 complete genome.            152   6e-36   
gb:AE016787_333060 Pseudomonas putida KT2440 section 14 of 21 of...   152   8e-36   
gb:AE016776_329986 Pseudomonas putida KT2440 section 3 of 21 of ...   152   8e-36   
gb:AE014291_307661 Brucella suis 1330 chromosome I, complete seq...   152   1e-35   
pir|AE3470|AE3470 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) [imp...   152   1e-35   
gb:BA000040_733044 Bradyrhizobium japonicum USDA 110 DNA, comple...   151   1e-35   
gb:AL646069_547278 Ralstonia solanacearum GMI1000 chromosome, co...   151   1e-35   
gb:AF277380_494807 Azotobacter vinelandii aldehyde dehydrogenase...   151   1e-35   
gb:AE015880_318784 Shewanella oneidensis MR-1 section 429 of 457...   151   1e-35   
gb:BX640430_810674 Bordetella parapertussis strain 12822, comple...   151   2e-35   
gb:AY328003S2_609759 Symbiont bacterium of Paederus fuscipes put...   151   2e-35   
gb:AF425233_509770 Yersinia pseudotuberculosis putative Na+/H+ a...   151   2e-35   
gb:AF335466_502483 Yersinia pseudotuberculosis strain AH superan...   151   2e-35   
gb:AF068264_475632 Pseudomonas aeruginosa quinoprotein ethanol d...   151   2e-35   
gb:AF009415_468222 Staphylococcus xylosus choline transporter (c...   151   2e-35   
pir|F83142|F83142 probable aldehyde dehydrogenase PA4022 [import...   151   2e-35   
gb:CP000011_868215 Burkholderia mallei ATCC 23344 chromosome 2, ...   150   2e-35   
gb:BX571966_794613 Burkholderia pseudomallei strain K96243, chro...   150   2e-35   
gb:BX248360_763372 Corynebacterium diphtheriae gravis NCTC13129,...   150   2e-35   
gb:AE016856_349558 Pseudomonas syringae pv. tomato str. DC3000 s...   150   2e-35   
gb:BA000038_725429 Vibrio vulnificus YJ016 DNA, chromosome II, c...   150   3e-35   
gb:BA000031_707163 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...   150   3e-35   
gb:AF418982_509587 Yersinia pseudotuberculosis strain 487/90 sup...   150   3e-35   
gb:AE016811_338581 Vibrio vulnificus CMCP6 chromosome II section...   150   3e-35   
gb:AE015786_317828 Shewanella oneidensis MR-1 section 335 of 457...   150   3e-35   
gb:AE017303_436233 Thermus thermophilus HB27 section 3 of 7 of t...   150   4e-35   
gb:AB047106_7074 Bacillus thermoleovorans Bt-adh, Bt-aldh, ORF-X...   150   4e-35   
gb:AE017344_1756162 Cryptococcus neoformans var. neoformans JEC2...   149   5e-35   
gb:AF284553_495613 Halomonas salina NAD+-dependent aldehyde dehy...   149   5e-35   
gb:AF031161_470949 Pseudomonas sp. VLB120 styrene degradation ge...   149   5e-35   
gb:AE017241_414657 Mycobacterium avium subsp. paratuberculosis s...   149   5e-35   
gb:AE011636_275092 Xanthomonas axonopodis pv. citri str. 306, se...   149   5e-35   
pir|H83396|H83396 probable aldehyde dehydrogenase PA1984 [import...   149   5e-35   
pir|B82981|B82981 probable aldehyde dehydrogenase PA5312 [import...   149   5e-35   
gb:CP000011_868595 Burkholderia mallei ATCC 23344 chromosome 2, ...   149   7e-35   
gb:BX640417_806704 Bordetella pertussis strain Tohama I, complet...   149   7e-35   
gb:BX571966_794118 Burkholderia pseudomallei strain K96243, chro...   149   7e-35   
pir|A83735|A83735 aldehyde dehydrogenase aldA [imported] - Bacil...   149   7e-35   
pir|H83131|H83131 5-carboxy-2-hydroxymuconate semialdehyde dehyd...   149   7e-35   
gb:BA000012_671178 Mesorhizobium loti MAFF303099 DNA, complete g...   149   9e-35   
gb:BA000012_669648 Mesorhizobium loti MAFF303099 DNA, complete g...   149   9e-35   
gb:CP000026_76552 Salmonella enterica subsp. enterica serovar Pa...   149   9e-35   
gb:AE016819_1748637 Ashbya gossypii (= Eremothecium gossypii) AT...   148   1e-34   
gb:AF029734_470673 Xanthobacter autotrophicus transcriptional ac...   148   1e-34   
gb:AB009654_1433 Alteromonas sp. DNA for aldehyde dehydrogenase,...   148   1e-34   
gb:CP000031_87362 Silicibacter pomeroyi DSS-3, complete genome.       148   2e-34   
gb:AP006618_559391 Nocardia farcinica IFM 10152 DNA, complete ge...   147   2e-34   
sp|P19059|DMPC_PSEUF|DMPC_PSEUF 2-hydroxymuconic semialdehyde dehydrogenase...   147   2e-34   
gb:AF127374_481454 Streptomyces lavendulae LinA homolog, cytochr...   147   3e-34   
gb:CR543861_103937 Acinetobacter sp. ADP1 complete genome.            147   3e-34   
gb:AB003475_628 Deinococcus radiodurans gene for aldehyde dehydr...   147   3e-34   
pir|E95276|E95276 probable aldehyde [imported] - Sinorhizobium m...   147   3e-34   
pir|A82276|A82276 aldehyde dehydrogenase VC0819 [imported] - Vib...   147   3e-34   
sp|P23240|DHAL_VIBCH|DHAL_VIBCH Aldehyde dehydrogenase (EC 1.2.1.3).>pir|T0...   147   3e-34   
sp|Q9RYG9|DHAL_DEIRA|DHAL_DEIRA Aldehyde dehydrogenase (EC 1.2.1.3).>pir|H7...   147   3e-34   
gb:BX936398_835841 Yersinia pseudotuberculosis IP32953 genome, c...   147   4e-34   
gb:BX571965_790804 Burkholderia pseudomallei strain K96243, chro...   147   4e-34   
gb:BA000036_720523 Corynebacterium glutamicum ATCC 13032 DNA, co...   147   4e-34   
gb:BA000028_696921 Oceanobacillus iheyensis HTE831 DNA, complete...   147   4e-34   
gb:AE016779_330917 Pseudomonas putida KT2440 section 6 of 21 of ...   147   4e-34   
gb:CR555306_108026 Azoarcus sp. EbN1 complete genome.                 147   4e-34   
gb:AB112922_13821 Gordonia sp. TY-5 adh3 genes for alcohol dehyd...   147   4e-34   
pir|AD0143|AD0143 betaine aldehyde dehydrogenase (EC 1.2.1.8) [i...   147   4e-34   
gb:AE008870_245311 Salmonella typhimurium LT2, section 174 of 22...   146   5e-34   
gb:AE006189_216418 Pasteurella multocida subsp. multocida str. P...   146   5e-34   
gb:AB042203_6669 Acinetobacter sp. M-1 ald1 gene for aldehyde de...   146   5e-34   
gb:AB023640_3973 Petroleum-degrading bacterium HD-1 gene for ald...   146   5e-34   
pir|AF0977|AF0977 lactaldehyde dehydrogenase (EC 1.2.1.22) - Sal...   146   5e-34   
gb:AY056147_1563479 Arabidopsis thaliana putative succinic semia...   146   6e-34   
gb:AY294313_606775 Pseudomonas putida NahR (nahR), complete cds;...   146   6e-34   
gb:AF039534_472136 Pseuodmonas stutzeri transposase-like protein...   146   6e-34   
gb:AE017234_412789 Mycobacterium avium subsp. paratuberculosis s...   146   6e-34   
gb:AE016858_350182 Pseudomonas syringae pv. tomato str. DC3000 s...   146   6e-34   
gb:HEL238780_136883 Halomonas elongata betI, betB and betA genes...   146   6e-34   
gb:CP000026_78219 Salmonella enterica subsp. enterica serovar Pa...   146   6e-34   
gb:AE005674_73210 Shigella flexneri 2a str. 301, complete genome...   146   6e-34   
gb:AB001722_481 Pseudomonas stutzeri carbazole catabolic genes, ...   146   6e-34   
pir|A23709|A60560 formyltetrahydrofolate dehydrogenase (EC 1.5.1...   146   6e-34   
pir|S47809|S47809 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) aldB...   146   6e-34   
sp|Q9RJZ6|DHAL_STRCO|DHAL_STRCO Probable aldehyde dehydrogenase (EC 1.2.1.3...   146   6e-34   
sp|P37685|ALDB_ECOLI|ALDB_ECOLI Aldehyde dehydrogenase B (EC 1.2.1.22) (Lac...   146   6e-34   
gb:BX571966_793942 Burkholderia pseudomallei strain K96243, chro...   145   8e-34   
gb:BX571871_788594 Photorhabdus luminescens subsp. laumondii TTO...   145   8e-34   
gb:AP006840_567911 Symbiobacterium thermophilum DNA, complete ge...   145   8e-34   
gb:AE016768_328382 Escherichia coli CFT073 section 14 of 18 of t...   145   8e-34   
gb:AE012104_279376 Xanthomonas campestris pv. campestris str. AT...   145   8e-34   
gb:CP000031_84169 Silicibacter pomeroyi DSS-3, complete genome.       145   8e-34   
pir|AC3525|AC3525 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) [imp...   145   8e-34   
gb:BX571965_791432 Burkholderia pseudomallei strain K96243, chro...   145   1e-33   
gb:AY596298_634885 Haloarcula marismortui ATCC 43049 chromosome ...   145   1e-33   
gb:AY316746_608731 Rhizobium sp. NGR234 megaplasmid 2 contig 2, ...   145   1e-33   
gb:AE014292_310708 Brucella suis 1330 chromosome II, complete se...   145   1e-33   
gb:AE012458_282629 Xanthomonas campestris pv. campestris str. AT...   145   1e-33   
gb:ECU73857_134515 Escherichia coli chromosome minutes 6-8.           145   1e-33   
gb:ECOBETB_128179 E.coli betaine aldehyde dehydrogenase (betB) g...   145   1e-33   
gb:ECOBETB_128178 E.coli betaine aldehyde dehydrogenase (betB) g...   145   1e-33   
pir|B85524|B85524 NAD+-dependent betaine aldehyde dehydrogenase ...   145   1e-33   
pir|F90673|F90673 NAD+-dependent betaine aldehyde dehydrogenase ...   145   1e-33   
pir|S15181|S15181 betaine-aldehyde dehydrogenase (EC 1.2.1.8) - ...   145   1e-33   
sp|P17445|DHAB_ECOLI|DHAB_ECOLI Betaine aldehyde dehydrogenase (EC 1.2.1.8)...   145   1e-33   
gb:CP000011_868407 Burkholderia mallei ATCC 23344 chromosome 2, ...   145   1e-33   
gb:BX640439_813390 Bordetella bronchiseptica strain RB50, comple...   145   1e-33   
gb:AE016784_332102 Pseudomonas putida KT2440 section 11 of 21 of...   145   1e-33   
gb:AE016756_324482 Escherichia coli CFT073 section 2 of 18 of th...   145   1e-33   
pir|F82973|F82973 betaine aldehyde dehydrogenase PA5373 [importe...   145   1e-33   
pir|JW0056|JW0056 2-hydroxymuconic semialdehyde dehydrogenase (E...   145   1e-33   
gb:AY596298_634759 Haloarcula marismortui ATCC 43049 chromosome ...   144   2e-33   
gb:AP006627_564137 Bacillus clausii KSM-K16 DNA, complete genome.     144   2e-33   
gb:CR543861_102996 Acinetobacter sp. ADP1 complete genome.            144   2e-33   
gb:CR378676_97157 Photobacterium profundum SS9 chromosome 2; seg...   144   2e-33   
pir|G86033|G86033 aldehyde dehydrogenase B [similarity] - Escher...   144   2e-33   
gb:BX950851_840487 Erwinia carotovora subsp. atroseptica SCRI104...   144   3e-33   
gb:BA000030_705064 Streptomyces avermitilis MA-4680 genomic DNA,...   144   3e-33   
pir|F82152|F82152 aldehyde dehydrogenase VC1819 [imported] - Vib...   144   3e-33   
sp|O53743|DHAL_MYCTU|DHAL_MYCTU Probable aldehyde dehydrogenase (EC 1.2.1.3...   144   3e-33   
gb:BX571873_789140 Photorhabdus luminescens subsp. laumondii TTO...   143   4e-33   
gb:BX571856_782112 Staphylococcus aureus subsp. aureus strain MR...   143   4e-33   
gb:BA000043_739775 Geobacillus kaustophilus HTA426 DNA, complete...   143   4e-33   
gb:BA000028_697256 Oceanobacillus iheyensis HTE831 DNA, complete...   143   4e-33   
gb:AE016813_339333 Vibrio vulnificus CMCP6 chromosome II section...   143   4e-33   
gb:CP000046_92696 Staphylococcus aureus subsp. aureus COL, compl...   143   4e-33   
gb:AF491307_515650 Pseudomonas putida NCIB 9816-4 plasmid pDTG1,...   143   5e-33   
gb:AF346500_503282 Photorhabdus luminescens strain W14 toxin com...   143   5e-33   
gb:SME591790_186369 Sinorhizobium meliloti 1021 complete chromos...   143   5e-33   
gb:AE005674_73967 Shigella flexneri 2a str. 301, complete genome...   143   5e-33   
gb:AB085823_11261 Cytophaga sp. KUC-1 alddh gene for aldehyde de...   143   5e-33   
gb:BX950851_838851 Erwinia carotovora subsp. atroseptica SCRI104...   142   7e-33   
gb:BA000038_724595 Vibrio vulnificus YJ016 DNA, chromosome II, c...   142   7e-33   
pir|AI1188|AI1188 succinate semialdehyde dehydrogenase homolog l...   142   7e-33   
pir|E90068|E90068 glycine betaine aldehyde dehydrogenase gbsA [i...   142   7e-33   
gb:BX571862_785847 Photorhabdus luminescens subsp. laumondii TTO...   142   9e-33   
gb:AE016783_331913 Pseudomonas putida KT2440 section 10 of 21 of...   142   9e-33   
gb:SSU65001_191881 Sphingomonas sp. putative insertion sequence ...   142   9e-33   
gb:BX640417_806563 Bordetella pertussis strain Tohama I, complet...   142   1e-32   
gb:AB008831_1353 Acinetobacter sp. YAA genes for aniline dioxyge...   142   1e-32   
pir|G95315|G95315 probable [imported] - Sinorhizobium meliloti (...   142   1e-32   
gb:AF144422_483031 Salmonella dublin 4-hydroxyphenylacetate cata...   141   1e-32   
gb:SCO939121_178500 Streptomyces coelicolor A3(2) complete genom...   141   1e-32   
gb:EC4HPADNA_124770 E.coli hpa[G,R,E,D,F,H,I,X,A,B,C] genes.          141   1e-32   
pir|AI0214|AI0214 5-carboxymethyl-2-hydroxymuconate semialdehyde...   141   1e-32   
gb:BX936398_836283 Yersinia pseudotuberculosis IP32953 genome, c...   141   2e-32   
gb:BA000035_717406 Corynebacterium efficiens YS-314 DNA, complet...   141   2e-32   
gb:AY599747_635346 Pseudomonas sp. ST41 xyl lower (meta-cleavage...   141   2e-32   
gb:AE017246_415135 Treponema denticola ATCC 35405, section 1 of ...   140   3e-32   
gb:AB088043_11437 Pseudomonas fluorescens 3-hydroxyanthranilic a...   140   3e-32   
pir|AG3187|AG3187 aldehyde dehydrogenase dhaS [imported] - Agrob...   140   3e-32   
gb:AE017325_443365 Listeria monocytogenes str. 4b F2365, section...   140   3e-32   
gb:AE016751_323816 Staphylococcus epidermidis ATCC 12228, sectio...   140   3e-32   
gb:AE010557_264351 Fusobacterium nucleatum subsp. nucleatum ATCC...   140   3e-32   
gb:CP000029_82761 Staphylococcus epidermidis RP62A, complete gen...   140   3e-32   
gb:BX571856_779640 Staphylococcus aureus subsp. aureus strain MR...   140   4e-32   
gb:AF134348_482043 Pseudomonas putida plasmid pDK1 xyl lower (me...   140   4e-32   
gb:CR378680_98581 Photobacterium profundum SS9 chromosome 2; seg...   140   4e-32   
gb:CP000046_90333 Staphylococcus aureus subsp. aureus COL, compl...   140   4e-32   
pir|C89778|C89778 hypothetical protein aldA [imported] - Staphyl...   140   4e-32   
gb:CR382124_1656770 Kluyveromyces lactis strain NRRL Y-1140 chro...   139   6e-32   
gb:BX572596_800821 Rhodopseudomonas palustris CGA009 complete ge...   139   6e-32   
gb:AE016760_325881 Escherichia coli CFT073 section 6 of 18 of th...   139   6e-32   
gb:CR555306_106642 Azoarcus sp. EbN1 complete genome.                 139   6e-32   
gb:CR543861_103523 Acinetobacter sp. ADP1 complete genome.            139   6e-32   
pir|C83675|C83675 glycine betaine aldehyde dehydrogenase gbsA [i...   139   6e-32   
gb:BX640444_815037 Bordetella bronchiseptica strain RB50, comple...   139   7e-32   
gb:BX640427_809577 Bordetella parapertussis strain 12822, comple...   139   7e-32   
gb:BX571857_782354 Staphylococcus aureus strain MSSA476, complet...   139   7e-32   
gb:AE011120_269363 Methanosarcina acetivorans str. C2A, section ...   139   7e-32   
sp|P42269|HPCC_ECOLI|HPCC_ECOLI 5-carboxymethyl-2-hydroxymuconate semialdeh...   139   7e-32   
gb:AE016793_334442 Pseudomonas putida KT2440 section 20 of 21 of...   139   1e-31   
gb:AE011702_275679 Xanthomonas axonopodis pv. citri str. 306, se...   139   1e-31   
gb:AB011837_1851 Bacillus halodurans C-125 genomic DNA, clone AL...   139   1e-31   
gb:BX571965_793170 Burkholderia pseudomallei strain K96243, chro...   138   1e-31   
gb:BA000030_699509 Streptomyces avermitilis MA-4680 genomic DNA,...   138   1e-31   
pir|AI1546|AI1546 succinate semialdehyde dehydrogenase homolog l...   138   1e-31   
gb:BX248360_763455 Corynebacterium diphtheriae gravis NCTC13129,...   137   2e-31   
gb:BA000045_741579 Gloeobacter violaceus PCC 7421 DNA, complete ...   137   2e-31   
gb:AE016857_349897 Pseudomonas syringae pv. tomato str. DC3000 s...   137   2e-31   
gb:AE013309_291168 Methanosarcina mazei strain Goe1, section 91 ...   137   2e-31   
gb:AY052389_586916 Agrobacterium tumefaciens AttJ (attJ), AttK (...   137   3e-31   
gb:RSU17129_168268 Rhodococcus erythropolis ThcA (thcA) gene, co...   137   3e-31   
pir|G85733|G85733 probable aldehyde dehydrogenase Z2275 [importe...   137   3e-31   
sp|P77674|YDCW_ECOLI|YDCW_ECOLI Putative betaine aldehyde dehydrogenase (EC...   137   3e-31   
sp|P46369|THCA_RHOER|THCA_RHOER EPTC-inducible aldehyde dehydrogenase (EC 1...   137   3e-31   
gb:BA000043_737988 Geobacillus kaustophilus HTA426 DNA, complete...   137   4e-31   
gb:AY249530_602364 Rhodococcus ruber aldh7-adh7 operon, partial ...   137   4e-31   
gb:AE007885_231151 Agrobacterium tumefaciens str. C58 plasmid AT...   137   4e-31   
gb:U59485_205958 Agrobacterium tumefaciens AtrC (atrC) gene, par...   137   4e-31   
gb:SME591793_187320 Sinorhizobium meliloti 1021 complete chromos...   137   4e-31   
gb:ECMAO_126593 E.coli mao cluster for phenylethylamine catabolism.   137   4e-31   
gb:ECFEA_125593 Escherichia coli feaR & feaB genes.                   137   4e-31   
pir|AE3176|AE3176 NAD-dependent succinate aldehyde dehydrogenase...   137   4e-31   
pir|D64889|D64889 probable phenylacetaldehyde dehydrogenase (EC ...   137   4e-31   
sp|P80668|FEAB_ECOLI|FEAB_ECOLI Phenylacetaldehyde dehydrogenase (EC 1.2.1....   137   4e-31   
gb:AL646081_549260 Ralstonia solanacearum GMI1000 megaplasmid, c...   136   5e-31   
pir|E75574|E75574 aldehyde dehydrogenase - Deinococcus radiodura...   136   5e-31   
pir|T31272|T31272 4-carboxy-2-hydroxymuconate-6-semialdehyde deh...   136   5e-31   
pir|E96825|E96825 hypothetical protein T8K14.14 [imported] - Ara...   136   6e-31   
pir|T31265|T31265 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) - Sp...   135   8e-31   
gb:AE005674_71356 Shigella flexneri 2a str. 301, complete genome...   135   1e-30   
pir|AD2277|AD2277 aldehyde dehydrogenase [imported] - Nostoc sp....   135   1e-30   
gb:AB029044_4720 Comamonas testosteroni orfX, orfY, aphT, aphC, ...   135   1e-30   
pir|AE3077|AE3077 aldehyde dehydrogenase dhaS [imported] - Agrob...   135   1e-30   
sp|P46368|DHA2_ALCEU|DHA2_ALCEU Acetaldehyde dehydrogenase II (EC 1.2.1.3) ...   135   1e-30   
gb:BX294134_765371 Pirellula sp. strain 1 complete genome; segme...   134   2e-30   
gb:BA000032_709653 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...   134   2e-30   
gb:BA000030_701321 Streptomyces avermitilis MA-4680 genomic DNA,...   134   2e-30   


>gb:AY227203_1591057 Lotus corniculatus aldehyde dehydrogenase 1
           precursor (Aldh1) mRNA, complete cds; nuclear gene for
           mitochondrial product.
          Length = 542

 Score =  384 bits (987), Expect = e-105
 Identities = 181/226 (80%), Positives = 201/226 (88%)
 Frame = +3

Query: 219 GWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI 398
           GW+    +   R+STAA VEEL++P V + YTQH+INGKFVD+ASGKTFP  DPRT DVI
Sbjct: 35  GWR----NSNNRYSTAAVVEELITPQVSINYTQHLINGKFVDAASGKTFPAYDPRTGDVI 90

Query: 399 AHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWD 578
           AHVAEG+AED+NRAVAAARKAFDEGPWP+M+AYERSRI+L+FADLVEKH DE+A LETW+
Sbjct: 91  AHVAEGDAEDVNRAVAAARKAFDEGPWPRMTAYERSRILLRFADLVEKHNDEIAALETWN 150

Query: 579 NGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWN 758
           NGKPYEQAAK+E+P  VRLF YYAGWADKIHGLTVPADG +HVQTLHEPIGVAGQIIPWN
Sbjct: 151 NGKPYEQAAKAEVPTFVRLFRYYAGWADKIHGLTVPADGNYHVQTLHEPIGVAGQIIPWN 210

Query: 759 FPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           FPL MFAWKVGPALACGNT+VLKTAEQTPLTAL   KL HEAGLPP
Sbjct: 211 FPLLMFAWKVGPALACGNTIVLKTAEQTPLTALVVAKLLHEAGLPP 256



>gb:AB084898_1524393 Sorghum bicolor ALDH2b mRNA for mitochondrial
           aldehyde dehydrogenase, complete cds.
          Length = 547

 Score =  382 bits (981), Expect = e-105
 Identities = 180/216 (83%), Positives = 198/216 (91%)
 Frame = +3

Query: 246 IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE 425
           +QRFSTAAAVEE ++P+V+V YT+ +ING FVD+ASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct: 45  LQRFSTAAAVEEPITPSVQVNYTKLLINGNFVDAASGKTFPTLDPRTGEVIAHVAEGDAE 104

Query: 426 DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA 605
           DINRAVAAARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DELA LETWDNGKPYEQAA
Sbjct: 105 DINRAVAAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAA 164

Query: 606 KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK 785
             E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MFAWK
Sbjct: 165 HIEVPMVARLMRYYAGWADKIHGLVVPADGPHHVQILHEPIGVAGQIIPWNFPLLMFAWK 224

Query: 786 VGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
           VGPALACGNT+VLKTAEQTPL+ALY  KL HEAGLP
Sbjct: 225 VGPALACGNTLVLKTAEQTPLSALYISKLLHEAGLP 260



>gb:AF269064_1782056 Zea mays T-cytoplasm male sterility restorer
           factor 2 (rf2) mRNA, rf2-R213 allele, complete cds;
           nuclear gene for mitochondrial product.
          Length = 549

 Score =  382 bits (980), Expect = e-105
 Identities = 180/216 (83%), Positives = 198/216 (91%)
 Frame = +3

Query: 246 IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE 425
           +QRFSTAAAVEE ++P+V V YT+ +ING FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct: 47  LQRFSTAAAVEEPITPSVHVNYTKLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE 106

Query: 426 DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA 605
           DINRAVAAARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DELA LETWDNGKPYEQAA
Sbjct: 107 DINRAVAAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAA 166

Query: 606 KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK 785
           + E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL M+AWK
Sbjct: 167 QIEVPMVARLMRYYAGWADKIHGLIVPADGPHHVQILHEPIGVAGQIIPWNFPLLMYAWK 226

Query: 786 VGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
           VGPALACGNT+VLKTAEQTPL+ALY  KL HEAGLP
Sbjct: 227 VGPALACGNTLVLKTAEQTPLSALYISKLLHEAGLP 262



>pir|T03983|T03983 rf2 nuclear restorer protein -
           maize>gb:ZMU43082_1732147 Zea mays T cytoplasm male
           sterility restorer factor 2 (rf2) mRNA, complete
           cds.>gb:AF215823_1777950 Zea mays T cytoplasm male
           sterility restorer factor 2 (rf2a) gene, rf2a-B73
           allele, complete cds.
          Length = 549

 Score =  382 bits (980), Expect = e-105
 Identities = 180/216 (83%), Positives = 198/216 (91%)
 Frame = +3

Query: 246 IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE 425
           +QRFSTAAAVEE ++P+V V YT+ +ING FVDSASGKTFPTLDPRT +VIAHVAEG+AE
Sbjct: 47  LQRFSTAAAVEEPITPSVHVNYTKLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAE 106

Query: 426 DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA 605
           DINRAVAAARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DELA LETWDNGKPYEQAA
Sbjct: 107 DINRAVAAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDELAALETWDNGKPYEQAA 166

Query: 606 KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK 785
           + E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL M+AWK
Sbjct: 167 QIEVPMVARLMRYYAGWADKIHGLIVPADGPHHVQILHEPIGVAGQIIPWNFPLLMYAWK 226

Query: 786 VGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
           VGPALACGNT+VLKTAEQTPL+ALY  KL HEAGLP
Sbjct: 227 VGPALACGNTLVLKTAEQTPLSALYISKLLHEAGLP 262



>gb:AF162665_1773537 Oryza sativa aldehyde dehydrogenase (Aldh)
           mRNA, complete cds; nuclear gene for mitochondrial
           product.
          Length = 549

 Score =  379 bits (973), Expect = e-104
 Identities = 184/233 (78%), Positives = 202/233 (86%), Gaps = 1/233 (0%)
 Frame = +3

Query: 198 PSASAFLGWKYGVESGI-QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTL 374
           PSA        G+  GI QRFSTAA  EE +SP V+V YTQ +I+GKFVDSASGKTFPTL
Sbjct: 30  PSALRRADGTQGLLPGILQRFSTAAVAEEPISPPVQVNYTQLLIDGKFVDSASGKTFPTL 89

Query: 375 DPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDE 554
           DPRT ++IAHVAEG+AEDINRAV AARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DE
Sbjct: 90  DPRTGELIAHVAEGDAEDINRAVHAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDE 149

Query: 555 LATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGV 734
           +A LETWDNGKPY QAA+ E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGV
Sbjct: 150 IAALETWDNGKPYAQAAQIEVPMVARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGV 209

Query: 735 AGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
           AGQIIPWNFPL MFAWKVGPALACGNTVVLKTAEQTPL+AL+A KL HEAGLP
Sbjct: 210 AGQIIPWNFPLLMFAWKVGPALACGNTVVLKTAEQTPLSALFASKLLHEAGLP 262



>gb:AB044537_1520244 Oryza sativa (japonica cultivar-group) mRNA for
           aldehyde dehydrogenase ALDH2b, complete
           cds.>gb:AP005387_1850860 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 6, BAC
           clone:OSJNBa0084K06.
          Length = 549

 Score =  379 bits (972), Expect = e-104
 Identities = 184/233 (78%), Positives = 201/233 (86%), Gaps = 1/233 (0%)
 Frame = +3

Query: 198 PSASAFLGWKYGVESGI-QRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTL 374
           PSA        G+  GI QRFSTAA  EE +SP V+V YTQ +I+GKFVDSASGKTFPTL
Sbjct: 30  PSALRRADGTQGLLPGILQRFSTAAVAEEPISPPVQVNYTQLLIDGKFVDSASGKTFPTL 89

Query: 375 DPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDE 554
           DPRT ++IAHVAEG+AEDINRAV AARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DE
Sbjct: 90  DPRTGELIAHVAEGDAEDINRAVHAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDE 149

Query: 555 LATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGV 734
           +A LETWDNGKPY QAA  E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGV
Sbjct: 150 IAALETWDNGKPYAQAANIEVPMVARLMRYYAGWADKIHGLVVPADGPHHVQVLHEPIGV 209

Query: 735 AGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
           AGQIIPWNFPL MFAWKVGPALACGNTVVLKTAEQTPL+AL+A KL HEAGLP
Sbjct: 210 AGQIIPWNFPLLMFAWKVGPALACGNTVVLKTAEQTPLSALFASKLLHEAGLP 262



>pir|T06683|T06683 aldehyde dehydrogenase (NAD) (EC 1.2.1.3)
           T17F15.130 - Arabidopsis thaliana>gb:AB030820_1518540
           Arabidopsis thaliana ALDH2 mRNA for aldehyde
           dehydrogenase, complete cds.>gb:ATT17F15_1554704
           Arabidopsis thaliana DNA chromosome 3, BAC clone
           T17F15.>gb:AY090443_1574132 Arabidopsis thaliana
           AT3g48000/T17F15_130 mRNA, complete
           cds.>gb:BT000752_1635024 Arabidopsis thaliana clone
           RAFL09-59-P10 (R19157) putative aldehyde dehydrogenase
           (NAD+) (At3g48000) mRNA, complete
           cds.>gb:BT006371_1639258 Arabidopsis thaliana
           At3g48000/T17F15_130 gene, complete
           cds.>gb:AF327426_1786795 Arabidopsis thaliana putative
           (NAD+) aldehyde dehydrogenase (At3g48000) mRNA, complete
           cds.>gb:AF349447_1790191 Arabidopsis thaliana aldehyde
           dehydrogenase AtALDH2a mRNA, complete
           cds.>gb:AF349522_1790208 Arabidopsis thaliana putative
           aldehyde dehydrogenase (NAD+) (At3g48000) mRNA, complete
           cds.>gb:AF372911_1792626 Arabidopsis thaliana
           AT3g48000/T17F15_130 mRNA, complete cds.
          Length = 538

 Score =  368 bits (944), Expect = e-100
 Identities = 173/218 (79%), Positives = 197/218 (90%), Gaps = 1/218 (0%)
 Frame = +3

Query: 246 IQRFSTA-AAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA 422
           ++RF T+ AA EE+++P+V+V +TQ +ING FVDSASGKTFPTLDPRT +VIAHVAEG+A
Sbjct: 35  LRRFGTSSAAAEEIINPSVQVSHTQLLINGNFVDSASGKTFPTLDPRTGEVIAHVAEGDA 94

Query: 423 EDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA 602
           EDINRAV AAR AFDEGPWPKMSAYERSR++L+FADLVEKH +ELA+LETWDNGKPY+Q+
Sbjct: 95  EDINRAVKAARTAFDEGPWPKMSAYERSRVLLRFADLVEKHSEELASLETWDNGKPYQQS 154

Query: 603 AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW 782
             +E+PM  RLF YYAGWADKIHGLT+PADG + V TLHEPIGVAGQIIPWNFPL MFAW
Sbjct: 155 LTAEIPMFARLFRYYAGWADKIHGLTIPADGNYQVHTLHEPIGVAGQIIPWNFPLLMFAW 214

Query: 783 KVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           KVGPALACGNT+VLKTAEQTPLTA YAGKLF EAGLPP
Sbjct: 215 KVGPALACGNTIVLKTAEQTPLTAFYAGKLFLEAGLPP 252



>gb:AB055519_1521494 Hordeum vulgare mRNA for mitochondrial aldehyde
           dehydrogenase ALDH2, complete cds.
          Length = 549

 Score =  365 bits (938), Expect = e-100
 Identities = 170/216 (78%), Positives = 191/216 (88%)
 Frame = +3

Query: 246 IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE 425
           +QRF TAAA EE +SP+V+V  TQ +INGKFVD+ASGKTFPTLDPRT +VIA V+EG+AE
Sbjct: 47  LQRFGTAAAAEEPISPSVQVGETQLLINGKFVDAASGKTFPTLDPRTGEVIARVSEGDAE 106

Query: 426 DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA 605
           D++RAV AARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DE+A LETWDNGKPYEQAA
Sbjct: 107 DVDRAVVAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDEIAALETWDNGKPYEQAA 166

Query: 606 KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK 785
             E+PM+ RL  YYAGW DKIHGL VPADGPHHVQ LHEPIGV GQIIPWNFPL M+ WK
Sbjct: 167 HIEVPMLARLMRYYAGWTDKIHGLIVPADGPHHVQVLHEPIGVVGQIIPWNFPLLMYGWK 226

Query: 786 VGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
           VGPALACGNT+VLKTAEQTPL+ALY  KL HEAGLP
Sbjct: 227 VGPALACGNTIVLKTAEQTPLSALYVSKLLHEAGLP 262



>pir|T02301|T02301 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 2A
           precursor, mitochondrial - common
           tobacco>gb:NTALDEDEH_1691460 N.tabacum mRNA for aldehyde
           dehydrogenase.
          Length = 542

 Score =  364 bits (935), Expect = 1e-99
 Identities = 168/214 (78%), Positives = 194/214 (90%)
 Frame = +3

Query: 252 RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDI 431
           ++STAAA+EE + PAV V++T+  ING+FVD+ASGKTFPTLDPRT +VIAHVAEG+AEDI
Sbjct: 42  QYSTAAAIEEPIKPAVNVEHTKLFINGQFVDAASGKTFPTLDPRTGEVIAHVAEGDAEDI 101

Query: 432 NRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS 611
           NRAVAAARKAFDEGPWPKM+AYERS+I ++ ADL+EKH D++ATLETWD GKPYEQAAK 
Sbjct: 102 NRAVAAARKAFDEGPWPKMNAYERSKIFVRLADLIEKHNDQIATLETWDTGKPYEQAAKI 161

Query: 612 ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVG 791
           E+PM+VRL  YYAGWADKIHG+T+PADGP+HVQTLHEPIGVAGQIIPWNFPL MF+WK+G
Sbjct: 162 EVPMVVRLLRYYAGWADKIHGMTIPADGPYHVQTLHEPIGVAGQIIPWNFPLLMFSWKIG 221

Query: 792 PALACGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
           PALACGNTVVLKTAEQTPL+A Y   L  EAGLP
Sbjct: 222 PALACGNTVVLKTAEQTPLSAFYVAHLLQEAGLP 255



>gb:AB084896_1524391 Secale cereale ALDH2b mRNA for mitochondrial
           aldehyde dehydrogenase, complete cds.
          Length = 549

 Score =  363 bits (933), Expect = 2e-99
 Identities = 168/216 (77%), Positives = 191/216 (88%)
 Frame = +3

Query: 246 IQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE 425
           +QRF TAAA EE +SP+V+V  TQ +INGKFVD+ASGKTFPTLDPRT +VIA V+EG+AE
Sbjct: 47  LQRFGTAAAAEEPISPSVQVSETQLLINGKFVDAASGKTFPTLDPRTGEVIARVSEGDAE 106

Query: 426 DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA 605
           D++RAV AARKAFD GPWPKM+AYERSRI+L+FADL+EKH D++A LETWDNGKPYEQAA
Sbjct: 107 DVDRAVIAARKAFDHGPWPKMTAYERSRILLRFADLIEKHNDDIAALETWDNGKPYEQAA 166

Query: 606 KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK 785
           + E+PM+ RL  YYAGW DKIHGL VPADGPHHVQ LHEPIGV GQIIPWNFPL M+ WK
Sbjct: 167 QIEVPMLARLMRYYAGWTDKIHGLIVPADGPHHVQVLHEPIGVVGQIIPWNFPLLMYGWK 226

Query: 786 VGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
           VGPALACGNT+VLKTAEQTPL+ALY  KL HEAGLP
Sbjct: 227 VGPALACGNTIVLKTAEQTPLSALYVSKLLHEAGLP 262



>gb:AF348416_1790093 Arabidopsis thaliana mitochondrial aldehyde
           dehydrogenase (ALDH3) mRNA, complete cds; nuclear gene
           for mitochondrial product.
          Length = 534

 Score =  360 bits (925), Expect = 2e-98
 Identities = 169/234 (72%), Positives = 201/234 (85%), Gaps = 1/234 (0%)
 Frame = +3

Query: 195 FPSASAFLGWKYGVESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT 371
           F S+S  +    G+  G QR+S  AAAVE  ++P V+V++TQ +I G+FVD+ SGKTFPT
Sbjct: 14  FMSSSRSIFSLRGMNRGAQRYSNLAAAVENTITPPVKVEHTQLLIGGRFVDAVSGKTFPT 73

Query: 372 LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD 551
           LDPR  +VIA V+EG+AED+NRAVAAARKAFDEGPWPKM+AYERS+I+ +FADL+EKH D
Sbjct: 74  LDPRNGEVIAQVSEGDAEDVNRAVAAARKAFDEGPWPKMTAYERSKILFRFADLIEKHND 133

Query: 552 ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG 731
           E+A LETWDNGKPYEQ+A+ E+PM+ R+F YYAGWADKIHG+T+P DGPHHVQTLHEPIG
Sbjct: 134 EIAALETWDNGKPYEQSAQIEVPMLARVFRYYAGWADKIHGMTMPGDGPHHVQTLHEPIG 193

Query: 732 VAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
           VAGQIIPWNFPL M +WK+GPALACGNTVVLKTAEQTPL+AL  GKL HEAGLP
Sbjct: 194 VAGQIIPWNFPLLMLSWKLGPALACGNTVVLKTAEQTPLSALLVGKLLHEAGLP 247



>gb:AY035139_1559908 Arabidopsis thaliana putative aldehyde
           dehydrogenase (At1g23800) mRNA, complete
           cds.>gb:AY113912_1578323 Arabidopsis thaliana putative
           aldehyde dehydrogenase (At1g23800) mRNA, complete cds.
          Length = 534

 Score =  360 bits (925), Expect = 2e-98
 Identities = 169/234 (72%), Positives = 201/234 (85%), Gaps = 1/234 (0%)
 Frame = +3

Query: 195 FPSASAFLGWKYGVESGIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPT 371
           F S+S  +    G+  G QR+S  AAAVE  ++P V+V++TQ +I G+FVD+ SGKTFPT
Sbjct: 14  FMSSSRSIFSLRGMNRGAQRYSNLAAAVENTITPPVKVEHTQLLIGGRFVDAVSGKTFPT 73

Query: 372 LDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMD 551
           LDPR  +VIA V+EG+AED+NRAVAAARKAFDEGPWPKM+AYERS+I+ +FADL+EKH D
Sbjct: 74  LDPRNGEVIAQVSEGDAEDVNRAVAAARKAFDEGPWPKMTAYERSKILFRFADLIEKHND 133

Query: 552 ELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIG 731
           E+A LETWDNGKPYEQ+A+ E+PM+ R+F YYAGWADKIHG+T+P DGPHHVQTLHEPIG
Sbjct: 134 EIAALETWDNGKPYEQSAQIEVPMLARVFRYYAGWADKIHGMTMPGDGPHHVQTLHEPIG 193

Query: 732 VAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
           VAGQIIPWNFPL M +WK+GPALACGNTVVLKTAEQTPL+AL  GKL HEAGLP
Sbjct: 194 VAGQIIPWNFPLLMLSWKLGPALACGNTVVLKTAEQTPLSALLVGKLLHEAGLP 247



>gb:AF465822S1_1802177 Allium cepa aldehyde dehydrogenase mRNA,
           partial cds.
          Length = 282

 Score =  355 bits (910), Expect = 9e-97
 Identities = 174/220 (79%), Positives = 194/220 (88%), Gaps = 2/220 (0%)
 Frame = +3

Query: 240 SGIQRF-STAAAVEEL-VSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAE 413
           S IQ F STAAAVEE  ++P V+V+YTQ +INGK+VDSASGKTFP+LDPRT +VIAHV+E
Sbjct: 30  SRIQNFGSTAAAVEEQPITPPVKVEYTQLLINGKYVDSASGKTFPSLDPRTGEVIAHVSE 89

Query: 414 GEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPY 593
           G+AEDI+RAVAAARKAFDEGPW KM+AYERS I+L+FADL+EKH D +A LETWDNGKPY
Sbjct: 90  GDAEDIDRAVAAARKAFDEGPWLKMTAYERSNILLRFADLIEKHNDHIAALETWDNGKPY 149

Query: 594 EQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAM 773
           EQAA  E+PM+VRL  YYAGW DKIHGL  PADGPHHVQ L+EPIGVAGQIIPWNFPL M
Sbjct: 150 EQAALVEIPMLVRLMRYYAGWTDKIHGLIXPADGPHHVQVLYEPIGVAGQIIPWNFPLLM 209

Query: 774 FAWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
           FAWKVGPALA GNTVVLKTAEQTPL+ALY  KLFHEAG P
Sbjct: 210 FAWKVGPALATGNTVVLKTAEQTPLSALYVAKLFHEAGGP 249



>pir|C86372|C86372 hypothetical protein F5O8.35 [imported] -
           Arabidopsis thaliana>gb:AE005172_891331 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:F5O8_1678445 Arabidopsis thaliana
           chromosome 1 BAC F5O8 sequence, complete sequence.
          Length = 519

 Score =  349 bits (895), Expect = 5e-95
 Identities = 165/229 (72%), Positives = 194/229 (84%), Gaps = 12/229 (5%)
 Frame = +3

Query: 243 GIQRFST-AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE 419
           G QR+S  AAAVE  ++P V+V++TQ +I G+FVD+ SGKTFPTLDPR  +VIA V+EG+
Sbjct: 4   GAQRYSNLAAAVENTITPPVKVEHTQLLIGGRFVDAVSGKTFPTLDPRNGEVIAQVSEGD 63

Query: 420 AEDINRAVAAARKAFDEGPWPKMSAY-----------ERSRIMLKFADLVEKHMDELATL 566
           AED+NRAVAAARKAFDEGPWPKM+AY           ERS+I+ +FADL+EKH DE+A L
Sbjct: 64  AEDVNRAVAAARKAFDEGPWPKMTAYVYNKVVLCLSSERSKILFRFADLIEKHNDEIAAL 123

Query: 567 ETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQI 746
           ETWDNGKPYEQ+A+ E+PM+ R+F YYAGWADKIHG+T+P DGPHHVQTLHEPIGVAGQI
Sbjct: 124 ETWDNGKPYEQSAQIEVPMLARVFRYYAGWADKIHGMTMPGDGPHHVQTLHEPIGVAGQI 183

Query: 747 IPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
           IPWNFPL M +WK+GPALACGNTVVLKTAEQTPL+AL  GKL HEAGLP
Sbjct: 184 IPWNFPLLMLSWKLGPALACGNTVVLKTAEQTPLSALLVGKLLHEAGLP 232



>gb:AB084897_1524392 Sorghum bicolor ALDH2a mRNA for mitochondrial
           aldehyde dehydrogenase, complete cds.
          Length = 551

 Score =  347 bits (889), Expect = 2e-94
 Identities = 164/226 (72%), Positives = 188/226 (83%), Gaps = 5/226 (2%)
 Frame = +3

Query: 231 GVESGIQRFSTA-----AAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDV 395
           G    + RFSTA     A  EE + PAVEVK+TQ +ING FVD+ASGKTFPTLDPRT +V
Sbjct: 39  GAGGPLHRFSTAPAAAAATAEEPIQPAVEVKHTQLLINGNFVDAASGKTFPTLDPRTGEV 98

Query: 396 IAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETW 575
           IA VAEG++EDI+RAVAAAR+AFDEGPWP+M+AYER R++L+FADL+E+H +E+A LETW
Sbjct: 99  IARVAEGDSEDIDRAVAAARRAFDEGPWPRMTAYERCRVLLRFADLIERHAEEIAALETW 158

Query: 576 DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW 755
           DNGK   QAA +E+PM+ R   YYAGWADKIHGL VP DG HHVQ LHEP+GVAGQIIPW
Sbjct: 159 DNGKTLAQAAGAEVPMVARCIRYYAGWADKIHGLVVPGDGAHHVQVLHEPVGVAGQIIPW 218

Query: 756 NFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
           NFPL MFAWKVGPALACGNTVVLKTAEQTPL+ALY   L HEAGLP
Sbjct: 219 NFPLLMFAWKVGPALACGNTVVLKTAEQTPLSALYVANLLHEAGLP 264



>gb:AF348417_1790094 Zea mays mitochondrial aldehyde dehydrogenase
           RF2B (rf2b) mRNA, complete cds; nuclear gene for
           mitochondrial product.>gb:AF348418_1790095 Zea mays
           mitochondrial aldehyde dehydrogenase RF2B (rf2b) gene,
           complete cds; nuclear gene for mitochondrial product.
          Length = 550

 Score =  346 bits (887), Expect = 4e-94
 Identities = 163/223 (73%), Positives = 189/223 (84%), Gaps = 5/223 (2%)
 Frame = +3

Query: 240 SGIQRFSTA-----AAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAH 404
           + + RFSTA     AA EE + PAVEVK+TQ +ING FVD+ASGKTFPTLDPRT +VIA 
Sbjct: 41  AALHRFSTAPASAAAAAEEPIQPAVEVKHTQLLINGNFVDAASGKTFPTLDPRTGEVIAR 100

Query: 405 VAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNG 584
           VAEG++EDI+RAVAAAR+AFDEGPWP+M+AY+R R++L+FADL+E+H +E+A LETWDNG
Sbjct: 101 VAEGDSEDIDRAVAAARRAFDEGPWPRMTAYDRCRVLLRFADLIERHAEEVAALETWDNG 160

Query: 585 KPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFP 764
           K   QAA +E+PM+ R   YYAGWADKIHGL  PADG HHVQ LHEP+GVAGQIIPWNFP
Sbjct: 161 KTLAQAAGAEVPMVARCVRYYAGWADKIHGLVAPADGAHHVQVLHEPVGVAGQIIPWNFP 220

Query: 765 LAMFAWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
           L MFAWKVGPALACGNTVVLKTAEQTPL+ALY   L HEAGLP
Sbjct: 221 LLMFAWKVGPALACGNTVVLKTAEQTPLSALYVANLLHEAGLP 263



>gb:AB030939_1518582 Oryza sativa (japonica cultivar-group) mRNA for
           mitochondrial aldehyde dehydrogenase ALDH2a, complete
           cds.>gb:AP004888_1846659 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0617A09.>gb:AP005751_1857172 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0072H09.
          Length = 553

 Score =  343 bits (879), Expect = 3e-93
 Identities = 158/212 (74%), Positives = 181/212 (85%)
 Frame = +3

Query: 258 STAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINR 437
           +TAAA EE + P V+VKYT+ +ING FVD+ASGKTF T+DPRT DVIA VAEG+AED+NR
Sbjct: 55  ATAAATEEPIQPPVDVKYTKLLINGNFVDAASGKTFATVDPRTGDVIARVAEGDAEDVNR 114

Query: 438 AVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSEL 617
           AVAAAR+AFDEGPWP+M+AYER R++L+FADL+E+H DE+A LETWD GK  EQ   +E+
Sbjct: 115 AVAAARRAFDEGPWPRMTAYERCRVLLRFADLIEQHADEIAALETWDGGKTLEQTTGTEV 174

Query: 618 PMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPA 797
           PM+ R   YY GWADKIHGL VPADGPHHVQ LHEPIGVAGQIIPWNFPL MFAWKVGPA
Sbjct: 175 PMVARYMRYYGGWADKIHGLVVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAWKVGPA 234

Query: 798 LACGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
           LACGN VVLKTAEQTPL+AL+   L HEAGLP
Sbjct: 235 LACGNAVVLKTAEQTPLSALFVASLLHEAGLP 266



>gb:AP006627_562374 Bacillus clausii KSM-K16 DNA, complete genome.
          Length = 498

 Score =  241 bits (614), Expect = 2e-62
 Identities = 117/191 (61%), Positives = 144/191 (75%)
 Frame = +3

Query: 321 IINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYE 500
           +ING++VD+ SG+TF T++P T D +A VAE   EDI+ AV AARKAFDEGPW KMSA E
Sbjct: 27  LINGEWVDAVSGQTFETMNPATGDTLAIVAEAGQEDIDSAVKAARKAFDEGPWSKMSAAE 86

Query: 501 RSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLT 680
           RSR++ K ADL+E+H +ELA LET DNGKP  + A +++P+ +  F Y+AGWA KI G T
Sbjct: 87  RSRLIYKLADLIEEHKEELAQLETLDNGKPIRETANADVPLAIEHFRYFAGWATKIVGQT 146

Query: 681 VPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALY 860
           +P  G +   T HE IGV GQIIPWNFPL M AWK+G ALA G TVVLK AEQTPL+ALY
Sbjct: 147 IPVQGNYFNYTRHEAIGVVGQIIPWNFPLLMAAWKLGAALATGCTVVLKPAEQTPLSALY 206

Query: 861 AGKLFHEAGLP 893
            G+L +EAG P
Sbjct: 207 LGELINEAGFP 217



>sp|P20000|DHAM_BOVIN Aldehyde dehydrogenase, mitochondrial
           precursor (EC 1.2.1.3) (ALDH class 2) (ALDHI)
           (ALDH-E2).>pir|S09030|S09030 aldehyde dehydrogenase
           (NAD) (EC 1.2.1.3) 2 precursor, mitochondrial - bovine
          Length = 520

 Score =  241 bits (614), Expect = 2e-62
 Identities = 123/232 (53%), Positives = 150/232 (64%), Gaps = 1/232 (0%)
 Frame = +3

Query: 204 ASAFLGWKYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPR 383
           A A    + G   G +  S A       +   EV Y Q  IN ++ D+ S KTFPT++P 
Sbjct: 4   AVALAAARLGPRQGRRLLSAATQAVPTPNQQPEVLYNQIFINNEWHDAVSKKTFPTVNPS 63

Query: 384 TEDVIAHVAEGEAEDINRAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELA 560
           T DVI HVAEG+  D++RAV AAR AF  G PW +M A ER R++ + ADL+E+    LA
Sbjct: 64  TGDVICHVAEGDKADVDRAVKAARAAFQLGSPWRRMDASERGRLLNRLADLIERDRTYLA 123

Query: 561 TLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAG 740
            LET DNGKPY  +   +L M+++   YYAGWADK HG T+P DG +   T HEP+GV G
Sbjct: 124 ALETLDNGKPYIISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDYFSYTRHEPVGVCG 183

Query: 741 QIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           QIIPWNFPL M AWK+GPALA GN VV+K AEQTPLTALY   L  EAG PP
Sbjct: 184 QIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPP 235



>gb:AL135785_1918684 Human DNA sequence from clone RP11-113O24 on
           chromosome 9p11-13.3 Contains a novel gene, possible
           ortholog of mouse insulin-like growth factor binding
           protein 7 (IGFBP7), a novel gene similar to aldehyde
           dehydrogenase 1 family, member B1 (ALDH5, ALDHX,
           MGC2230) (ALDH1B1), a novel gene and four CpG islands,
           complete sequence.
          Length = 517

 Score =  239 bits (609), Expect = 7e-62
 Identities = 117/217 (53%), Positives = 157/217 (72%), Gaps = 2/217 (0%)
 Frame = +3

Query: 252 RFSTAAAVEE-LVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED 428
           R+S+AAA+   +++P  ++ Y Q  IN ++ D+ S KTFPT++P T +VI HVAEG+  D
Sbjct: 18  RYSSAAALPSPILNP--DIPYNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHVAEGDRAD 75

Query: 429 INRAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA 605
           ++RAV AAR+AF  G PW +M A ER R++ + ADLVE+    LA+LET DNGKP++++ 
Sbjct: 76  VDRAVKAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVYLASLETLDNGKPFQESY 135

Query: 606 KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK 785
             +L  +++++ Y+AGWADK HG T+P DG H   T HEP+GV GQIIPWNFPL M  WK
Sbjct: 136 ALDLDEVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEPVGVCGQIIPWNFPLVMQGWK 195

Query: 786 VGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           + PALA GNTVV+K AEQTPL+ALY   L  EAG PP
Sbjct: 196 LAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPP 232



>gb:BC081884_2108130 Rattus norvegicus aldehyde dehydrogenase 1
           family, member B1 (predicted), mRNA (cDNA clone
           MGC:93759 IMAGE:7108511), complete cds.
          Length = 519

 Score =  238 bits (606), Expect = 2e-61
 Identities = 117/215 (54%), Positives = 153/215 (71%), Gaps = 1/215 (0%)
 Frame = +3

Query: 255 FSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDIN 434
           +STAAA+   + P  E++Y Q  IN ++ D+ S KTFPT++P T +VI HVAEG+  D++
Sbjct: 21  YSTAAALPNPI-PNPEIRYNQLFINNEWHDAVSKKTFPTVNPTTGEVIGHVAEGDRADVD 79

Query: 435 RAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS 611
            AV AAR+AF  G PW +M A ER R++ + ADLVE+    LA+LET DNGKP++++   
Sbjct: 80  LAVRAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVYLASLETLDNGKPFQESYVL 139

Query: 612 ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVG 791
           +L  +++++ Y AGWADK HG T+P DG H   T HEP+GV GQIIPWNFPL M  WK+ 
Sbjct: 140 DLDEVIKVYRYLAGWADKWHGKTIPMDGEHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLA 199

Query: 792 PALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           PALA GNTVV+K AEQTPL+ALY   L  EAG PP
Sbjct: 200 PALATGNTVVMKVAEQTPLSALYLASLIKEAGFPP 234



>gb:BT007781_2150713 Synthetic construct Homo sapiens aldehyde
           dehydrogenase 1 family, member B1 mRNA, partial cds.
          Length = 518

 Score =  237 bits (605), Expect = 2e-61
 Identities = 117/217 (53%), Positives = 156/217 (71%), Gaps = 2/217 (0%)
 Frame = +3

Query: 252 RFSTAAAVEE-LVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED 428
           R+S+AAA+   +++P  ++ Y Q  IN ++ D+ S KTFPT++P T +VI HVAEG+  D
Sbjct: 18  RYSSAAALPSPILNP--DIPYNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHVAEGDRAD 75

Query: 429 INRAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA 605
           ++RAV AAR+AF  G PW +M A ER R++   ADLVE+    LA+LET DNGKP++++ 
Sbjct: 76  VDRAVKAAREAFRLGSPWRRMDASERGRLLNLLADLVERDRVYLASLETLDNGKPFQESY 135

Query: 606 KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK 785
             +L  +++++ Y+AGWADK HG T+P DG H   T HEP+GV GQIIPWNFPL M  WK
Sbjct: 136 ALDLDEVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEPVGVCGQIIPWNFPLVMQGWK 195

Query: 786 VGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           + PALA GNTVV+K AEQTPL+ALY   L  EAG PP
Sbjct: 196 LAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPP 232



>gb:BC001619_1967717 Homo sapiens aldehyde dehydrogenase 1 family,
           member B1, mRNA (cDNA clone MGC:2230 IMAGE:3356389),
           complete cds.>gb:BT007418_1990856 Homo sapiens aldehyde
           dehydrogenase 1 family, member B1 mRNA, complete cds.
          Length = 517

 Score =  237 bits (605), Expect = 2e-61
 Identities = 117/217 (53%), Positives = 156/217 (71%), Gaps = 2/217 (0%)
 Frame = +3

Query: 252 RFSTAAAVEE-LVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED 428
           R+S+AAA+   +++P  ++ Y Q  IN ++ D+ S KTFPT++P T +VI HVAEG+  D
Sbjct: 18  RYSSAAALPSPILNP--DIPYNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHVAEGDRAD 75

Query: 429 INRAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA 605
           ++RAV AAR+AF  G PW +M A ER R++   ADLVE+    LA+LET DNGKP++++ 
Sbjct: 76  VDRAVKAAREAFRLGSPWRRMDASERGRLLNLLADLVERDRVYLASLETLDNGKPFQESY 135

Query: 606 KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK 785
             +L  +++++ Y+AGWADK HG T+P DG H   T HEP+GV GQIIPWNFPL M  WK
Sbjct: 136 ALDLDEVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEPVGVCGQIIPWNFPLVMQGWK 195

Query: 786 VGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           + PALA GNTVV+K AEQTPL+ALY   L  EAG PP
Sbjct: 196 LAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPP 232



>gb:CR860576_1184640 Pongo pygmaeus mRNA; cDNA DKFZp459D157 (from
           clone DKFZp459D157).
          Length = 517

 Score =  237 bits (605), Expect = 2e-61
 Identities = 118/217 (54%), Positives = 156/217 (71%), Gaps = 2/217 (0%)
 Frame = +3

Query: 252 RFSTAAAVEE-LVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED 428
           R+S+AAA+   +++P  ++ Y Q  IN ++ D+ S KTFPT++P T +VI HVAEG+  D
Sbjct: 18  RYSSAAALPSPILNP--DIPYNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHVAEGDRAD 75

Query: 429 INRAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA 605
           ++RAV AAR+AF  G PW +M A ER R++   ADLVE+    LA+LET DNGKP++++ 
Sbjct: 76  VDRAVKAAREAFRLGSPWRRMDASERGRLLNCLADLVERDRVYLASLETLDNGKPFQESY 135

Query: 606 KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK 785
             +L  +++++ Y+AGWADK HG T+P DG H   T HEPIGV GQIIPWNFPL M  WK
Sbjct: 136 ALDLDEVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEPIGVCGQIIPWNFPLVMQGWK 195

Query: 786 VGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           + PALA GNTVV+K AEQTPL+ALY   L  EAG PP
Sbjct: 196 LAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPP 232



>gb:BST458323_751290 Geobacillus stearothermophilus partial aldh
           gene for aldehyde dehydrogenase and partial pddh gene
           for 1,3 propanediol dehydrogenase.
          Length = 494

 Score =  237 bits (605), Expect = 2e-61
 Identities = 115/190 (60%), Positives = 142/190 (74%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           ING FV+SASGKTF T +P T + +A V EG+AEDI+RAV AAR+AFD GPW +MSA ER
Sbjct: 24  INGSFVESASGKTFDTPNPATGERLATVYEGDAEDIDRAVKAAREAFDRGPWSRMSAAER 83

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
           SR+M K ADL+E++ +ELA LET DNGKP  +   +++P+ +    YYAGW+ KI G T+
Sbjct: 84  SRLMYKLADLMEENKEELAQLETLDNGKPIRETINADVPLAIEHMRYYAGWSTKIVGQTI 143

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
           P +GP+   T HEP+GV GQIIPWNFPL M  WK+G ALA G TVVLK AEQTPL+ALY 
Sbjct: 144 PVNGPYFNYTRHEPVGVVGQIIPWNFPLLMAMWKLGAALATGCTVVLKPAEQTPLSALYL 203

Query: 864 GKLFHEAGLP 893
            +L  EAG P
Sbjct: 204 AELIEEAGFP 213



>pir|A40872|A40872 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 5
           precursor, mitochondrial - human
          Length = 517

 Score =  237 bits (605), Expect = 2e-61
 Identities = 116/217 (53%), Positives = 156/217 (71%), Gaps = 2/217 (0%)
 Frame = +3

Query: 252 RFSTAAAVEE-LVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED 428
           R+S+AAA+   +++P  ++ Y Q  IN ++ D+ S KTFPT++P T +VI HVAEG+  D
Sbjct: 18  RYSSAAALPSPILNP--DIPYNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHVAEGDRAD 75

Query: 429 INRAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA 605
           ++RAV AAR+ F  G PW +M A ER R++ + ADLVE+    LA+LET DNGKP++++ 
Sbjct: 76  VDRAVKAAREVFRLGSPWRRMDASERGRLLNRLADLVERDRVYLASLETLDNGKPFQESY 135

Query: 606 KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWK 785
             +L  +++++ Y+AGWADK HG T+P DG H   T HEP+GV GQIIPWNFPL M  WK
Sbjct: 136 ALDLDEVIKVYRYFAGWADKWHGKTIPMDGQHFCFTRHEPVGVCGQIIPWNFPLVMQGWK 195

Query: 786 VGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           + PALA GNTVV+K AEQTPL+ALY   L  EAG PP
Sbjct: 196 LAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPP 232



>gb:PSP417789_1702306 Polytomella sp. 'Pringsheim 198.80' mRNA for
           aldehyde dehydrogenase (aldh gene).
          Length = 523

 Score =  236 bits (602), Expect = 4e-61
 Identities = 117/215 (54%), Positives = 147/215 (68%), Gaps = 3/215 (1%)
 Frame = +3

Query: 258 STAAAVEELVSPAVEVKYT---QHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAED 428
           ST+A V ++ S  ++       +  IN K+VD+ SGKT    DPR  + I  VAEG++ D
Sbjct: 23  STSAPVVDIASETIQFARNLPNKLFINNKWVDAKSGKTMGVEDPRNGEEILRVAEGDSAD 82

Query: 429 INRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAK 608
           ++ AV AARKAFDEG WP+M+  ER R++ K AD +E + +  A LET DNGKP   +  
Sbjct: 83  VDLAVKAARKAFDEGAWPRMTGKERGRLIYKLADALEANAEAFARLETLDNGKPLNISRI 142

Query: 609 SELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKV 788
           +++P+ V  F YYAGWADKIHG T+P DGPH   TLHEP+GV G IIPWNFPL M AWK+
Sbjct: 143 ADVPLSVDHFRYYAGWADKIHGKTIPVDGPHMAYTLHEPLGVVGAIIPWNFPLLMAAWKL 202

Query: 789 GPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
           GPALA GNT+VLK AEQTPL+AL   KL  E G P
Sbjct: 203 GPALAAGNTIVLKPAEQTPLSALLIAKLAAEVGFP 237



>pir|C83717|C83717 NADP-dependent aldehyde dehydrogenase dhaS
           [imported] - Bacillus halodurans (strain
           C-125)>gb:BA000004_654485 Bacillus halodurans C-125 DNA,
           complete genome.
          Length = 498

 Score =  236 bits (602), Expect = 4e-61
 Identities = 115/190 (60%), Positives = 143/190 (75%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           ING++VDS SG++F T++P T + +A VAE  +EDI+ AV AARKAFDEGPW KMSA ER
Sbjct: 28  INGEWVDSFSGQSFETMNPATGETLALVAEAGSEDIDFAVKAARKAFDEGPWSKMSAAER 87

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
           SR++ K ADL+E H + LA LET DNGKP  + A +++P+++  F Y+AGWA KI G T+
Sbjct: 88  SRLIYKLADLIEDHKEALAQLETLDNGKPIRETANADIPLVIEHFRYFAGWATKIVGQTI 147

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
           P  G +   T HE IGV GQIIPWNFPL M AWK+G ALA G TVVLK AEQTPL+ALY 
Sbjct: 148 PVQGHYFNYTRHEAIGVVGQIIPWNFPLLMAAWKLGAALATGCTVVLKPAEQTPLSALYL 207

Query: 864 GKLFHEAGLP 893
           G+L +EAG P
Sbjct: 208 GELINEAGFP 217



>gb:AK012213_1156839 Mus musculus 11 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2700007F14
           product:aldehyde dehydrogenase 1 family, member B1, full
           insert sequence.>gb:AK088396_1175377 Mus musculus 2 days
           neonate thymus thymic cells cDNA, RIKEN full-length
           enriched library, clone:E430014M04 product:aldehyde
           dehydrogenase 1 family, member B1, full insert
           sequence.>gb:BC020001_2093199 Mus musculus aldehyde
           dehydrogenase 1 family, member B1, mRNA (cDNA clone
           MGC:28561 IMAGE:4207479), complete
           cds.>gb:BC086768_2109784 Mus musculus aldehyde
           dehydrogenase 1 family, member B1, mRNA (cDNA clone
           MGC:101971 IMAGE:6808412), complete cds.
          Length = 519

 Score =  236 bits (601), Expect = 6e-61
 Identities = 116/215 (53%), Positives = 153/215 (71%), Gaps = 1/215 (0%)
 Frame = +3

Query: 255 FSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDIN 434
           +STAAA+   + P  E+ Y +  IN ++ D+ S KTFPT++P T +VI HVAEG+  D++
Sbjct: 21  YSTAAALPNPI-PNPEICYNKLFINNEWHDAVSKKTFPTVNPTTGEVIGHVAEGDRADVD 79

Query: 435 RAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS 611
            AV AAR+AF  G PW +M A ER R++ + ADLVE+    LA+LET DNGKP++++   
Sbjct: 80  LAVKAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVYLASLETLDNGKPFQESYVL 139

Query: 612 ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVG 791
           +L  +++++ Y+AGWADK HG T+P DG H   T HEP+GV GQIIPWNFPL M  WK+ 
Sbjct: 140 DLDEVIKVYRYFAGWADKWHGKTIPMDGEHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLA 199

Query: 792 PALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           PALA GNTVV+K AEQTPL+ALY   L  EAG PP
Sbjct: 200 PALATGNTVVMKVAEQTPLSALYLASLIKEAGFPP 234



>gb:AF339837_2488543 Danio rerio retinaldehyde dehydrogenase type 2
           (RALDH2) mRNA, complete cds.
          Length = 518

 Score =  235 bits (599), Expect = 1e-60
 Identities = 117/203 (57%), Positives = 140/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query: 291 PAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDE 470
           P  E+KYT+  IN ++ DS SGK FPT +P T + I  V E +  D+++AV AAR AF  
Sbjct: 31  PNPEIKYTKIFINNEWHDSVSGKVFPTYNPATGEKICDVQEADKADVDKAVQAARSAFSL 90

Query: 471 GP-WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYY 647
           G  W KM A ER +++ K ADLVE+    LATLE+ D+GKP+      +L  I++ F YY
Sbjct: 91  GSVWRKMDASERGKLLFKLADLVERDSAYLATLESLDSGKPFLPCFFVDLQGIIKTFRYY 150

Query: 648 AGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLK 827
           AGWADKIHG T+P DG     T HEPIGV GQIIPWNFPL M AWK+GPAL+CGNTVVLK
Sbjct: 151 AGWADKIHGSTIPIDGEFFTLTRHEPIGVCGQIIPWNFPLVMTAWKLGPALSCGNTVVLK 210

Query: 828 TAEQTPLTALYAGKLFHEAGLPP 896
            AEQTPLT LY G L  EAG PP
Sbjct: 211 PAEQTPLTCLYLGALIKEAGFPP 233



>gb:BC075335_2558439 Xenopus tropicalis MGC89020 protein, mRNA (cDNA
           clone MGC:89020 IMAGE:7004710), complete cds.
          Length = 521

 Score =  233 bits (595), Expect = 3e-60
 Identities = 112/204 (54%), Positives = 144/204 (70%), Gaps = 1/204 (0%)
 Frame = +3

Query: 288 SPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFD 467
           +P  +V + Q  IN ++ D+AS KTFPT++P T +VI HVAEG+  D+++AV AAR+AF 
Sbjct: 33  NPKPDVHFNQLFINNEWHDAASKKTFPTINPSTGEVICHVAEGDKADVDKAVKAAREAFR 92

Query: 468 EG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY 644
            G PW +M A +R  ++ + ADL+E+    LATLET DNGKPY  +   +L ++V+   Y
Sbjct: 93  LGSPWRRMDASQRGVLLNRLADLIERDRAILATLETLDNGKPYAISYAVDLDLVVKCLRY 152

Query: 645 YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVL 824
           YAGWADK HG T+P DG +   T HEP+GV GQIIPWNFPL M AWK GPALA GN +V+
Sbjct: 153 YAGWADKCHGKTIPIDGDYFTYTRHEPVGVCGQIIPWNFPLLMLAWKFGPALATGNVIVM 212

Query: 825 KTAEQTPLTALYAGKLFHEAGLPP 896
           K AEQTPLTAL+   L  EAG PP
Sbjct: 213 KVAEQTPLTALHVASLVKEAGFPP 236



>gb:AF310252_2486808 Xenopus laevis RALDH2 mRNA, complete cds.
          Length = 518

 Score =  233 bits (595), Expect = 3e-60
 Identities = 118/213 (55%), Positives = 150/213 (70%), Gaps = 3/213 (1%)
 Frame = +3

Query: 267 AAVEELVSPA--VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRA 440
           A+++ L SP+  +EVK+++  IN ++  S SGK FP  +P T + I  V E E  D+++A
Sbjct: 21  ASLQLLPSPSANLEVKHSKIFINNEWQTSESGKAFPVYNPATGEQICEVQEAEKSDVDKA 80

Query: 441 VAAARKAFDEGP-WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSEL 617
           V AAR AF  G  W +M A ER R++ K ADL+E+    LATLE+ ++GKP+ Q+   +L
Sbjct: 81  VQAARLAFALGSVWRRMDASERGRLLDKLADLIERERTALATLESLNSGKPFLQSYYVDL 140

Query: 618 PMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPA 797
              ++ F YYAGWADKIHGLT+PADG +   T HEPIGV GQIIPWNFPL MFAWK+ PA
Sbjct: 141 QGAIKTFRYYAGWADKIHGLTIPADGDYLTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPA 200

Query: 798 LACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           L CGNTVV+K AEQTPLTALY G L  EAG PP
Sbjct: 201 LCCGNTVVIKPAEQTPLTALYMGALIKEAGFPP 233



>gb:AB015226_1864682 Homo sapiens mRNA for RALDH2, complete cds.
          Length = 518

 Score =  233 bits (594), Expect = 4e-60
 Identities = 112/204 (54%), Positives = 144/204 (70%), Gaps = 1/204 (0%)
 Frame = +3

Query: 288 SPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFD 467
           +P +E+KYT+  IN ++ +S SG+ FP  +P T + +  V E +  DI++AV AAR AF 
Sbjct: 30  TPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFS 89

Query: 468 EGP-WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY 644
            G  W +M A ER R++ K ADLVE+    LAT+E+ + GKP+ QA   +L  +++ F Y
Sbjct: 90  LGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRY 149

Query: 645 YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVL 824
           YAGWADKIHG+T+P DG +   T HEPIGV GQIIPWNFPL MFAWK+ PAL CGNTVV+
Sbjct: 150 YAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVI 209

Query: 825 KTAEQTPLTALYAGKLFHEAGLPP 896
           K AEQTPL+ALY G L  EAG PP
Sbjct: 210 KPAEQTPLSALYMGALIKEAGFPP 233



>sp|O94788|DHA2_HUMAN Aldehyde dehydrogenase 1A2 (EC 1.2.1.3)
           (Retinaldehyde-specific dehydrogenase type 2)
           (RALDH(II)) (RALDH-2).
          Length = 499

 Score =  233 bits (594), Expect = 4e-60
 Identities = 112/204 (54%), Positives = 144/204 (70%), Gaps = 1/204 (0%)
 Frame = +3

Query: 288 SPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFD 467
           +P +E+KYT+  IN ++ +S SG+ FP  +P T + +  V E +  DI++AV AAR AF 
Sbjct: 11  TPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFS 70

Query: 468 EGP-WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY 644
            G  W +M A ER R++ K ADLVE+    LAT+E+ + GKP+ QA   +L  +++ F Y
Sbjct: 71  LGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRY 130

Query: 645 YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVL 824
           YAGWADKIHG+T+P DG +   T HEPIGV GQIIPWNFPL MFAWK+ PAL CGNTVV+
Sbjct: 131 YAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVI 190

Query: 825 KTAEQTPLTALYAGKLFHEAGLPP 896
           K AEQTPL+ALY G L  EAG PP
Sbjct: 191 KPAEQTPLSALYMGALIKEAGFPP 214



>sp|P30837|DHA5_HUMAN Aldehyde dehydrogenase X, mitochondrial
           precursor (EC 1.2.1.3) (ALDH class
           2).>gb:HUMMTALD_2034921 Human mitochondrial aldehyde
           dehydrogenase x gene, complete cds.
          Length = 517

 Score =  233 bits (593), Expect = 5e-60
 Identities = 114/214 (53%), Positives = 150/214 (70%), Gaps = 1/214 (0%)
 Frame = +3

Query: 258 STAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINR 437
           S AA    +++P  ++ Y Q  IN ++ D+ S KTFPT++P T +VI HVAEG+  D++R
Sbjct: 21  SAAALPSPILNP--DIPYNQLFINNEWQDAVSKKTFPTVNPTTGEVIGHVAEGDRADVDR 78

Query: 438 AVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSE 614
           AV AAR+AF  G PW +M A ER R++   ADLVE+    LA+LET DNGKP++++   +
Sbjct: 79  AVKAAREAFRLGSPWRRMDASERGRLLNLLADLVERDRVYLASLETLDNGKPFQESYALD 138

Query: 615 LPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGP 794
           L  +++++ Y+AGWADK HG T+P  G H   T HEP+GV GQIIPWNFPL M  WK+ P
Sbjct: 139 LDEVIKVYRYFAGWADKWHGKTIPMHGQHFCFTRHEPVGVCGQIIPWNFPLVMQGWKLAP 198

Query: 795 ALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           ALA GNTVV+K AEQTPL+ALY   L  EAG PP
Sbjct: 199 ALATGNTVVMKVAEQTPLSALYLASLIKEAGFPP 232



>gb:AY621070_1957710 Homo sapiens mitochondrial aldehyde
           dehydrogenase 2 (ALDH2) mRNA, complete cds; nuclear gene
           for mitochondrial product.
          Length = 517

 Score =  232 bits (592), Expect = 6e-60
 Identities = 120/227 (52%), Positives = 152/227 (66%), Gaps = 3/227 (1%)
 Frame = +3

Query: 225 KYGVESGIQRFSTAAAVEELVSP--AVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI 398
           ++G   G +R  +AAA + + +P    EV   Q  IN ++ D+ S KTFPT++P T +VI
Sbjct: 7   RFGPRLG-RRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVI 65

Query: 399 AHVAEGEAEDINRAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETW 575
             VAEG+ ED+++AV AAR AF  G PW +M A  R R++ + ADL+E+    LA LET 
Sbjct: 66  CQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDQTYLAALETL 125

Query: 576 DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW 755
           DNGKPY  +   +L M+++   YYAGWADK HG T+P DG     T HEP+GV GQIIPW
Sbjct: 126 DNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPW 185

Query: 756 NFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           NFPL M AWK+GPALA GN VV+K AEQTPLTALY   L  EAG PP
Sbjct: 186 NFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPP 232



>gb:BT007942_2150874 Synthetic construct Homo sapiens aldehyde
           dehydrogenase 2 family (mitochondrial) mRNA, partial
           cds.
          Length = 518

 Score =  232 bits (591), Expect = 8e-60
 Identities = 120/227 (52%), Positives = 152/227 (66%), Gaps = 3/227 (1%)
 Frame = +3

Query: 225 KYGVESGIQRFSTAAAVEELVSP--AVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI 398
           ++G   G +R  +AAA + + +P    EV   Q  IN ++ D+ S KTFPT++P T +VI
Sbjct: 7   RFGPRLG-RRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVI 65

Query: 399 AHVAEGEAEDINRAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETW 575
             VAEG+ ED+++AV AAR AF  G PW +M A  R R++ + ADL+E+    LA LET 
Sbjct: 66  CQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLAALETL 125

Query: 576 DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW 755
           DNGKPY  +   +L M+++   YYAGWADK HG T+P DG     T HEP+GV GQIIPW
Sbjct: 126 DNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPW 185

Query: 756 NFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           NFPL M AWK+GPALA GN VV+K AEQTPLTALY   L  EAG PP
Sbjct: 186 NFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPP 232



>gb:AY566469_2086589 Rattus norvegicus mitochondrial aldehyde
           dehydrogenase precursor (Aldh2) mRNA, Aldh2*3 allele,
           partial cds; nuclear gene for mitochondrial product.
          Length = 510

 Score =  232 bits (591), Expect = 8e-60
 Identities = 118/220 (53%), Positives = 147/220 (66%), Gaps = 3/220 (1%)
 Frame = +3

Query: 246 IQRFSTAAAVEELVSP--AVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE 419
           + R  +AAA   + +P    EV   Q  IN ++ D+ S KTFPT++P T +VI  VAEG 
Sbjct: 6   LSRLLSAAATSAVPAPNQQPEVFCNQIFINNEWHDAVSKKTFPTVNPSTGEVICQVAEGN 65

Query: 420 AEDINRAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYE 596
            ED+++AV AAR AF  G PW +M A +R R++ + ADL+E+    LA LET DNGKPY 
Sbjct: 66  KEDVDKAVKAARAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYLAALETLDNGKPYV 125

Query: 597 QAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMF 776
            +   +L M+++   YYAGWADK HG T+P DG     T HEP+GV GQIIPWNFPL M 
Sbjct: 126 ISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQ 185

Query: 777 AWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           AWK+GPALA GN VV+K AEQTPLTALY   L  EAG PP
Sbjct: 186 AWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPP 225



>gb:AY566468_2086588 Rattus norvegicus mitochondrial aldehyde
           dehydrogenase precursor (Aldh2) mRNA, Aldh2*2 allele,
           partial cds; nuclear gene for mitochondrial product.
          Length = 510

 Score =  232 bits (591), Expect = 8e-60
 Identities = 118/220 (53%), Positives = 147/220 (66%), Gaps = 3/220 (1%)
 Frame = +3

Query: 246 IQRFSTAAAVEELVSP--AVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE 419
           + R  +AAA   + +P    EV   Q  IN ++ D+ S KTFPT++P T +VI  VAEG 
Sbjct: 6   LSRLLSAAATSAVPAPNQQPEVFCNQIFINNEWHDAVSKKTFPTVNPSTGEVICQVAEGN 65

Query: 420 AEDINRAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYE 596
            ED+++AV AAR AF  G PW +M A +R R++ + ADL+E+    LA LET DNGKPY 
Sbjct: 66  KEDVDKAVKAARAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYLAALETLDNGKPYV 125

Query: 597 QAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMF 776
            +   +L M+++   YYAGWADK HG T+P DG     T HEP+GV GQIIPWNFPL M 
Sbjct: 126 ISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQ 185

Query: 777 AWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           AWK+GPALA GN VV+K AEQTPLTALY   L  EAG PP
Sbjct: 186 AWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPP 225



>gb:HUMALDH13_2029124 Human nucleus-encoded mitochondrial aldehyde
           dehydrogenase 2 (ALDH2) gene, exon 13.
          Length = 517

 Score =  232 bits (591), Expect = 8e-60
 Identities = 120/227 (52%), Positives = 152/227 (66%), Gaps = 3/227 (1%)
 Frame = +3

Query: 225 KYGVESGIQRFSTAAAVEELVSP--AVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI 398
           ++G   G +R  +AAA + + +P    EV   Q  IN ++ D+ S KTFPT++P T +VI
Sbjct: 7   RFGPRLG-RRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVI 65

Query: 399 AHVAEGEAEDINRAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETW 575
             VAEG+ ED+++AV AAR AF  G PW +M A  R R++ + ADL+E+    LA LET 
Sbjct: 66  CQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLAALETL 125

Query: 576 DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW 755
           DNGKPY  +   +L M+++   YYAGWADK HG T+P DG     T HEP+GV GQIIPW
Sbjct: 126 DNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPW 185

Query: 756 NFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           NFPL M AWK+GPALA GN VV+K AEQTPLTALY   L  EAG PP
Sbjct: 186 NFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPP 232



>gb:CR857362_1181605 Pongo pygmaeus mRNA; cDNA DKFZp469J1332 (from
           clone DKFZp469J1332).
          Length = 517

 Score =  232 bits (591), Expect = 8e-60
 Identities = 120/227 (52%), Positives = 152/227 (66%), Gaps = 3/227 (1%)
 Frame = +3

Query: 225 KYGVESGIQRFSTAAAVEELVSP--AVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI 398
           ++G   G +R  +AAA + + +P    EV   Q  IN ++ D+ S KTFPT++P T +VI
Sbjct: 7   RFGPRLG-RRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVI 65

Query: 399 AHVAEGEAEDINRAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETW 575
             VAEG+ ED+++AV AAR AF  G PW +M A  R R++ + ADL+E+    LA LET 
Sbjct: 66  CQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLAALETL 125

Query: 576 DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW 755
           DNGKPY  +   +L M+++   YYAGWADK HG T+P DG     T HEP+GV GQIIPW
Sbjct: 126 DNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPW 185

Query: 756 NFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           NFPL M AWK+GPALA GN VV+K AEQTPLTALY   L  EAG PP
Sbjct: 186 NFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPP 232



>sp|P47738|DHAM_MOUSE Aldehyde dehydrogenase, mitochondrial
           precursor (EC 1.2.1.3) (ALDH class 2) (AHD-M1) (ALDHI)
           (ALDH-E2).>pir|I48966|I48966 aldehyde dehydrogenase
           (NAD) (EC 1.2.1.3) 2 precursor, mitochondrial -
           mouse>gb:AK035145_1164004 Mus musculus 12 days embryo
           embryonic body between diaphragm region and neck cDNA,
           RIKEN full-length enriched library, clone:9430093D07
           product:aldehyde dehydrogenase 2, mitochondrial, full
           insert sequence.>gb:AK042326_1166271 Mus musculus 3 days
           neonate thymus cDNA, RIKEN full-length enriched library,
           clone:A630082J17 product:aldehyde dehydrogenase 2,
           mitochondrial, full insert sequence.>gb:AK079602_1172748
           Mus musculus adult male spinal cord cDNA, RIKEN
           full-length enriched library, clone:A330064L07
           product:aldehyde dehydrogenase 2, mitochondrial, full
           insert sequence.>gb:BC005476_2089907 Mus musculus
           aldehyde dehydrogenase 2, mitochondrial, mRNA (cDNA
           clone MGC:6764 IMAGE:3600875), complete
           cds.>gb:MMU07235_2118114 Mus musculus aldehyde
           dehydrogenase (ALDH2) mRNA, nuclear gene encoding
           mitochondrial protein, complete cds.
          Length = 519

 Score =  232 bits (591), Expect = 8e-60
 Identities = 118/220 (53%), Positives = 147/220 (66%), Gaps = 3/220 (1%)
 Frame = +3

Query: 246 IQRFSTAAAVEELVSP--AVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE 419
           + R  +AAA   + +P    EV   Q  IN ++ D+ S KTFPT++P T +VI  VAEG 
Sbjct: 15  LSRLLSAAATSAVPAPNHQPEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGN 74

Query: 420 AEDINRAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYE 596
            ED+++AV AAR AF  G PW +M A +R R++ + ADL+E+    LA LET DNGKPY 
Sbjct: 75  KEDVDKAVKAARAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYLAALETLDNGKPYV 134

Query: 597 QAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMF 776
            +   +L M+++   YYAGWADK HG T+P DG     T HEP+GV GQIIPWNFPL M 
Sbjct: 135 ISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQ 194

Query: 777 AWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           AWK+GPALA GN VV+K AEQTPLTALY   L  EAG PP
Sbjct: 195 AWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPP 234



>sp|P05091|DHAM_HUMAN Aldehyde dehydrogenase, mitochondrial
           precursor (EC 1.2.1.3) (ALDH class 2) (ALDHI)
           (ALDH-E2).>pir|A29975|DEHUE2 aldehyde dehydrogenase
           (NAD) (EC 1.2.1.3) 2 precursor, mitochondrial
           [validated] - human>gb:BC002967_1968567 Homo sapiens
           aldehyde dehydrogenase 2 family (mitochondrial), mRNA
           (cDNA clone MGC:1806 IMAGE:3543343), complete
           cds.>gb:BC071839_1988815 Homo sapiens aldehyde
           dehydrogenase 2 family (mitochondrial), mRNA (cDNA clone
           MGC:88499 IMAGE:5477768), complete cds.
          Length = 517

 Score =  232 bits (591), Expect = 8e-60
 Identities = 120/227 (52%), Positives = 152/227 (66%), Gaps = 3/227 (1%)
 Frame = +3

Query: 225 KYGVESGIQRFSTAAAVEELVSP--AVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI 398
           ++G   G +R  +AAA + + +P    EV   Q  IN ++ D+ S KTFPT++P T +VI
Sbjct: 7   RFGPRLG-RRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVI 65

Query: 399 AHVAEGEAEDINRAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETW 575
             VAEG+ ED+++AV AAR AF  G PW +M A  R R++ + ADL+E+    LA LET 
Sbjct: 66  CQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLAALETL 125

Query: 576 DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW 755
           DNGKPY  +   +L M+++   YYAGWADK HG T+P DG     T HEP+GV GQIIPW
Sbjct: 126 DNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPW 185

Query: 756 NFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           NFPL M AWK+GPALA GN VV+K AEQTPLTALY   L  EAG PP
Sbjct: 186 NFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPP 232



>gb:AF315691_2487173 Danio rerio aldehyde dehydrogenase 1A2 mRNA,
           complete cds.
          Length = 518

 Score =  231 bits (590), Expect = 1e-59
 Identities = 116/203 (57%), Positives = 139/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query: 291 PAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDE 470
           P  E+KYT+  IN ++ DS SGK F T +P T + I  V E +  D+++AV AAR AF  
Sbjct: 31  PNPEIKYTKIFINNEWHDSVSGKVFHTYNPATGEKICDVQESDKADVDKAVQAARSAFSL 90

Query: 471 GP-WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYY 647
           G  W KM A ER +++ K ADLVE+    LATLE+ D+GKP+      +L  I++ F YY
Sbjct: 91  GSVWRKMDASERGKLLFKLADLVERDSAYLATLESLDSGKPFLPCFFVDLQGIIKTFRYY 150

Query: 648 AGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLK 827
           AGWADKIHG T+P DG     T HEPIGV GQIIPWNFPL M AWK+GPAL+CGNTVVLK
Sbjct: 151 AGWADKIHGSTIPIDGEFFTLTRHEPIGVCGQIIPWNFPLVMTAWKLGPALSCGNTVVLK 210

Query: 828 TAEQTPLTALYAGKLFHEAGLPP 896
            AEQTPLT LY G L  EAG PP
Sbjct: 211 PAEQTPLTCLYLGALIKEAGFPP 233



>gb:AF288764_2485043 Danio rerio retinaldehyde dehydrogenase 2
           (raldh2) mRNA, complete cds.
          Length = 518

 Score =  231 bits (590), Expect = 1e-59
 Identities = 116/203 (57%), Positives = 139/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query: 291 PAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDE 470
           P  E+KYT+  IN ++ DS SGK F T +P T + I  V E +  D+++AV AAR AF  
Sbjct: 31  PNPEIKYTKIFINNEWHDSVSGKVFHTYNPATGEKICDVQEADKADVDKAVQAARSAFSL 90

Query: 471 GP-WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYY 647
           G  W KM A ER +++ K ADLVE+    LATLE+ D+GKP+      +L  I++ F YY
Sbjct: 91  GSVWRKMDASERGKLLFKLADLVERDSAYLATLESLDSGKPFLPCFFVDLQGIIKTFRYY 150

Query: 648 AGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLK 827
           AGWADKIHG T+P DG     T HEPIGV GQIIPWNFPL M AWK+GPAL+CGNTVVLK
Sbjct: 151 AGWADKIHGSTIPIDGEFFTLTRHEPIGVCGQIIPWNFPLVMTAWKLGPALSCGNTVVLK 210

Query: 828 TAEQTPLTALYAGKLFHEAGLPP 896
            AEQTPLT LY G L  EAG PP
Sbjct: 211 PAEQTPLTCLYLGALIKEAGFPP 233



>gb:CR456991_1993198 Homo sapiens full open reading frame cDNA clone
           RZPDo834H0211D for gene ALDH2, aldehyde dehydrogenase 2
           family (mitochondrial); complete cds, incl. stopcodon.
          Length = 517

 Score =  231 bits (589), Expect = 1e-59
 Identities = 120/227 (52%), Positives = 152/227 (66%), Gaps = 3/227 (1%)
 Frame = +3

Query: 225 KYGVESGIQRFSTAAAVEELVSP--AVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVI 398
           ++G   G +R  +AAA + + +P    EV   Q  IN ++ D+ S KTFPT++P T +VI
Sbjct: 7   RFGPRLG-RRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPFTGEVI 65

Query: 399 AHVAEGEAEDINRAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETW 575
             VAEG+ ED+++AV AAR AF  G PW +M A  R R++ + ADL+E+    LA LET 
Sbjct: 66  CQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLAALETL 125

Query: 576 DNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPW 755
           DNGKPY  +   +L M+++   YYAGWADK HG T+P DG     T HEP+GV GQIIPW
Sbjct: 126 DNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPW 185

Query: 756 NFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           NFPL M AWK+GPALA GN VV+K AEQTPLTALY   L  EAG PP
Sbjct: 186 NFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPP 232



>gb:BC077256_2559972 Xenopus laevis aldehyde dehydrogenase class I,
           mRNA (cDNA clone MGC:79911 IMAGE:3399386), complete cds.
          Length = 502

 Score =  231 bits (588), Expect = 2e-59
 Identities = 109/201 (54%), Positives = 142/201 (70%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           +E+KYT+  IN ++ +S SGK FP  +P T + +  V EG+ ED+N+AV AAR+AF  G 
Sbjct: 17  LEIKYTKIFINNEWHNSISGKKFPVYNPATGEKVCEVEEGDKEDVNKAVKAAREAFQIGS 76

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW ++ A ER R++ K ADLVE+    L+T+E+ D GKPY  +   ++P  ++   Y AG
Sbjct: 77  PWRRLDASERGRMLNKLADLVERDRLILSTMESIDGGKPYTASYFGDIPGAIKSLRYCAG 136

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADK+ G T+P DG +   T HEP+GV GQIIPWNFPL MFAWK+ PAL CGNTVV+K A
Sbjct: 137 WADKVQGRTIPMDGDYFTFTRHEPVGVCGQIIPWNFPLVMFAWKIAPALCCGNTVVIKPA 196

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTALY G L  EAG+PP
Sbjct: 197 EQTPLTALYMGSLIKEAGIPP 217



>gb:AF061833_2471352 Xenopus laevis aldehyde dehydrogenase (ALDH1)
           mRNA, complete cds.
          Length = 502

 Score =  231 bits (588), Expect = 2e-59
 Identities = 109/201 (54%), Positives = 142/201 (70%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           +E+KYT+  IN ++ +S SGK FP  +P T + +  V EG+ ED+N+AV AAR+AF  G 
Sbjct: 17  LEIKYTKIFINNEWHNSISGKKFPVYNPATGEKVCEVEEGDKEDVNKAVKAAREAFQIGS 76

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW ++ A ER R++ K ADLVE+    L+T+E+ D GKPY  +   ++P  ++   Y AG
Sbjct: 77  PWRRLDASERGRMLNKLADLVERDRLILSTMESIDGGKPYTASYFGDIPGAIKSLRYCAG 136

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADK+ G T+P DG +   T HEP+GV GQIIPWNFPL MFAWK+ PAL CGNTVV+K A
Sbjct: 137 WADKVQGRTIPMDGDYFTFTRHEPVGVCGQIIPWNFPLVMFAWKIAPALCCGNTVVIKPA 196

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTALY G L  EAG+PP
Sbjct: 197 EQTPLTALYMGSLIKEAGIPP 217



>gb:AB016718_2460746 Xenopus laevis mRNA for aldehyde dehydrogenase
           class 1, complete cds.
          Length = 502

 Score =  231 bits (588), Expect = 2e-59
 Identities = 109/201 (54%), Positives = 142/201 (70%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           +E+KYT+  IN ++ +S SGK FP  +P T + +  V EG+ ED+N+AV AAR+AF  G 
Sbjct: 17  LEIKYTKIFINNEWHNSISGKKFPVYNPATGEKVCEVEEGDKEDVNKAVKAAREAFQIGS 76

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW ++ A ER R++ K ADLVE+    L+T+E+ D GKPY  +   ++P  ++   Y AG
Sbjct: 77  PWRRLDASERGRMLNKLADLVERDRLILSTMESIDGGKPYTASYFGDIPGAIKSLRYCAG 136

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADK+ G T+P DG +   T HEP+GV GQIIPWNFPL MFAWK+ PAL CGNTVV+K A
Sbjct: 137 WADKVQGRTIPMDGDYFTFTRHEPVGVCGQIIPWNFPLVMFAWKIAPALCCGNTVVIKPA 196

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTALY G L  EAG+PP
Sbjct: 197 EQTPLTALYMGSLIKEAGIPP 217



>gb:AY566467_2086587 Rattus norvegicus mitochondrial aldehyde
           dehydrogenase precursor (Aldh2) mRNA, Aldh2*1 allele,
           partial cds; nuclear gene for mitochondrial product.
          Length = 510

 Score =  230 bits (587), Expect = 2e-59
 Identities = 117/220 (53%), Positives = 147/220 (66%), Gaps = 3/220 (1%)
 Frame = +3

Query: 246 IQRFSTAAAVEELVSP--AVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE 419
           + R  +AAA   + +P    EV   Q  IN ++ D+ S KTFPT++P T +VI  VAEG 
Sbjct: 6   LSRLLSAAATSAVPAPNQQPEVFCNQIFINNEWHDAVSKKTFPTVNPSTGEVICQVAEGN 65

Query: 420 AEDINRAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYE 596
            ED+++AV AA+ AF  G PW +M A +R R++ + ADL+E+    LA LET DNGKPY 
Sbjct: 66  KEDVDKAVKAAQAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYLAALETLDNGKPYV 125

Query: 597 QAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMF 776
            +   +L M+++   YYAGWADK HG T+P DG     T HEP+GV GQIIPWNFPL M 
Sbjct: 126 ISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQ 185

Query: 777 AWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           AWK+GPALA GN VV+K AEQTPLTALY   L  EAG PP
Sbjct: 186 AWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPP 225



>sp|P11884|DHAM_RAT Aldehyde dehydrogenase, mitochondrial precursor
           (EC 1.2.1.3) (ALDH class 2) (ALDH1)
           (ALDH-E2).>pir|S03564|S03564 aldehyde dehydrogenase
           (NAD) (EC 1.2.1.3) 2 precursor, mitochondrial -
           rat>gb:BC062081_2104853 Rattus norvegicus aldehyde
           dehydrogenase 2, mRNA (cDNA clone MGC:72375
           IMAGE:5621229), complete cds.>gb:RNADR_2134366 Rat mRNA
           for liver mitochondrial aldehyde dehydrogenase.
          Length = 519

 Score =  230 bits (587), Expect = 2e-59
 Identities = 117/220 (53%), Positives = 147/220 (66%), Gaps = 3/220 (1%)
 Frame = +3

Query: 246 IQRFSTAAAVEELVSP--AVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE 419
           + R  +AAA   + +P    EV   Q  IN ++ D+ S KTFPT++P T +VI  VAEG 
Sbjct: 15  LSRLLSAAATSAVPAPNQQPEVFCNQIFINNEWHDAVSKKTFPTVNPSTGEVICQVAEGN 74

Query: 420 AEDINRAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYE 596
            ED+++AV AA+ AF  G PW +M A +R R++ + ADL+E+    LA LET DNGKPY 
Sbjct: 75  KEDVDKAVKAAQAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYLAALETLDNGKPYV 134

Query: 597 QAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMF 776
            +   +L M+++   YYAGWADK HG T+P DG     T HEP+GV GQIIPWNFPL M 
Sbjct: 135 ISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQ 194

Query: 777 AWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           AWK+GPALA GN VV+K AEQTPLTALY   L  EAG PP
Sbjct: 195 AWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPP 234



>gb:BC077908_2560555 Xenopus laevis MGC80785 protein, mRNA (cDNA
           clone MGC:80785 IMAGE:5513343), complete cds.
          Length = 521

 Score =  230 bits (586), Expect = 3e-59
 Identities = 118/234 (50%), Positives = 155/234 (66%), Gaps = 7/234 (2%)
 Frame = +3

Query: 216 LGWKYG----VESGIQ--RFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLD 377
           LG  YG    V  G+Q  R+S A       +P  +V + Q  IN ++ D+ S KTFPT++
Sbjct: 6   LGSLYGKVSRVPLGLQLCRYSVAIPTP---NPKPDVHFNQLFINNEWHDAVSKKTFPTIN 62

Query: 378 PRTEDVIAHVAEGEAEDINRAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDE 554
           P T +VI H+AEG+  D+++AV AAR+AF  G PW +M A +R  ++ + ADL+E+    
Sbjct: 63  PSTAEVICHIAEGDKADVDKAVKAAREAFRLGSPWRRMDASQRGVLINRLADLIERDRAI 122

Query: 555 LATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGV 734
           LATLET DNGKPY  +   +L ++++   YYAGWADK HG T+P DG +   T HEP+GV
Sbjct: 123 LATLETLDNGKPYAISYAVDLDLVLKCLRYYAGWADKCHGKTIPIDGDYFTYTRHEPVGV 182

Query: 735 AGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
            GQIIPWNFPL M AWK GPALA GN +V+K AEQTPL+AL+   L  EAG PP
Sbjct: 183 CGQIIPWNFPLLMLAWKFGPALATGNVIVMKVAEQTPLSALHVASLVKEAGFPP 236



>gb:BX294151_770628 Pirellula sp. strain 1 complete genome; segment
           19/24.
          Length = 489

 Score =  229 bits (585), Expect = 4e-59
 Identities = 113/210 (53%), Positives = 147/210 (70%)
 Frame = +3

Query: 264 AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAV 443
           +  + E+  P  +V++TQ  I+G++ DSASGKTF T++P TE+ I  VAEG+ EDI+ AV
Sbjct: 2   STTLPEIAPP--KVRHTQLFIDGQWRDSASGKTFATINPATEEEIVQVAEGDKEDIDAAV 59

Query: 444 AAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPM 623
            AARKAF+ GPW  M A +R R+M+K AD +E  +DELA LET DNGKP  ++  ++LP+
Sbjct: 60  KAARKAFESGPWRTMDARDRGRLMMKLADAIENEIDELAQLETLDNGKPLRESRHADLPL 119

Query: 624 IVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALA 803
           ++    YYAG+ADKI G TVP  G +   T  EP+GV GQIIPWNFP+ M AWK GPALA
Sbjct: 120 VIDALRYYAGYADKIQGETVPIRGNYLCYTRKEPVGVVGQIIPWNFPMLMVAWKWGPALA 179

Query: 804 CGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
            G T+V+K AEQTPLT L   +L  E G P
Sbjct: 180 TGCTIVMKPAEQTPLTCLRMAQLAKEVGFP 209



>gb:BC087227_2565084 Xenopus laevis hypothetical LOC496110, mRNA
           (cDNA clone MGC:98380 IMAGE:7197199), complete cds.
          Length = 511

 Score =  229 bits (584), Expect = 5e-59
 Identities = 110/204 (53%), Positives = 142/204 (69%), Gaps = 1/204 (0%)
 Frame = +3

Query: 288 SPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFD 467
           +P +E+KYT+  IN ++ +S SG+ FP  +P T + +  V E +  DI++AV AAR AF 
Sbjct: 23  TPNLEIKYTKIFINNEWQNSESGRVFPVCNPATGEQVCEVQEADKVDIDKAVQAARLAFS 82

Query: 468 EGP-WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY 644
            G  W +M A ER R++ K ADLVE+    LAT+E+ + GKP+ QA   +L  +++   Y
Sbjct: 83  LGSVWRRMDASERGRLLDKLADLVERDRATLATMESLNGGKPFLQAFYIDLQGVIKTLRY 142

Query: 645 YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVL 824
           YAGWADKIHG+T+P DG +   T HEPIGV GQIIPWNFPL MF WK+ PAL CGNTVV+
Sbjct: 143 YAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFTWKIAPALCCGNTVVI 202

Query: 825 KTAEQTPLTALYAGKLFHEAGLPP 896
           K AEQTPL+ALY G L  EAG PP
Sbjct: 203 KPAEQTPLSALYMGALIKEAGFPP 226



>gb:BC075704_2106719 Mus musculus aldehyde dehydrogenase family 1,
           subfamily A2, mRNA (cDNA clone MGC:76772
           IMAGE:30471325), complete cds.
          Length = 518

 Score =  229 bits (584), Expect = 5e-59
 Identities = 110/204 (53%), Positives = 142/204 (69%), Gaps = 1/204 (0%)
 Frame = +3

Query: 288 SPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFD 467
           +P +E+KYT+  IN ++ +S SG+ FP  +P T + +  V E +  DI++AV AAR AF 
Sbjct: 30  TPNLEIKYTKIFINNEWQNSESGRVFPVCNPATGEQVCEVQEADKVDIDKAVQAARLAFS 89

Query: 468 EGP-WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY 644
            G  W +M A ER R++ K ADLVE+    LAT+E+ + GKP+ QA   +L  +++   Y
Sbjct: 90  LGSVWRRMDASERGRLLDKLADLVERDRATLATMESLNGGKPFLQAFYIDLQGVIKTLRY 149

Query: 645 YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVL 824
           YAGWADKIHG+T+P DG +   T HEPIGV GQIIPWNFPL MF WK+ PAL CGNTVV+
Sbjct: 150 YAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFTWKIAPALCCGNTVVI 209

Query: 825 KTAEQTPLTALYAGKLFHEAGLPP 896
           K AEQTPL+ALY G L  EAG PP
Sbjct: 210 KPAEQTPLSALYMGALIKEAGFPP 233



>gb:AF318139S1_1785597 Zea mays clone RXQ48.rev T cytoplasm male
           sterility restorer factor 2 (Rf2) gene, Rf2'1036W103
           allele, exons 2-4 and partial cds.
          Length = 129

 Score =  229 bits (584), Expect = 5e-59
 Identities = 107/127 (84%), Positives = 116/127 (91%)
 Frame = +3

Query: 381 RTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELA 560
           RT +VIAHVAEG+AEDINRAVAAARKAFDEGPWPKM+AYERSRI+L+FADL+EKH DELA
Sbjct: 1   RTGEVIAHVAEGDAEDINRAVAAARKAFDEGPWPKMTAYERSRILLRFADLIEKHNDELA 60

Query: 561 TLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAG 740
            LETWDNGKPYEQAA+ E+PM+ RL  YYAGWADKIHGL VPADGPHHVQ LHEPIGVAG
Sbjct: 61  ALETWDNGKPYEQAAQIEVPMVARLMRYYAGWADKIHGLIVPADGPHHVQILHEPIGVAG 120

Query: 741 QIIPWNF 761
           QIIP  F
Sbjct: 121 QIIPGTF 127



>sp|P81178|DHAM_MESAU Aldehyde dehydrogenase, mitochondrial (EC
           1.2.1.3) (ALDH class 2) (ALDH1) (ALDH-E2).
          Length = 500

 Score =  229 bits (584), Expect = 5e-59
 Identities = 117/215 (54%), Positives = 145/215 (67%), Gaps = 3/215 (1%)
 Frame = +3

Query: 261 TAAAVEELVSP--AVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDIN 434
           +AAA   + +P    EV   Q  IN ++ D+ S KTFPT++P T +VI  VAEG  ED++
Sbjct: 1   SAAATSAVPAPNQQPEVFCNQIFINNEWHDAVSKKTFPTVNPSTGEVICQVAEGSKEDVD 60

Query: 435 RAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS 611
           +AV AAR AF  G PW +M A +R R++ + ADL+E+    LA LET DNGKPY  +   
Sbjct: 61  KAVKAARAAFQLGSPWRRMDASDRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLV 120

Query: 612 ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVG 791
           +L M+++   YYAGWADK HG T+P DG     T HEP+GV GQIIPWNFPL M AWK+G
Sbjct: 121 DLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLG 180

Query: 792 PALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           PALA GN VV+K AEQTPLTALY   L  EAG PP
Sbjct: 181 PALATGNVVVMKVAEQTPLTALYVANLIKEAGFPP 215



>sp|Q63639|DHA2_RAT Aldehyde dehydrogenase 1A2 (EC 1.2.1.3)
           (Retinaldehyde-specific dehydrogenase type 2)
           (RALDH(II)) (RALDH-2).>gb:RNU60063_2137521 Rattus
           norvegicus aldehyde dehydrogenase mRNA, complete cds.
          Length = 499

 Score =  229 bits (584), Expect = 5e-59
 Identities = 110/204 (53%), Positives = 142/204 (69%), Gaps = 1/204 (0%)
 Frame = +3

Query: 288 SPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFD 467
           +P +E+KYT+  IN ++ +S SG+ FP  +P T + +  V E +  DI++AV AAR AF 
Sbjct: 11  TPNLEIKYTKIFINNEWQNSESGRVFPVCNPATGEQVCEVQEADKVDIDKAVQAARLAFS 70

Query: 468 EGP-WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY 644
            G  W +M A ER R++ K ADLVE+    LAT+E+ + GKP+ QA   +L  +++   Y
Sbjct: 71  LGSVWRRMDASERGRLLDKLADLVERDRATLATMESLNGGKPFLQAFYIDLQGVIKTLRY 130

Query: 645 YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVL 824
           YAGWADKIHG+T+P DG +   T HEPIGV GQIIPWNFPL MF WK+ PAL CGNTVV+
Sbjct: 131 YAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFTWKIAPALCCGNTVVI 190

Query: 825 KTAEQTPLTALYAGKLFHEAGLPP 896
           K AEQTPL+ALY G L  EAG PP
Sbjct: 191 KPAEQTPLSALYMGALIKEAGFPP 214



>sp|Q62148|DHA2_MOUSE Aldehyde dehydrogenase 1A2 (EC 1.2.1.3)
           (Retinaldehyde-specific dehydrogenase type 2)
           (RALDH(II)) (RALDH-2).>pir|S74224|S74224 aldehyde
           dehydrogenase (NAD) (EC 1.2.1.3) 2 -
           mouse>gb:AK078553_1172383 Mus musculus 12 days embryo
           female mullerian duct includes surrounding region cDNA,
           RIKEN full-length enriched library, clone:6820449I02
           product:aldehyde dehydrogenase family 1, subfamily A2,
           full insert sequence.>gb:MMRALDH2_2117154 M.musculus
           mRNA for retinaldehyde-specific dehydrogenase.
          Length = 499

 Score =  229 bits (584), Expect = 5e-59
 Identities = 110/204 (53%), Positives = 142/204 (69%), Gaps = 1/204 (0%)
 Frame = +3

Query: 288 SPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFD 467
           +P +E+KYT+  IN ++ +S SG+ FP  +P T + +  V E +  DI++AV AAR AF 
Sbjct: 11  TPNLEIKYTKIFINNEWQNSESGRVFPVCNPATGEQVCEVQEADKVDIDKAVQAARLAFS 70

Query: 468 EGP-WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY 644
            G  W +M A ER R++ K ADLVE+    LAT+E+ + GKP+ QA   +L  +++   Y
Sbjct: 71  LGSVWRRMDASERGRLLDKLADLVERDRATLATMESLNGGKPFLQAFYIDLQGVIKTLRY 130

Query: 645 YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVL 824
           YAGWADKIHG+T+P DG +   T HEPIGV GQIIPWNFPL MF WK+ PAL CGNTVV+
Sbjct: 131 YAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFTWKIAPALCCGNTVVI 190

Query: 825 KTAEQTPLTALYAGKLFHEAGLPP 896
           K AEQTPL+ALY G L  EAG PP
Sbjct: 191 KPAEQTPLSALYMGALIKEAGFPP 214



>gb:AE017009_378445 Bacillus cereus ATCC 14579 section 12 of 18 of
           the complete genome.>gb:AE016877_1018695 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 494

 Score =  228 bits (582), Expect = 9e-59
 Identities = 109/190 (57%), Positives = 136/190 (71%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           +NG F++SASGKTF T +P T + +A V+E   EDI++AV AAR AFDEGPW +MS  ER
Sbjct: 24  VNGSFIESASGKTFKTPNPATGETLAVVSEAGREDIHKAVVAARMAFDEGPWSRMSTAER 83

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
           SR+M K ADL+E+H +ELA LET DNGKP  +   +++P+ +    YYAGWA KI G T+
Sbjct: 84  SRLMYKLADLMEEHKEELAQLETLDNGKPIRETMAADIPLAIEHMRYYAGWATKIVGQTI 143

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
           P  G +   T HE +GV GQIIPWNFPL M  WK+G ALA G T+VLK AEQTPL+ALY 
Sbjct: 144 PVSGDYFNYTRHEAVGVVGQIIPWNFPLLMAMWKMGAALATGCTIVLKPAEQTPLSALYL 203

Query: 864 GKLFHEAGLP 893
            +L  EAG P
Sbjct: 204 AELIEEAGFP 213



>gb:AE017275_424773 Bacillus cereus ATCC 10987, section 12 of 18 of
           the complete genome.>gb:AE017194_1063192 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 494

 Score =  228 bits (581), Expect = 1e-58
 Identities = 109/190 (57%), Positives = 136/190 (71%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           +NG F++SASGKTF T +P T + +A V+E   EDI++AV AAR AFDEGPW +MS  ER
Sbjct: 24  VNGSFIESASGKTFNTPNPATGETLAVVSEAGREDIHKAVVAARMAFDEGPWSRMSTAER 83

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
           SR+M K ADL+E+H +ELA LET DNGKP  +   +++P+ +    YYAGWA KI G T+
Sbjct: 84  SRLMYKLADLMEEHKEELAQLETLDNGKPIRETMAADIPLAIEHMRYYAGWATKIVGQTI 143

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
           P  G +   T HE +GV GQIIPWNFPL M  WK+G ALA G T+VLK AEQTPL+ALY 
Sbjct: 144 PVSGDYFNYTRHEAVGVVGQIIPWNFPLLMAMWKMGAALATGCTIVLKPAEQTPLSALYL 203

Query: 864 GKLFHEAGLP 893
            +L  EAG P
Sbjct: 204 AELIEEAGFP 213



>gb:AF348413_1790090 Zea mays cytosolic aldehyde dehydrogenase RF2C
           (rf2c) mRNA, complete cds.
          Length = 503

 Score =  228 bits (580), Expect = 2e-58
 Identities = 110/201 (54%), Positives = 143/201 (71%)
 Frame = +3

Query: 291 PAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDE 470
           P VEV++T+  I+GKFVD+ SGKTF T DPRT +VIA +AEG   D++ AV AAR+AFD 
Sbjct: 15  PKVEVRFTKLFIDGKFVDAVSGKTFETRDPRTGEVIASIAEGGKADVDLAVKAAREAFDN 74

Query: 471 GPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYA 650
           GPWP+M+ YER RI+ +FADL+++H++ELA L+T D GK +      ++P    L  YYA
Sbjct: 75  GPWPRMTGYERGRILHRFADLIDEHVEELAALDTVDAGKLFAVGKARDIPGAAHLLRYYA 134

Query: 651 GWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKT 830
           G ADK+HG T+      H  TL EP+GV G I+PWN+P  MF +KVGPALA G  VV+K 
Sbjct: 135 GAADKVHGATLKMAQRMHGYTLKEPVGVVGHIVPWNYPTTMFFFKVGPALAAGCAVVVKP 194

Query: 831 AEQTPLTALYAGKLFHEAGLP 893
           AEQTPL+AL+   L  EAG+P
Sbjct: 195 AEQTPLSALFYAHLAREAGVP 215



>gb:AF348412_1790089 Zea mays cytosolic aldehyde dehydrogenase RF2C
           (rf2c) gene, complete cds.
          Length = 502

 Score =  228 bits (580), Expect = 2e-58
 Identities = 110/201 (54%), Positives = 143/201 (71%)
 Frame = +3

Query: 291 PAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDE 470
           P VEV++T+  I+GKFVD+ SGKTF T DPRT +VIA +AEG   D++ AV AAR+AFD 
Sbjct: 15  PKVEVRFTKLFIDGKFVDAVSGKTFETRDPRTGEVIASIAEGGKADVDLAVKAAREAFDN 74

Query: 471 GPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYA 650
           GPWP+M+ YER RI+ +FADL+++H++ELA L+T D GK +      ++P    L  YYA
Sbjct: 75  GPWPRMTGYERGRILHRFADLIDEHVEELAALDTVDAGKLFAVGKARDIPGAAHLLRYYA 134

Query: 651 GWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKT 830
           G ADK+HG T+      H  TL EP+GV G I+PWN+P  MF +KVGPALA G  VV+K 
Sbjct: 135 GAADKVHGATLKMAQRMHGYTLKEPVGVVGHIVPWNYPTTMFFFKVGPALAAGCAVVVKP 194

Query: 831 AEQTPLTALYAGKLFHEAGLP 893
           AEQTPL+AL+   L  EAG+P
Sbjct: 195 AEQTPLSALFYAHLAREAGVP 215



>gb:AF529165_2067592 Rattus norvegicus mitochondrial aldehyde
           dehydrogenase (Aldh2) mRNA, partial cds; nuclear gene
           for mitochondrial product.
          Length = 488

 Score =  227 bits (579), Expect = 2e-58
 Identities = 112/200 (56%), Positives = 138/200 (69%), Gaps = 1/200 (0%)
 Frame = +3

Query: 300 EVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG-P 476
           EV   Q  IN ++ D+ S KTFPT++P T +VI  VAEG  ED+++AV AA+ AF  G P
Sbjct: 4   EVFCNQIFINNEWHDAVSKKTFPTVNPSTGEVICQVAEGNKEDVDKAVKAAQAAFQLGSP 63

Query: 477 WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW 656
           W +M A +R R++ + ADL+E+    LA LET DNGKPY  +   +L M+++   YYAGW
Sbjct: 64  WRRMDASDRGRLLYRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGW 123

Query: 657 ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAE 836
           ADK HG T+P DG     T HEP+GV GQIIPWNFPL M AWK+GPALA GN VV+K AE
Sbjct: 124 ADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAE 183

Query: 837 QTPLTALYAGKLFHEAGLPP 896
           QTPLTALY   L  EAG PP
Sbjct: 184 QTPLTALYVANLIKEAGFPP 203



>gb:AE017035_383607 Bacillus anthracis str. Ames section 12 of 18 of
           the complete genome.>gb:AE017225_408732 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_453454 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE017355_464611 Bacillus
           thuringiensis serovar konkukian str. 97-27, complete
           genome.>gb:CP000001_853869 Bacillus cereus ZK, complete
           genome.>gb:AE016879_1013312 Bacillus anthracis str. Ames
           complete genome.
          Length = 494

 Score =  227 bits (578), Expect = 3e-58
 Identities = 109/190 (57%), Positives = 135/190 (71%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           +NG F++SASGKTF T +P T + +A V+E   EDI++AV AAR AFDEGPW +MS  ER
Sbjct: 24  VNGSFIESASGKTFNTPNPATGETLAVVSEAGREDIHKAVVAARMAFDEGPWSRMSTAER 83

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
           SR+M K ADL+E+H +ELA LET DNGKP  +   +++P+ +    YYAGWA KI G T+
Sbjct: 84  SRLMYKLADLMEEHKEELAQLETLDNGKPIRETMAADIPLAIEHMRYYAGWATKIVGQTI 143

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
           P  G     T HE +GV GQIIPWNFPL M  WK+G ALA G T+VLK AEQTPL+ALY 
Sbjct: 144 PVSGDFFNYTRHEAVGVVGQIIPWNFPLLMAMWKMGAALATGCTIVLKPAEQTPLSALYL 203

Query: 864 GKLFHEAGLP 893
            +L  EAG P
Sbjct: 204 AELIEEAGFP 213



>pir|S00364|S00364 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 2,
           mitochondrial - horse (tentative sequence)
          Length = 500

 Score =  226 bits (577), Expect = 4e-58
 Identities = 117/214 (54%), Positives = 145/214 (67%), Gaps = 3/214 (1%)
 Frame = +3

Query: 264 AAAVEELVSP--AVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINR 437
           AAA + + +P    EV Y Q  IN ++ D+ S KTFPT++P T +VI  VA G+ ED++R
Sbjct: 2   AAATQAVPAPNQQPEVFYNQIFINNEWHDAVSKKTFPTVNPSTGEVICQVAAGDKEDVDR 61

Query: 438 AVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSE 614
           AV AAR AF  G PW +M A +R R++ + ADL+E+    LA LET DNGKPY  +   +
Sbjct: 62  AVKAARAAFQLGSPWRRMDASDRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVD 121

Query: 615 LPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGP 794
           L M+++   YYAGWADK HG T+P DG     T HEP+GV GQIIPWNFPL M A K+GP
Sbjct: 122 LDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAAKLGP 181

Query: 795 ALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           ALA GN VV+K AEQTPLTALY   L  EAG PP
Sbjct: 182 ALATGNVVVMKVAEQTPLTALYVANLTKEAGFPP 215



>sp|P12762|DHAM_HORSE Aldehyde dehydrogenase, mitochondrial (EC
           1.2.1.3) (ALDH class 2) (ALDHI) (ALDH-E2).
          Length = 500

 Score =  226 bits (577), Expect = 4e-58
 Identities = 117/214 (54%), Positives = 145/214 (67%), Gaps = 3/214 (1%)
 Frame = +3

Query: 264 AAAVEELVSP--AVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINR 437
           AAA + + +P    EV Y Q  IN ++ D+ S KTFPT++P T +VI  VA G+ ED++R
Sbjct: 2   AAATQAVPAPNQQPEVFYNQIFINNEWHDAVSKKTFPTVNPSTGEVICQVAAGDKEDVDR 61

Query: 438 AVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSE 614
           AV AAR AF  G PW +M A +R R++ + ADL+E+    LA LET DNGKPY  +   +
Sbjct: 62  AVKAARAAFQLGSPWRRMDASDRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVD 121

Query: 615 LPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGP 794
           L M+++   YYAGWADK HG T+P DG     T HEP+GV GQIIPWNFPL M A K+GP
Sbjct: 122 LDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAAKLGP 181

Query: 795 ALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           ALA GN VV+K AEQTPLTALY   L  EAG PP
Sbjct: 182 ALATGNVVVMKVAEQTPLTALYVANLTKEAGFPP 215



>gb:BC030589_1979857 Homo sapiens aldehyde dehydrogenase 1 family,
           member A2, transcript variant 2, mRNA (cDNA clone
           MGC:26444 IMAGE:4826743), complete cds.
          Length = 480

 Score =  226 bits (576), Expect = 5e-58
 Identities = 109/201 (54%), Positives = 141/201 (70%), Gaps = 1/201 (0%)
 Frame = +3

Query: 288 SPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFD 467
           +P +E+KYT+  IN ++ +S SG+ FP  +P T + +  V E +  DI++AV AAR AF 
Sbjct: 30  TPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFS 89

Query: 468 EGP-WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY 644
            G  W +M A ER R++ K ADLVE+    LAT+E+ + GKP+ QA   +L  +++ F Y
Sbjct: 90  LGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRY 149

Query: 645 YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVL 824
           YAGWADKIHG+T+P DG +   T HEPIGV GQIIPWNFPL MFAWK+ PAL CGNTVV+
Sbjct: 150 YAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVI 209

Query: 825 KTAEQTPLTALYAGKLFHEAG 887
           K AEQTPL+ALY G L  E G
Sbjct: 210 KPAEQTPLSALYMGALIKEVG 230



>gb:AY398308_2531838 Danio rerio clone RK063A3D05 mitochondrial
           aldehyde dehydrogenase 2 family (ALDH2) mRNA, complete
           cds.
          Length = 516

 Score =  225 bits (574), Expect = 8e-58
 Identities = 109/199 (54%), Positives = 138/199 (69%), Gaps = 1/199 (0%)
 Frame = +3

Query: 300 EVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG-P 476
           +V Y +  IN ++ D+ S KTFPT++P T ++I HVAEG+  D+++AV AAR AF  G P
Sbjct: 32  DVHYNKIFINNEWHDAVSKKTFPTINPATGEIICHVAEGDKADVDKAVKAARDAFKLGSP 91

Query: 477 WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW 656
           W +M A +R  ++ + AD +E+    LA LET DNGKPY  +   ++PM+V+   YYAGW
Sbjct: 92  WRRMDASQRGLLLSRLADCIERDAAYLAELETLDNGKPYAVSFSVDVPMVVKCMRYYAGW 151

Query: 657 ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAE 836
           ADK  G T+P DG +   T HEPIGV GQIIPWNFPL M AWK+GPALA GNTVV+K AE
Sbjct: 152 ADKWEGKTIPIDGNYFCYTRHEPIGVCGQIIPWNFPLLMQAWKLGPALATGNTVVMKVAE 211

Query: 837 QTPLTALYAGKLFHEAGLP 893
           QTPLTALY   L  E G P
Sbjct: 212 QTPLTALYIASLIKEVGFP 230



>gb:AE017273_424071 Bacillus cereus ATCC 10987, section 10 of 18 of
           the complete genome.>gb:AE017194_1062490 Bacillus cereus
           ATCC 10987, complete genome.
          Length = 494

 Score =  225 bits (574), Expect = 8e-58
 Identities = 110/190 (57%), Positives = 134/190 (70%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           ING+FV S SGKTF T +P TEDV+A V E + EDIN AV AAR AF+ GPW +M+  ER
Sbjct: 24  INGEFVPSISGKTFETYNPATEDVLAVVCEAQEEDINVAVKAARSAFESGPWAEMTTAER 83

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
           + ++ K ADL+E+H +ELA LE  DNGKPY+ A   ++   V  + YYAGWA KI G T+
Sbjct: 84  AHLIYKLADLIEEHGEELAQLEALDNGKPYQVALDDDIAATVENYRYYAGWATKIIGQTI 143

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
           P    +   T HEP+GV GQIIPWNFPL M +WK+G ALA G T+VLK AEQTPL+ LY 
Sbjct: 144 PISKDYLNYTRHEPVGVVGQIIPWNFPLVMSSWKMGAALATGCTIVLKPAEQTPLSLLYT 203

Query: 864 GKLFHEAGLP 893
            KLF EAG P
Sbjct: 204 AKLFKEAGFP 213



>gb:AF162770_2477781 Taeniopygia guttata class I aldehyde
           dehydrogenase mRNA, complete cds.
          Length = 517

 Score =  224 bits (572), Expect = 1e-57
 Identities = 112/213 (52%), Positives = 146/213 (68%), Gaps = 3/213 (1%)
 Frame = +3

Query: 267 AAVEELVSPAV--EVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRA 440
           A++  L SP +  E+KYT+  IN ++ +S SG+ FP  +P T + I  + E +  D ++A
Sbjct: 21  ASLHLLPSPTLNLEIKYTKIFINNEWQNSESGRIFPVYNPATGEQICDIQEADKVDTDKA 80

Query: 441 VAAARKAFDEGP-WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSEL 617
           V AAR AF  G  W +M A ER  ++ K ADLVE+    LAT+E+ ++GKP+ QA   +L
Sbjct: 81  VRAARLAFSLGSVWRRMDASERGHLLDKLADLVERDRAILATMESLNSGKPFLQAFYVDL 140

Query: 618 PMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPA 797
             +++   YYAGWADKIHG+T+P DG +   T HEPIGV GQIIPWNFPL MFAWK+ PA
Sbjct: 141 QGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPA 200

Query: 798 LACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           L CGNTVV+K AEQTPL+ALY G L  EAG PP
Sbjct: 201 LCCGNTVVIKPAEQTPLSALYMGALIKEAGFPP 233



>gb:AB037421_1519138 Oryza sativa (japonica cultivar-group) ALDH1a
           mRNA for cytosolic aldehyde dehydrogenase, complete
           cds.>gb:AP003048_1824452 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0710A02.
          Length = 502

 Score =  224 bits (572), Expect = 1e-57
 Identities = 110/201 (54%), Positives = 142/201 (70%)
 Frame = +3

Query: 291 PAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDE 470
           P +E+K+T+  ING+FVD+ SGKTF T DPRT +VIA +AEG+  DI+ AV AAR+AFD 
Sbjct: 15  PKLEIKFTKLFINGRFVDAVSGKTFETRDPRTGEVIAKIAEGDKADIDLAVKAAREAFDH 74

Query: 471 GPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYA 650
           GPWP+MS + R RI+ KFADLVE+H++ELA L+T D GK +      ++P    L  YYA
Sbjct: 75  GPWPRMSGFARGRILHKFADLVEQHVEELAALDTVDAGKLFAMGKLVDIPGGANLLRYYA 134

Query: 651 GWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKT 830
           G ADK+HG T+    P H  TL EP+GV G I+PWN+P  MF +K  PALA G T+V+K 
Sbjct: 135 GAADKVHGETLKMARPCHGYTLKEPVGVVGHIVPWNYPTTMFFFKASPALAAGCTMVVKP 194

Query: 831 AEQTPLTALYAGKLFHEAGLP 893
           AEQTPL+AL+   L   AG+P
Sbjct: 195 AEQTPLSALFYAHLAKLAGVP 215



>sp|P27463|DHA1_CHICK Aldehyde dehydrogenase 1A1 (EC 1.2.1.3)
           (Aldehyde dehydrogenase, cytosolic) (ALDH class
           1).>pir|S14629|S14629 aldehyde dehydrogenase (NAD) (EC
           1.2.1.3) 1, cytosolic - chicken>gb:GGADHR_2572902 Gallus
           gallus mRNA for aldehyde dehydrogenase 1 (aldh1 gene).
          Length = 509

 Score =  224 bits (572), Expect = 1e-57
 Identities = 112/201 (55%), Positives = 136/201 (67%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           +++KYT+  IN ++ DS SGK F   +P  E+ I  VAEG+  DI++AV AARKAF+ G 
Sbjct: 24  LKIKYTKIFINNEWHDSVSGKKFEVFNPANEEKICEVAEGDKADIDKAVKAARKAFELGS 83

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A ER R++ K ADLVE+    LAT+E  D GK +  A   +L   ++   Y AG
Sbjct: 84  PWRTMDASERGRLLNKLADLVERDRLTLATMEAIDGGKLFSTAYLMDLGACIKTIRYCAG 143

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKIHG TVP DG     T HEP+GV GQIIPWNFPL MF WK+ PAL CGNTVV+K A
Sbjct: 144 WADKIHGRTVPMDGNFFTFTRHEPVGVCGQIIPWNFPLVMFIWKIAPALCCGNTVVVKPA 203

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPL+ALY G L  EAG PP
Sbjct: 204 EQTPLSALYMGSLIKEAGFPP 224



>gb:AP003617_1831493 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0502H06.
          Length = 526

 Score =  224 bits (571), Expect = 2e-57
 Identities = 113/198 (57%), Positives = 141/198 (71%)
 Frame = +3

Query: 300 EVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPW 479
           E++YT+  ING+FVD+ASGKTF T DPRT DVIA VAEG+ ED++ AV AAR+AFD G W
Sbjct: 42  EIRYTKLFINGRFVDAASGKTFETRDPRTGDVIARVAEGDKEDVDLAVKAAREAFDHGEW 101

Query: 480 PKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWA 659
           P+MS  ER R+M K+A++VE+H DELA LE+ D GKP   A   ++   V +  Y+AG A
Sbjct: 102 PRMSGSERGRVMAKYAEVVERHADELAALESLDAGKPLAAARAVDVGECVGILRYFAGAA 161

Query: 660 DKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQ 839
           DKIHG T+         TL EP+GVAG I+PWNFP  MF  KV PALA G TVV+K AEQ
Sbjct: 162 DKIHGETLKMSRQLQGYTLREPLGVAGLIVPWNFPAIMFFSKVSPALAAGCTVVVKPAEQ 221

Query: 840 TPLTALYAGKLFHEAGLP 893
           TPL+AL+   L  +AG+P
Sbjct: 222 TPLSALFLAHLSKQAGVP 239



>gb:CSA549290_1673847 Crocus sativus mRNA for aldehyde dehydrogenase
           (adh gene).
          Length = 506

 Score =  224 bits (571), Expect = 2e-57
 Identities = 113/198 (57%), Positives = 137/198 (69%)
 Frame = +3

Query: 300 EVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPW 479
           E+K+T+  ING+FVDS SG TF T DPR  DVIA++AEG+ ED++ AV AAR+AFD G W
Sbjct: 22  EIKFTKLFINGEFVDSVSGSTFETRDPRNGDVIANIAEGDKEDVDLAVKAAREAFDHGKW 81

Query: 480 PKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWA 659
           P+MS YER RIM+KFADL+E  ++ELA L+T D GK        ++P  V +  YYAG A
Sbjct: 82  PRMSGYERGRIMMKFADLIEAFIEELAALDTLDAGKLLSMGKAVDIPAAVHIIRYYAGAA 141

Query: 660 DKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQ 839
           DKIHG T+         TL EPIGV G IIPWNFP  MF  KV PALA G T+V+K AEQ
Sbjct: 142 DKIHGYTLKLSSELQGYTLKEPIGVVGVIIPWNFPTTMFFLKVSPALAAGCTMVVKPAEQ 201

Query: 840 TPLTALYAGKLFHEAGLP 893
           TPL+ALY   L   AG+P
Sbjct: 202 TPLSALYYAHLAKLAGVP 219



>sp|O93344|DHAS_CHICK Aldehyde dehydrogenase 1A2 (EC 1.2.1.3)
           (Retinaldehyde-specific dehydrogenase type 2)
           (RALDH(II)) (RALDH-2).>gb:AF064253_2471394 Gallus gallus
           retinaldehyde dehydrogenase 2 (RALDH2) mRNA, complete
           cds.>gb:AF181680_2478897 Gallus gallus retinaldehyde
           dehydrogenase 2 (Raldh2) mRNA, complete cds.
          Length = 499

 Score =  224 bits (571), Expect = 2e-57
 Identities = 111/213 (52%), Positives = 147/213 (69%), Gaps = 3/213 (1%)
 Frame = +3

Query: 267 AAVEELVSPAV--EVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRA 440
           A++  L SP +  E+K+T+  IN ++ +S SG+ FP  +P T + I  + E +  D ++A
Sbjct: 2   ASLHLLPSPTLNLEIKHTKIFINNEWQNSESGRVFPVYNPATGEQICEIQEADKVDTDKA 61

Query: 441 VAAARKAFDEGP-WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSEL 617
           V AAR AF  G  W +M A ER +++ K ADLVE+    LAT+E+ ++GKP+ QA   +L
Sbjct: 62  VRAARLAFSLGSVWRRMDASERGQLLDKLADLVERDRAVLATMESLNSGKPFLQAFYVDL 121

Query: 618 PMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPA 797
             +++   YYAGWADKIHG+T+P DG +   T HEPIGV GQIIPWNFPL MFAWK+ PA
Sbjct: 122 QGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPA 181

Query: 798 LACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           L CGNTVV+K AEQTPL+ALY G L  EAG PP
Sbjct: 182 LCCGNTVVIKPAEQTPLSALYMGALIKEAGFPP 214



>gb:AE017007_377739 Bacillus cereus ATCC 14579 section 10 of 18 of
           the complete genome.>gb:AE016877_1017989 Bacillus cereus
           ATCC 14579 complete genome.
          Length = 494

 Score =  223 bits (569), Expect = 3e-57
 Identities = 111/206 (53%), Positives = 139/206 (67%), Gaps = 3/206 (1%)
 Frame = +3

Query: 285 VSPAVEVKYTQHI---INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR 455
           + P VE    + I   ING+FV +  GKTF T +P TEDV+A V E + EDI+ AV AAR
Sbjct: 8   LKPKVEAFLNEEIKMFINGEFVAAIGGKTFETYNPATEDVLAVVCEAQEEDIDAAVKAAR 67

Query: 456 KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL 635
            AF+ GPW +M+  ER+ ++ K ADL+E+H +ELA LE  DNGKPY+ A   ++   V  
Sbjct: 68  SAFESGPWAEMTTAERAHLIYKLADLIEEHREELAQLEALDNGKPYQVALDDDISATVEN 127

Query: 636 FHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNT 815
           + YYAGWA KI G T+P    +   T HEP+GV GQIIPWNFPL M +WK+G ALA G T
Sbjct: 128 YRYYAGWATKIIGQTIPISKDYLNYTRHEPVGVVGQIIPWNFPLVMSSWKMGAALATGCT 187

Query: 816 VVLKTAEQTPLTALYAGKLFHEAGLP 893
           +VLK AEQTPL+ LY  KLF EAG P
Sbjct: 188 IVLKPAEQTPLSLLYTAKLFKEAGFP 213



>gb:AF003341_1875821 Homo sapiens aldehyde dehydrogenase 1 (ALDH1)
           mRNA, complete cds.
          Length = 501

 Score =  223 bits (568), Expect = 4e-57
 Identities = 108/201 (53%), Positives = 138/201 (68%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           ++++YT+  IN ++ DS SGK FP  +P TE+ +  V EG+ ED+++AV AAR+AF  G 
Sbjct: 16  LKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGS 75

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A ER R++ K ADL+E+    LAT+E+ + GK Y  A  S+L   ++   Y AG
Sbjct: 76  PWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLSDLAGCIKTLRYCAG 135

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKI G T+P DG     T HEPIGV GQIIPWNFPL M  WK+GPAL+CGNTVV+K A
Sbjct: 136 WADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPA 195

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTAL+   L  EAG PP
Sbjct: 196 EQTPLTALHVASLIKEAGFPP 216



>gb:BC076716_2559463 Xenopus laevis aldehyde dehydrogenase class 1,
           mRNA (cDNA clone MGC:79912 IMAGE:4031362), complete cds.
          Length = 502

 Score =  223 bits (567), Expect = 5e-57
 Identities = 104/201 (51%), Positives = 141/201 (70%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP 476
           +E+KYT+  IN ++ +S SGK FP  +P T + I  V EG+ ED+N+AV AA++AF  G 
Sbjct: 17  LEIKYTKIFINNEWHNSVSGKKFPVYNPATGEKICEVEEGDKEDVNKAVKAAKEAFQIGS 76

Query: 477 -WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
            W ++ A ER R++ + ADLVE+    L+T+E+ D GKP+  +   ++P  ++   Y AG
Sbjct: 77  AWRRLDASERGRMLNRLADLVERDRLILSTMESIDGGKPFAASYYGDIPGAIKSLRYCAG 136

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADK+ G T+P DG +   T HEP+GV GQIIPWNFPL MF+WK+ PAL CGNTVV+K A
Sbjct: 137 WADKVQGRTIPMDGDYFTFTRHEPVGVCGQIIPWNFPLLMFSWKIAPALCCGNTVVIKPA 196

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTA+Y G L  EAG+PP
Sbjct: 197 EQTPLTAIYMGSLIKEAGIPP 217



>gb:S71509_2139106 Mus sp. aldehyde dehydrogenase AHD-M1 mRNA,
           complete cds.
          Length = 517

 Score =  223 bits (567), Expect = 5e-57
 Identities = 115/219 (52%), Positives = 144/219 (65%), Gaps = 2/219 (0%)
 Frame = +3

Query: 246 IQRFSTAAAVEELVSP--AVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGE 419
           + R  +AAA   + +P    EV   Q  IN ++ D+ S KTFPT++P T +VI  VAEG 
Sbjct: 15  LSRLLSAAATSAVPAPNHQPEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGN 74

Query: 420 AEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQ 599
            ED+++AV AAR      PW +M A +R R++ + ADL+E+    LA LET DNGKPY  
Sbjct: 75  KEDVDKAVKAARACQLGSPWRRMDASDRGRLLYRLADLIERDRTYLAALETLDNGKPYVI 134

Query: 600 AAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFA 779
           +   +L M+++   YYAGWADK HG T+P DG     T HEP+GV GQIIPWNFPL M A
Sbjct: 135 SYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGV-GQIIPWNFPLLMQA 193

Query: 780 WKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           WK+GPALA GN VV+K AEQTPLTALY   L  EAG PP
Sbjct: 194 WKLGPALATGNVVVMKVAEQTPLTALYVANLSKEAGFPP 232



>gb:AP003048_1824454 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0710A02.
          Length = 507

 Score =  223 bits (567), Expect = 5e-57
 Identities = 117/210 (55%), Positives = 144/210 (68%)
 Frame = +3

Query: 264 AAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAV 443
           AA    LV P  E+K+T+  ING+FVD+ASGKTF T DPRT DV+AH+AE +  D++ AV
Sbjct: 13  AAGGGGLVVP--EIKFTKLFINGEFVDAASGKTFKTRDPRTGDVLAHIAEADKADVDLAV 70

Query: 444 AAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPM 623
            AAR+AF+ G WP+MS YERSR+M K ADLVE+H DELA L+  D GK        ++P 
Sbjct: 71  KAAREAFEHGKWPRMSGYERSRVMNKLADLVEQHADELAALDGADAGKLLTLGKIIDMPA 130

Query: 624 IVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALA 803
             ++  YYAG ADKIHG ++   G +   TL EPIGV G IIPWNFP  MF  KV PALA
Sbjct: 131 AAQMMRYYAGAADKIHGESLRVAGKYQGYTLREPIGVVGVIIPWNFPTMMFFLKVSPALA 190

Query: 804 CGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
            G T+V+K AEQTPL+ALY   L   AG+P
Sbjct: 191 AGCTIVVKPAEQTPLSALYYAHLAKLAGVP 220



>gb:AE017355_463892 Bacillus thuringiensis serovar konkukian str.
           97-27, complete genome.
          Length = 494

 Score =  222 bits (566), Expect = 7e-57
 Identities = 109/190 (57%), Positives = 134/190 (70%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           ING+FV S SGKTF T +P TEDV+A V E + EDI+ AV AAR AF+ GPW +M+  ER
Sbjct: 24  INGEFVPSISGKTFETYNPATEDVLAVVYEAQEEDIDVAVKAARSAFESGPWVEMTTAER 83

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
           + ++ K ADL+E+H +ELA LE  DNGKPY+ A   ++   V  + YYAGWA KI G T+
Sbjct: 84  AHLIYKLADLIEEHGEELAQLEALDNGKPYQVALDDDIAATVENYRYYAGWATKIIGQTI 143

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
           P    +   T HEP+GV GQIIPWNFPL M +WK+G ALA G T+VLK AEQTPL+ LY 
Sbjct: 144 PISKDYLNYTRHEPVGVVGQIIPWNFPLVMSSWKMGAALATGCTIVLKPAEQTPLSLLYT 203

Query: 864 GKLFHEAGLP 893
            KLF EAG P
Sbjct: 204 AKLFKEAGFP 213



>gb:AE017033_382905 Bacillus anthracis str. Ames section 10 of 18 of
           the complete genome.>gb:AE017225_408026 Bacillus
           anthracis str. Sterne, complete
           genome.>gb:AE017334_452753 Bacillus anthracis str. 'Ames
           Ancestor', complete genome.>gb:AE016879_1012610 Bacillus
           anthracis str. Ames complete genome.
          Length = 494

 Score =  222 bits (566), Expect = 7e-57
 Identities = 109/190 (57%), Positives = 134/190 (70%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           ING+FV S SGKTF T +P TEDV+A V E + EDI+ AV AAR AF+ GPW +M+  ER
Sbjct: 24  INGEFVPSISGKTFETYNPATEDVLAVVYEAQEEDIDVAVKAARSAFESGPWVEMTTAER 83

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
           + ++ K ADL+E+H +ELA LE  DNGKPY+ A   ++   V  + YYAGWA KI G T+
Sbjct: 84  AHLIYKLADLIEEHGEELAQLEALDNGKPYQVALDDDIAATVENYRYYAGWATKIIGQTI 143

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
           P    +   T HEP+GV GQIIPWNFPL M +WK+G ALA G T+VLK AEQTPL+ LY 
Sbjct: 144 PISKDYLNYTRHEPVGVVGQIIPWNFPLVMSSWKMGAALATGCTIVLKPAEQTPLSLLYT 203

Query: 864 GKLFHEAGLP 893
            KLF EAG P
Sbjct: 204 AKLFKEAGFP 213



>pir|JC5553|JC5553 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) -
           rat>gb:AF001896_2050051 Rattus norvegicus aldehyde
           dehydrogenase (ALDH) mRNA, complete
           cds.>gb:AF001897_2050052 Rattus norvegicus aldehyde
           dehydrogenase (ALDH) mRNA, complete
           cds.>gb:AF001898_2050053 Rattus norvegicus aldehyde
           dehydrogenase (ALDH) mRNA, complete
           cds.>gb:BC061526_2104509 Rattus norvegicus aldehyde
           dehydrogenase family 1, member A1, mRNA (cDNA clone
           MGC:72648 IMAGE:6921926), complete
           cds.>gb:RNU79118_2137805 Rattus norvegicus aldehyde
           dehydrogenase mRNA, complete cds.
          Length = 501

 Score =  222 bits (566), Expect = 7e-57
 Identities = 110/201 (54%), Positives = 141/201 (70%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           +++++T+  IN ++ DS SGK FP L+P TE+VI HV EG+  D+++AV AAR+AF  G 
Sbjct: 16  LKIQHTKIFINNEWHDSVSGKKFPVLNPATEEVICHVEEGDKADVDKAVKAARQAFQIGS 75

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A ER R++ K ADL+E+    LAT+E  + GK +  A  S+L   ++   Y AG
Sbjct: 76  PWRTMDASERGRLLNKLADLMERDRLLLATIEAINGGKVFANAYLSDLGGSIKALKYCAG 135

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKIHG T+P+DG     T  EPIGV GQIIPWNFPL MF WK+GPAL+CGNTVV+K A
Sbjct: 136 WADKIHGQTIPSDGDIFTFTRREPIGVCGQIIPWNFPLLMFIWKIGPALSCGNTVVVKPA 195

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTAL+   L  EAG PP
Sbjct: 196 EQTPLTALHMASLIKEAGFPP 216



>sp|P51647|DHA1_RAT Aldehyde dehydrogenase 1A1 (EC 1.2.1.3)
           (Aldehyde dehydrogenase, cytosolic) (ALDH class 1)
           (Retinal dehydrogenase) (RALDH) (RalDH1).
          Length = 500

 Score =  222 bits (566), Expect = 7e-57
 Identities = 110/201 (54%), Positives = 141/201 (70%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           +++++T+  IN ++ DS SGK FP L+P TE+VI HV EG+  D+++AV AAR+AF  G 
Sbjct: 15  LKIQHTKIFINNEWHDSVSGKKFPVLNPATEEVICHVEEGDKADVDKAVKAARQAFQIGS 74

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A ER R++ K ADL+E+    LAT+E  + GK +  A  S+L   ++   Y AG
Sbjct: 75  PWRTMDASERGRLLNKLADLMERDRLLLATIEAINGGKVFANAYLSDLGGSIKALKYCAG 134

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKIHG T+P+DG     T  EPIGV GQIIPWNFPL MF WK+GPAL+CGNTVV+K A
Sbjct: 135 WADKIHGQTIPSDGDIFTFTRREPIGVCGQIIPWNFPLLMFIWKIGPALSCGNTVVVKPA 194

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTAL+   L  EAG PP
Sbjct: 195 EQTPLTALHMASLIKEAGFPP 215



>gb:BT007808_2150740 Synthetic construct Homo sapiens aldehyde
           dehydrogenase 1 family, member A1 mRNA, partial cds.
          Length = 502

 Score =  222 bits (565), Expect = 9e-57
 Identities = 107/201 (53%), Positives = 138/201 (68%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           ++++YT+  IN ++ DS SGK FP  +P TE+ +  V EG+ ED+++AV AAR+AF  G 
Sbjct: 16  LKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGS 75

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A ER R++ K ADL+E+    LAT+E+ + GK Y  A  ++L   ++   Y AG
Sbjct: 76  PWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAG 135

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKI G T+P DG     T HEPIGV GQIIPWNFPL M  WK+GPAL+CGNTVV+K A
Sbjct: 136 WADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPA 195

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTAL+   L  EAG PP
Sbjct: 196 EQTPLTALHVASLIKEAGFPP 216



>gb:AL591031_1929964 Human DNA sequence from clone RP11-151D14 on
           chromosome 9q13-21.2 Contains a novel gene and the
           ALDH1A1 gene for aldehyde dehydrogenase 1 family member
           A1, complete sequence.
          Length = 238

 Score =  222 bits (565), Expect = 9e-57
 Identities = 107/201 (53%), Positives = 138/201 (68%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           ++++YT+  IN ++ DS SGK FP  +P TE+ +  V EG+ ED+++AV AAR+AF  G 
Sbjct: 16  LKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGS 75

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A ER R++ K ADL+E+    LAT+E+ + GK Y  A  ++L   ++   Y AG
Sbjct: 76  PWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAG 135

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKI G T+P DG     T HEPIGV GQIIPWNFPL M  WK+GPAL+CGNTVV+K A
Sbjct: 136 WADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPA 195

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTAL+   L  EAG PP
Sbjct: 196 EQTPLTALHVASLIKEAGFPP 216



>gb:AL591031_1929963 Human DNA sequence from clone RP11-151D14 on
           chromosome 9q13-21.2 Contains a novel gene and the
           ALDH1A1 gene for aldehyde dehydrogenase 1 family member
           A1, complete sequence.
          Length = 230

 Score =  222 bits (565), Expect = 9e-57
 Identities = 107/201 (53%), Positives = 138/201 (68%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           ++++YT+  IN ++ DS SGK FP  +P TE+ +  V EG+ ED+++AV AAR+AF  G 
Sbjct: 16  LKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGS 75

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A ER R++ K ADL+E+    LAT+E+ + GK Y  A  ++L   ++   Y AG
Sbjct: 76  PWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAG 135

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKI G T+P DG     T HEPIGV GQIIPWNFPL M  WK+GPAL+CGNTVV+K A
Sbjct: 136 WADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPA 195

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTAL+   L  EAG PP
Sbjct: 196 EQTPLTALHVASLIKEAGFPP 216



>pir|A33371|DEHUE1 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 1,
           cytosolic [validated] - human>gb:AL591031_1929961 Human
           DNA sequence from clone RP11-151D14 on chromosome
           9q13-21.2 Contains a novel gene and the ALDH1A1 gene for
           aldehyde dehydrogenase 1 family member A1, complete
           sequence.>gb:AL591031_1929962 Human DNA sequence from
           clone RP11-151D14 on chromosome 9q13-21.2 Contains a
           novel gene and the ALDH1A1 gene for aldehyde
           dehydrogenase 1 family member A1, complete
           sequence.>gb:AY338497_1944176 Homo sapiens aldehyde
           dehydrogenase 1 family, member A1 (ALDH1A1) gene,
           complete cds.>gb:AY390731_1948914 Homo sapiens aldehyde
           dehydrogenase 1 A1 mRNA, complete
           cds.>gb:BC001505_1967642 Homo sapiens aldehyde
           dehydrogenase 1 family, member A1, mRNA (cDNA clone
           MGC:2318 IMAGE:2988388), complete
           cds.>gb:BT006921_1990359 Homo sapiens aldehyde
           dehydrogenase 1 family, member A1 mRNA, complete
           cds.>gb:HUMALDC13_2029121 Homo sapiens aldehyde
           dehydrogenase (ALDH1) gene, exon 13 and complete cds.
          Length = 501

 Score =  222 bits (565), Expect = 9e-57
 Identities = 107/201 (53%), Positives = 138/201 (68%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           ++++YT+  IN ++ DS SGK FP  +P TE+ +  V EG+ ED+++AV AAR+AF  G 
Sbjct: 16  LKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGS 75

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A ER R++ K ADL+E+    LAT+E+ + GK Y  A  ++L   ++   Y AG
Sbjct: 76  PWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAG 135

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKI G T+P DG     T HEPIGV GQIIPWNFPL M  WK+GPAL+CGNTVV+K A
Sbjct: 136 WADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPA 195

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTAL+   L  EAG PP
Sbjct: 196 EQTPLTALHVASLIKEAGFPP 216



>sp|P00352|DHA1_HUMAN Aldehyde dehydrogenase 1A1 (EC 1.2.1.3)
           (Aldehyde dehydrogenase, cytosolic) (ALDH class 1)
           (Retinal dehydrogenase 1) (ALHDII) (ALDH- E1).
          Length = 500

 Score =  222 bits (565), Expect = 9e-57
 Identities = 107/201 (53%), Positives = 138/201 (68%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           ++++YT+  IN ++ DS SGK FP  +P TE+ +  V EG+ ED+++AV AAR+AF  G 
Sbjct: 15  LKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGS 74

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A ER R++ K ADL+E+    LAT+E+ + GK Y  A  ++L   ++   Y AG
Sbjct: 75  PWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAG 134

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKI G T+P DG     T HEPIGV GQIIPWNFPL M  WK+GPAL+CGNTVV+K A
Sbjct: 135 WADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPA 194

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTAL+   L  EAG PP
Sbjct: 195 EQTPLTALHVASLIKEAGFPP 215



>gb:CR860845_1184893 Pongo pygmaeus mRNA; cDNA DKFZp469B0514 (from
           clone DKFZp469B0514).
          Length = 501

 Score =  221 bits (564), Expect = 1e-56
 Identities = 107/201 (53%), Positives = 138/201 (68%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           ++++YT+  IN ++ DS SGK FP  +P TE+ +  V EG+ ED+++AV AAR+AF  G 
Sbjct: 16  LKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGS 75

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A ER R++ K ADL+E+    LAT+E+ + GK Y  A  ++L   ++   Y AG
Sbjct: 76  PWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAG 135

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKI G T+P DG     T HEPIGV GQIIPWNFPL M  WK+GPAL+CGNTVV+K A
Sbjct: 136 WADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPA 195

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTAL+   L  EAG PP
Sbjct: 196 EQTPLTALHVASLVKEAGFPP 216



>gb:AE017333_448092 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_857900 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 498

 Score =  221 bits (564), Expect = 1e-56
 Identities = 108/190 (56%), Positives = 133/190 (70%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           ING+FV SAS KTF T +P T + +A + E   ED+++AV AAR+AFD G W  M+  ER
Sbjct: 27  INGEFVASASNKTFETPNPATGETLATLYEAGPEDVDKAVKAAREAFDRGEWRTMNPAER 86

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
           SR+M K ADL+E+H  ELA LET DNGKP  +    ++P+ +    YYAGWA KI G T+
Sbjct: 87  SRLMYKLADLMEEHKTELAQLETLDNGKPISETTAGDIPLSIEHMRYYAGWATKITGQTI 146

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
           P +GP+   T HEP+GV GQIIPWNFPL M  WK+G ALA G TVVLK AEQTPL+ALY 
Sbjct: 147 PVNGPYFNYTRHEPVGVVGQIIPWNFPLLMAMWKMGAALAAGCTVVLKPAEQTPLSALYL 206

Query: 864 GKLFHEAGLP 893
            +L  EAG P
Sbjct: 207 AELIDEAGFP 216



>gb:BC054386_2101670 Mus musculus aldehyde dehydrogenase family 1,
           subfamily A1, mRNA (cDNA clone MGC:62611 IMAGE:6477503),
           complete cds.
          Length = 501

 Score =  221 bits (563), Expect = 1e-56
 Identities = 108/201 (53%), Positives = 141/201 (70%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           +++++T+  IN ++ +S SGK FP L+P TE+VI HV EG+  D+++AV AAR+AF  G 
Sbjct: 16  LKIQHTKIFINNEWHNSVSGKKFPVLNPATEEVICHVEEGDKADVDKAVKAARQAFQIGS 75

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A ER R++ K ADL+E+    LAT+E  + GK +  A  S+L   ++   Y AG
Sbjct: 76  PWRTMDASERGRLLNKLADLMERDRLLLATMEALNGGKVFANAYLSDLGGCIKALKYCAG 135

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKIHG T+P+DG     T  EPIGV GQIIPWNFP+ MF WK+GPAL+CGNTVV+K A
Sbjct: 136 WADKIHGQTIPSDGDIFTYTRREPIGVCGQIIPWNFPMLMFIWKIGPALSCGNTVVVKPA 195

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTAL+   L  EAG PP
Sbjct: 196 EQTPLTALHLASLIKEAGFPP 216



>gb:BC044729_2099010 Mus musculus aldehyde dehydrogenase family 1,
           subfamily A1, mRNA (cDNA clone IMAGE:5098781), partial
           cds.
          Length = 511

 Score =  221 bits (563), Expect = 1e-56
 Identities = 108/201 (53%), Positives = 141/201 (70%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           +++++T+  IN ++ +S SGK FP L+P TE+VI HV EG+  D+++AV AAR+AF  G 
Sbjct: 26  LKIQHTKIFINNEWHNSVSGKKFPVLNPATEEVICHVEEGDKADVDKAVKAARQAFQIGS 85

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A ER R++ K ADL+E+    LAT+E  + GK +  A  S+L   ++   Y AG
Sbjct: 86  PWRTMDASERGRLLNKLADLMERDRLLLATMEALNGGKVFANAYLSDLGGCIKALKYCAG 145

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKIHG T+P+DG     T  EPIGV GQIIPWNFP+ MF WK+GPAL+CGNTVV+K A
Sbjct: 146 WADKIHGQTIPSDGDIFTYTRREPIGVCGQIIPWNFPMLMFIWKIGPALSCGNTVVVKPA 205

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTAL+   L  EAG PP
Sbjct: 206 EQTPLTALHLASLIKEAGFPP 226



>gb:AP004888_1846660 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC
           clone:P0617A09.>gb:AP005751_1857173 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0072H09.
          Length = 421

 Score =  221 bits (563), Expect = 1e-56
 Identities = 99/132 (75%), Positives = 110/132 (83%)
 Frame = +3

Query: 498 ERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGL 677
           ER R++L+FADL+E+H DE+A LETWD GK  EQ   +E+PM+ R   YY GWADKIHGL
Sbjct: 3   ERCRVLLRFADLIEQHADEIAALETWDGGKTLEQTTGTEVPMVARYMRYYGGWADKIHGL 62

Query: 678 TVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTAL 857
            VPADGPHHVQ LHEPIGVAGQIIPWNFPL MFAWKVGPALACGN VVLKTAEQTPL+AL
Sbjct: 63  VVPADGPHHVQVLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNAVVLKTAEQTPLSAL 122

Query: 858 YAGKLFHEAGLP 893
           +   L HEAGLP
Sbjct: 123 FVASLLHEAGLP 134



>sp|P24549|DHA1_MOUSE Aldehyde dehydrogenase 1A1 (EC 1.2.1.3)
           (Aldehyde dehydrogenase, cytosolic) (ALDH class 1)
           (ALHDII) (ALDH-E1).
          Length = 500

 Score =  221 bits (563), Expect = 1e-56
 Identities = 108/201 (53%), Positives = 141/201 (70%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           +++++T+  IN ++ +S SGK FP L+P TE+VI HV EG+  D+++AV AAR+AF  G 
Sbjct: 15  LKIQHTKIFINNEWHNSVSGKKFPVLNPATEEVICHVEEGDKADVDKAVKAARQAFQIGS 74

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A ER R++ K ADL+E+    LAT+E  + GK +  A  S+L   ++   Y AG
Sbjct: 75  PWRTMDASERGRLLNKLADLMERDRLLLATMEALNGGKVFANAYLSDLGGCIKALKYCAG 134

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKIHG T+P+DG     T  EPIGV GQIIPWNFP+ MF WK+GPAL+CGNTVV+K A
Sbjct: 135 WADKIHGQTIPSDGDIFTYTRREPIGVCGQIIPWNFPMLMFIWKIGPALSCGNTVVVKPA 194

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTAL+   L  EAG PP
Sbjct: 195 EQTPLTALHLASLIKEAGFPP 215



>gb:BC055244_2551323 Danio rerio zgc:63786, mRNA (cDNA clone
           MGC:63786 IMAGE:2644084), complete cds.
          Length = 516

 Score =  221 bits (562), Expect = 2e-56
 Identities = 110/199 (55%), Positives = 137/199 (68%), Gaps = 1/199 (0%)
 Frame = +3

Query: 300 EVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG-P 476
           +V Y +  IN ++ D+ S KTFPT++P T +VI HVAEG+  D+++AV AAR AF  G P
Sbjct: 32  DVHYNKIFINNEWHDAVSKKTFPTINPATAEVICHVAEGDKADVDKAVKAARDAFKLGSP 91

Query: 477 WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW 656
           W +M A +R  ++ + AD +E+    LA LET DNGKPY  +   +LPM+V+   YYAGW
Sbjct: 92  WRRMDASQRGLLLNRLADCIERDAAYLAELETLDNGKPYTLSFCVDLPMVVKCLRYYAGW 151

Query: 657 ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAE 836
           ADK  G T+P DG +   T HEPIGV GQIIPWNFPL M A K+GPALA GNTVV+K AE
Sbjct: 152 ADKWEGKTIPIDGNYFCYTRHEPIGVCGQIIPWNFPLLMQALKLGPALATGNTVVMKVAE 211

Query: 837 QTPLTALYAGKLFHEAGLP 893
           QTPLTALY   L  E G P
Sbjct: 212 QTPLTALYIASLIKEVGFP 230



>gb:AF260121_2483050 Danio rerio aldehyde dehydrogenase 2 precursor
           (ALDH2) mRNA, complete cds; nuclear gene for
           mitochondrial product.
          Length = 516

 Score =  221 bits (562), Expect = 2e-56
 Identities = 110/199 (55%), Positives = 137/199 (68%), Gaps = 1/199 (0%)
 Frame = +3

Query: 300 EVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG-P 476
           +V Y +  IN ++ D+ S KTFPT++P T +VI HVAEG+  D+++AV AAR AF  G P
Sbjct: 32  DVHYNKIFINNEWHDAVSKKTFPTINPATAEVICHVAEGDKADVDKAVKAARDAFKLGSP 91

Query: 477 WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW 656
           W +M A +R  ++ + AD +E+    LA LET DNGKPY  +   +LPM+V+   YYAGW
Sbjct: 92  WRRMDASQRGLLLNRLADCIERDAAYLAELETLDNGKPYTLSFCVDLPMVVKCLRYYAGW 151

Query: 657 ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAE 836
           ADK  G T+P DG +   T HEPIGV GQIIPWNFPL M A K+GPALA GNTVV+K AE
Sbjct: 152 ADKWEGKTIPIDGNYFCYTRHEPIGVCGQIIPWNFPLLMQALKLGPALATGNTVVMKVAE 211

Query: 837 QTPLTALYAGKLFHEAGLP 893
           QTPLTALY   L  E G P
Sbjct: 212 QTPLTALYIASLIKEVGFP 230



>gb:CP000001_853165 Bacillus cereus ZK, complete genome.
          Length = 494

 Score =  220 bits (561), Expect = 3e-56
 Identities = 108/190 (56%), Positives = 133/190 (70%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           ING+FV S  GKTF T +P TEDV+A V E + EDI+ AV AAR AF+ GPW +M+  ER
Sbjct: 24  INGEFVPSIRGKTFETYNPATEDVLAVVYEAQEEDIDVAVKAARSAFESGPWVEMTTAER 83

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
           + ++ K ADL+E+H +ELA LE  DNGKPY+ A   ++   V  + YYAGWA KI G T+
Sbjct: 84  AHLIYKLADLIEEHGEELAQLEALDNGKPYQVALDDDIAATVENYRYYAGWATKIIGQTI 143

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
           P    +   T HEP+GV GQIIPWNFPL M +WK+G ALA G T+VLK AEQTPL+ LY 
Sbjct: 144 PISKDYLNYTRHEPVGVVGQIIPWNFPLVMSSWKMGAALATGCTIVLKPAEQTPLSLLYT 203

Query: 864 GKLFHEAGLP 893
            KLF EAG P
Sbjct: 204 AKLFKEAGFP 213



>gb:HSALDHI1_2010483 Human RNA for mitochondrial aldehyde
           dehydrogenase I ALDH I (EC 1.2.1.3).
          Length = 516

 Score =  220 bits (560), Expect = 3e-56
 Identities = 113/219 (51%), Positives = 143/219 (65%), Gaps = 3/219 (1%)
 Frame = +3

Query: 249 QRFSTAAAVEELVSP--AVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEA 422
           +R  +AAA + + +P    EV   Q  IN ++ D+ S KTFPT++P T +VI  VAEG+ 
Sbjct: 13  RRLLSAAATQAVPAPNQQPEVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDK 72

Query: 423 EDINRAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQ 599
           ED+++A      AF  G PW +M A    R++ + ADL+E+    LA LET DNGKPY  
Sbjct: 73  EDVDKAREGRPGAFQLGSPWRRMDASHSGRLLNRLADLIERDRTYLAALETLDNGKPYVI 132

Query: 600 AAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFA 779
           +   +L M+++   YYAGWADK HG T+P DG     T HEP+GV GQIIPWNFPL M A
Sbjct: 133 SYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQA 192

Query: 780 WKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           WK+GPALA GN VV+K AEQTPLTALY   L  EAG PP
Sbjct: 193 WKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPP 231



>gb:AF148508_1245135 Placopecten magellanicus aldehyde dehydrogenase
           mRNA, complete cds.>gb:AF175578_1247684 Placopecten
           magellanicus omega-crystallin mRNA, complete cds.
          Length = 492

 Score =  220 bits (560), Expect = 3e-56
 Identities = 103/200 (51%), Positives = 138/200 (69%), Gaps = 1/200 (0%)
 Frame = +3

Query: 300 EVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP- 476
           E++Y Q  IN ++V++ASGKTFP ++P T   I  + EG+  D+++AVAAA++AF+ G  
Sbjct: 9   EIRYKQLFINNEWVNAASGKTFPVINPATGKKIVDIQEGDKADVDKAVAAAKRAFEPGSV 68

Query: 477 WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW 656
           W    A +R R++ K ADL+E+    +A+LE+ DNGKP+  +   ++ ++ +   YYAGW
Sbjct: 69  WRNTDASDRGRLLNKLADLIERDRQYIASLESLDNGKPFSDSFNVDMVLVCKCLRYYAGW 128

Query: 657 ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAE 836
            DKI G T+P DG     T  EP+GV GQIIPWNFPL M AWK+GPA+ACGN VVLK AE
Sbjct: 129 TDKICGKTIPMDGNFFCYTKLEPVGVCGQIIPWNFPLLMLAWKIGPAIACGNVVVLKPAE 188

Query: 837 QTPLTALYAGKLFHEAGLPP 896
           QTPLTALY   L  EAG PP
Sbjct: 189 QTPLTALYTAALTKEAGFPP 208



>pir|JC4524|JC4524 aldehyde dehydrogenase [NAD(P)] (EC 1.2.1.5) -
           rat>gb:RATALDHA_2131447 Rattus rattus aldehyde
           dehydrogenase (ALDH) mRNA, complete cds.
          Length = 501

 Score =  220 bits (560), Expect = 3e-56
 Identities = 109/201 (54%), Positives = 140/201 (69%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           +++++T+  IN ++ DS SGK FP L+P TE+VI HV EG+  D+++AV AAR+AF  G 
Sbjct: 16  LKIQHTKIFINNEWHDSVSGKKFPVLNPATEEVICHVEEGDKADVDKAVKAARQAFQIGS 75

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A ER R++ K ADL+E+    LAT+E  + GK +  A  S+L   ++   Y AG
Sbjct: 76  PWRTMDASERGRLLNKLADLMERDCLLLATIEAINGGKVFANAYLSDLGGSIKALKYCAG 135

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKIHG T+P+DG     T  EPIGV GQIIPW FPL MF WK+GPAL+CGNTVV+K A
Sbjct: 136 WADKIHGQTIPSDGDIFTFTRREPIGVCGQIIPWEFPLLMFIWKIGPALSCGNTVVVKPA 195

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTAL+   L  EAG PP
Sbjct: 196 EQTPLTALHMASLIKEAGFPP 216



>gb:AF542418_1906474 Macaca fascicularis retinal dehydrogenase 1
           mRNA, complete cds.
          Length = 501

 Score =  219 bits (559), Expect = 4e-56
 Identities = 106/201 (52%), Positives = 137/201 (68%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           ++++YT+  IN ++ DS SGK FP  +P TE+ +  V EG+  D+++AV AAR+AF  G 
Sbjct: 16  LKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKADVDKAVKAARQAFQIGS 75

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A ER R++ K ADL+E+    LAT+E+ + GK Y  A  ++L   ++   Y AG
Sbjct: 76  PWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAG 135

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKI G T+P DG     T HEPIGV GQIIPWNFPL M  WK+GPAL+CGNTVV+K A
Sbjct: 136 WADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPA 195

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTAL+   L  EAG PP
Sbjct: 196 EQTPLTALHVASLIKEAGFPP 216



>sp|Q8HYE4|DHA1_MACFA Aldehyde dehydrogenase 1A1 (EC 1.2.1.3)
           (Aldehyde dehydrogenase, cytosolic) (ALDH class 1)
           (Retinal dehydrogenase 1).
          Length = 500

 Score =  219 bits (559), Expect = 4e-56
 Identities = 106/201 (52%), Positives = 137/201 (68%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           ++++YT+  IN ++ DS SGK FP  +P TE+ +  V EG+  D+++AV AAR+AF  G 
Sbjct: 15  LKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKADVDKAVKAARQAFQIGS 74

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A ER R++ K ADL+E+    LAT+E+ + GK Y  A  ++L   ++   Y AG
Sbjct: 75  PWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAG 134

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKI G T+P DG     T HEPIGV GQIIPWNFPL M  WK+GPAL+CGNTVV+K A
Sbjct: 135 WADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPA 194

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTAL+   L  EAG PP
Sbjct: 195 EQTPLTALHVASLIKEAGFPP 215



>gb:HSALDHIR_2010484 Human mRNA for mitochondrial aldehyde
           dehydrogenase (ALDH I).
          Length = 515

 Score =  219 bits (557), Expect = 7e-56
 Identities = 109/200 (54%), Positives = 134/200 (67%), Gaps = 1/200 (0%)
 Frame = +3

Query: 300 EVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG-P 476
           EV   Q  IN ++ D+ S KTFPT++P T +VI  VAEG+ ED+++A      AF  G P
Sbjct: 31  EVFCNQIFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDKEDVDKAREGRPGAFQLGSP 90

Query: 477 WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW 656
           W +M A  R R++ + ADL+E+    LA LET DNGKPY  +   +L M+++   YYAGW
Sbjct: 91  WRRMDASHRGRLLNRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGW 150

Query: 657 ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAE 836
           ADK HG T+P DG     T HEP+GV GQIIPWNFPL M AWK+GPALA GN VV+K AE
Sbjct: 151 ADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAE 210

Query: 837 QTPLTALYAGKLFHEAGLPP 896
           QTPLTALY   L  EAG PP
Sbjct: 211 QTPLTALYVANLIKEAGFPP 230



>sp|P15437|DHA1_HORSE Aldehyde dehydrogenase 1A1 (EC 1.2.1.3)
           (Aldehyde dehydrogenase, cytosolic) (ALDH class 1)
           (ALHDII) (ALDH-E1).>pir|S02302|S02302 aldehyde
           dehydrogenase (NAD) (EC 1.2.1.3) 1, cytosolic - horse
          Length = 500

 Score =  218 bits (556), Expect = 1e-55
 Identities = 106/201 (52%), Positives = 138/201 (68%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           ++ +YT+  IN ++ DS SGK FP  +P TE+ +  V EG+ ED+N+AVAAAR+AF  G 
Sbjct: 15  LKFQYTKIFINNEWHDSVSGKKFPVFNPATEEKLCEVEEGDKEDVNKAVAAARQAFQIGS 74

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A ER R++ K ADLVE+    LAT+E+ + GK +  A   +L   ++   Y AG
Sbjct: 75  PWRTMDASERGRLLYKLADLVERDRLILATMESMNGGKLFSNAYLMDLGGCLKTLRYCAG 134

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKI G T+P+DG     T HEP+GV GQI+PWNFPL MF WK+ PAL+CGNTVV+K A
Sbjct: 135 WADKIQGRTIPSDGNFFTYTRHEPVGVCGQILPWNFPLLMFLWKIAPALSCGNTVVVKPA 194

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPL+AL+   L  EAG PP
Sbjct: 195 EQTPLSALHVATLIKEAGFPP 215



>pir|JQ1004|JQ1004 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) 1
           precursor, cytosolic - mouse>gb:MUSAHD2F_2125057 Mouse
           aldehyde dehydrogenase II mRNA, complete cds.
          Length = 501

 Score =  218 bits (555), Expect = 1e-55
 Identities = 107/201 (53%), Positives = 140/201 (69%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           +++++T+  IN ++ +S SGK FP L+P TE+VI HV EG+  D+++AV AAR+AF  G 
Sbjct: 16  LKIQHTKIFINNEWHNSVSGKKFPVLNPATEEVICHVEEGDKADVDKAVKAARQAFQIGS 75

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A ER  ++ K ADL+E+    LAT+E  + GK +  A  S+L   ++   Y AG
Sbjct: 76  PWRTMDASERGCLLNKLADLMERDRLLLATMEALNGGKVFANAYLSDLGGCIKALKYCAG 135

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKIHG T+P+DG     T  EPIGV GQIIPWNFP+ MF WK+GPAL+CGNTVV+K A
Sbjct: 136 WADKIHGQTIPSDGDIFTYTRREPIGVCGQIIPWNFPMLMFIWKIGPALSCGNTVVVKPA 195

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTAL+   L  EAG PP
Sbjct: 196 EQTPLTALHLASLIKEAGFPP 216



>gb:AF348415_1790092 Zea mays cytosolic aldehyde dehydrogenase RF2D
           (rf2d) mRNA, complete cds.
          Length = 511

 Score =  218 bits (554), Expect = 2e-55
 Identities = 112/198 (56%), Positives = 136/198 (68%)
 Frame = +3

Query: 300 EVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPW 479
           E+K+T+  ING+FVD+ASGKTF T DPRT DV+AHVAE +  D++ AV +AR AF+ G W
Sbjct: 27  EIKFTKLFINGEFVDAASGKTFDTRDPRTGDVLAHVAEADKADVDLAVKSARDAFEHGKW 86

Query: 480 PKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWA 659
           P+MS YER RIM K ADLVE+H +ELA L+  D GK        ++P   ++  YYAG A
Sbjct: 87  PRMSGYERGRIMSKLADLVEQHTEELAALDGADAGKLLLLGKIIDIPAATQMLRYYAGAA 146

Query: 660 DKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQ 839
           DKIHG  +   G +   TL EPIGV G IIPWNFP  MF  KV PALA G TVV+K AEQ
Sbjct: 147 DKIHGDVLRVSGRYQGYTLKEPIGVVGVIIPWNFPTMMFFLKVSPALAAGCTVVVKPAEQ 206

Query: 840 TPLTALYAGKLFHEAGLP 893
           TPL+ALY   L   AG+P
Sbjct: 207 TPLSALYYAHLAKMAGVP 224



>pir|S78582|S14752 aldehyde dehydrogenase (NAD) (EC 1.2.1.3),
           cytosolic - sheep>gb:OAU12761_1441882 Ovis aries
           aldehyde dehydrogenase mRNA, complete cds.
          Length = 501

 Score =  217 bits (552), Expect = 3e-55
 Identities = 108/215 (50%), Positives = 144/215 (66%), Gaps = 3/215 (1%)
 Frame = +3

Query: 261 TAAAVEELVSPA--VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDIN 434
           +++A+ ++ +P   ++ KYT+  IN ++  S SGK FP  +P TE+ +  V EG+ ED++
Sbjct: 2   SSSAMPDVPAPLTNLQFKYTKIFINNEWHSSVSGKKFPVFNPATEEKLCEVEEGDKEDVD 61

Query: 435 RAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS 611
           +AV AAR+AF  G PW  M A ER R++ K ADL+E+    LAT+E  + GK +  A   
Sbjct: 62  KAVKAARQAFQIGSPWRTMDASERGRLLNKLADLIERDRLLLATMEAMNGGKLFSNAYLM 121

Query: 612 ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVG 791
           +L   ++   Y AGWADKI G T+P DG     T  EP+GV GQIIPWNFPL MF WK+G
Sbjct: 122 DLGGCIKTLRYCAGWADKIQGRTIPMDGNFFTYTRSEPVGVCGQIIPWNFPLLMFLWKIG 181

Query: 792 PALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           PAL+CGNTVV+K AEQTPLTAL+ G L  EAG PP
Sbjct: 182 PALSCGNTVVVKPAEQTPLTALHMGSLIKEAGFPP 216



>sp|P51977|DHA1_SHEEP Aldehyde dehydrogenase 1A1 (EC 1.2.1.3)
           (Aldehyde dehydrogenase, cytosolic) (ALDH class 1)
           (ALHDII) (ALDH-E1).
          Length = 500

 Score =  217 bits (552), Expect = 3e-55
 Identities = 108/215 (50%), Positives = 144/215 (66%), Gaps = 3/215 (1%)
 Frame = +3

Query: 261 TAAAVEELVSPA--VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDIN 434
           +++A+ ++ +P   ++ KYT+  IN ++  S SGK FP  +P TE+ +  V EG+ ED++
Sbjct: 1   SSSAMPDVPAPLTNLQFKYTKIFINNEWHSSVSGKKFPVFNPATEEKLCEVEEGDKEDVD 60

Query: 435 RAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS 611
           +AV AAR+AF  G PW  M A ER R++ K ADL+E+    LAT+E  + GK +  A   
Sbjct: 61  KAVKAARQAFQIGSPWRTMDASERGRLLNKLADLIERDRLLLATMEAMNGGKLFSNAYLM 120

Query: 612 ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVG 791
           +L   ++   Y AGWADKI G T+P DG     T  EP+GV GQIIPWNFPL MF WK+G
Sbjct: 121 DLGGCIKTLRYCAGWADKIQGRTIPMDGNFFTYTRSEPVGVCGQIIPWNFPLLMFLWKIG 180

Query: 792 PALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           PAL+CGNTVV+K AEQTPLTAL+ G L  EAG PP
Sbjct: 181 PALSCGNTVVVKPAEQTPLTALHMGSLIKEAGFPP 215



>gb:S75713_2139306 ahd-2=acetaldehyde dehydrogenase [mice, BALB/c,
           livers, mRNA Partial, 1632 nt].
          Length = 501

 Score =  216 bits (551), Expect = 4e-55
 Identities = 106/201 (52%), Positives = 140/201 (69%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           +++++T+  IN ++ +S SGK FP L+P +E+VI  V EG+  D+++AV AAR+AF  G 
Sbjct: 16  LKIQHTKIFINNEWHNSVSGKKFPVLNPASEEVICQVEEGDKADVDKAVKAARQAFQIGS 75

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A ER R++ K ADL+E+    LAT+E  + GK +  A  S+L   ++   Y AG
Sbjct: 76  PWRTMDASERGRLLNKLADLMERDRLLLATMEALNGGKVFANAYLSDLGGCIKALKYCAG 135

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKIHG T+P+DG     T  EPIGV GQIIPWNFP+ MF WK+GPAL+CGNTVV+K A
Sbjct: 136 WADKIHGQTIPSDGDIFTYTRREPIGVCGQIIPWNFPMLMFIWKIGPALSCGNTVVVKPA 195

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTAL+   L  EAG PP
Sbjct: 196 EQTPLTALHLASLIKEAGFPP 216



>gb:AE014134_1128355 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003624_1218462 Drosophila melanogaster
           chromosome 2L, section 33 of 83 of the complete
           sequence.
          Length = 520

 Score =  216 bits (551), Expect = 4e-55
 Identities = 107/199 (53%), Positives = 135/199 (67%), Gaps = 1/199 (0%)
 Frame = +3

Query: 300 EVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG-P 476
           ++ YT   IN ++  S SGK F T++P T +VIA +   + EDI+ AV AAR AF  G P
Sbjct: 36  DILYTGVFINNEWHKSKSGKIFETINPTTAEVIAEIQCADKEDIDIAVQAARNAFKLGSP 95

Query: 477 WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW 656
           W +M A ER R++ + ADL+E+    LA+LET DNGKPY  +   +LP  ++   Y+AGW
Sbjct: 96  WRRMDASERGRLLYRLADLMERDQVYLASLETLDNGKPYSMSYNVDLPTAIKNLRYFAGW 155

Query: 657 ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAE 836
           ADK HG T+P DG     T HEP+GV GQIIPWNFP+ M AWK+GPALA GNT+VLK AE
Sbjct: 156 ADKNHGKTIPMDGDFFTYTRHEPVGVCGQIIPWNFPILMMAWKLGPALATGNTIVLKPAE 215

Query: 837 QTPLTALYAGKLFHEAGLP 893
           QT LTALY  +L  EAG P
Sbjct: 216 QTSLTALYIAQLVKEAGFP 234



>gb:MMU96401_2124157 Mus musculus aldehyde dehydrogenase Ahd-2-like
           mRNA, complete cds.
          Length = 501

 Score =  216 bits (550), Expect = 5e-55
 Identities = 105/201 (52%), Positives = 141/201 (70%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           +++++T+  IN ++ DS S K FP L+P TE+VI HV EG+  D+++AV AAR+AF  G 
Sbjct: 16  LKIQHTKIFINNEWHDSVSSKKFPVLNPATEEVICHVEEGDKADVDKAVKAARQAFQIGS 75

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A ER R++ K ADL+E+    LAT+E+ + GK +  A   ++ + ++   Y+AG
Sbjct: 76  PWRTMDASERGRLLNKLADLMERDRLLLATMESMNAGKVFAHAYLLDVEISIKALQYFAG 135

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKIHG T+P+DG     T  EPIGV GQIIPWN PL +F WK+GPAL+CGNTVV+K A
Sbjct: 136 WADKIHGQTIPSDGNIFTYTRREPIGVCGQIIPWNGPLIIFTWKLGPALSCGNTVVVKPA 195

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTAL+   L  EAG PP
Sbjct: 196 EQTPLTALHMASLIKEAGFPP 216



>gb:BC046315_2099162 Mus musculus aldehyde dehydrogenase family 1,
           subfamily A7, mRNA (cDNA clone IMAGE:6314273), partial
           cds.
          Length = 507

 Score =  216 bits (550), Expect = 5e-55
 Identities = 105/201 (52%), Positives = 141/201 (70%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           +++++T+  IN ++ DS S K FP L+P TE+VI HV EG+  D+++AV AAR+AF  G 
Sbjct: 22  LKIQHTKIFINNEWHDSVSSKKFPVLNPATEEVICHVEEGDKADVDKAVKAARQAFQIGS 81

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A ER R++ K ADL+E+    LAT+E+ + GK +  A   ++ + ++   Y+AG
Sbjct: 82  PWRTMDASERGRLLNKLADLMERDRLLLATMESMNAGKVFAHAYLLDVEISIKALQYFAG 141

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKIHG T+P+DG     T  EPIGV GQIIPWN PL +F WK+GPAL+CGNTVV+K A
Sbjct: 142 WADKIHGQTIPSDGNIFTYTRREPIGVCGQIIPWNGPLIIFTWKLGPALSCGNTVVVKPA 201

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTAL+   L  EAG PP
Sbjct: 202 EQTPLTALHMASLIKEAGFPP 222



>pir|H69614|H69614 aldehyde dehydrogenase dhaS - Bacillus
           subtilis>gb:AF027868_470468 Bacillus subtilis chromosome
           region between terC and odhAB.>gb:BSUB0011_753896
           Bacillus subtilis complete genome (section 11 of 21):
           from 2014895 to 2207855.
          Length = 495

 Score =  216 bits (550), Expect = 5e-55
 Identities = 104/190 (54%), Positives = 130/190 (68%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           I+GKFV SASG TF T +P T + +  + E +A D+++AV AARKAFD+G W  MS   R
Sbjct: 24  IDGKFVPSASGATFDTPNPATGETLMTLYEAQAADVDKAVKAARKAFDQGEWRTMSPASR 83

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
           SR+M K ADL+E+H  ELA LET DNGKP  +    ++P+ +    YYAGW  KI G T+
Sbjct: 84  SRLMYKLADLMEEHKTELAQLETLDNGKPINETTNGDIPLAIEHMRYYAGWCTKITGQTI 143

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
           P  G +   T HEP+GV GQIIPWNFPL M  WK+G ALA G T+VLK AEQTPL+ALY 
Sbjct: 144 PVSGAYFNYTRHEPVGVVGQIIPWNFPLLMAMWKMGAALATGCTIVLKPAEQTPLSALYL 203

Query: 864 GKLFHEAGLP 893
            +L  +AG P
Sbjct: 204 AELIDQAGFP 213



>gb:BOVALDHYDA_1435150 Bos taurus aldehyde dehydrogenase mRNA,
           complete cds.
          Length = 501

 Score =  215 bits (547), Expect = 1e-54
 Identities = 107/215 (49%), Positives = 143/215 (66%), Gaps = 3/215 (1%)
 Frame = +3

Query: 261 TAAAVEELVSPA--VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDIN 434
           +++A+ ++ +P   ++ KYT+  IN ++  S SGK FP  +P TE+ +  V EG+ ED++
Sbjct: 2   SSSAMPDVPAPLTNLQFKYTKIFINNEWHSSVSGKKFPVFNPATEEKLCEVEEGDKEDVD 61

Query: 435 RAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS 611
           +AV A R+AF  G PW  M A ER R++ K ADL+E+    LAT+E  + GK +  A   
Sbjct: 62  KAVKAVRQAFQIGSPWRTMDASERGRLLNKLADLIERDHLLLATMEAMNGGKLFSNAYLM 121

Query: 612 ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVG 791
           +L   ++   Y AGWADKI G T+P DG     T  EP+GV GQIIPWNFPL MF WK+G
Sbjct: 122 DLGGCIKTLRYCAGWADKIQGRTIPMDGNFFTYTRSEPVGVCGQIIPWNFPLLMFLWKIG 181

Query: 792 PALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           PAL+CGNTVV+K AEQTPLTAL+ G L  EAG PP
Sbjct: 182 PALSCGNTVVVKPAEQTPLTALHMGSLIKEAGFPP 216



>sp|P48644|DHA1_BOVIN Aldehyde dehydrogenase 1A1 (EC 1.2.1.3)
           (Aldehyde dehydrogenase, cytosolic) (ALDH class 1)
           (ALHDII) (ALDH-E1).
          Length = 500

 Score =  215 bits (547), Expect = 1e-54
 Identities = 107/215 (49%), Positives = 143/215 (66%), Gaps = 3/215 (1%)
 Frame = +3

Query: 261 TAAAVEELVSPA--VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDIN 434
           +++A+ ++ +P   ++ KYT+  IN ++  S SGK FP  +P TE+ +  V EG+ ED++
Sbjct: 1   SSSAMPDVPAPLTNLQFKYTKIFINNEWHSSVSGKKFPVFNPATEEKLCEVEEGDKEDVD 60

Query: 435 RAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS 611
           +AV A R+AF  G PW  M A ER R++ K ADL+E+    LAT+E  + GK +  A   
Sbjct: 61  KAVKAVRQAFQIGSPWRTMDASERGRLLNKLADLIERDHLLLATMEAMNGGKLFSNAYLM 120

Query: 612 ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVG 791
           +L   ++   Y AGWADKI G T+P DG     T  EP+GV GQIIPWNFPL MF WK+G
Sbjct: 121 DLGGCIKTLRYCAGWADKIQGRTIPMDGNFFTYTRSEPVGVCGQIIPWNFPLLMFLWKIG 180

Query: 792 PALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           PAL+CGNTVV+K AEQTPLTAL+ G L  EAG PP
Sbjct: 181 PALSCGNTVVVKPAEQTPLTALHMGSLIKEAGFPP 215



>gb:U12966_1401766 Caenorhabditis elegans cosmid F54D8, complete
           sequence.
          Length = 510

 Score =  214 bits (546), Expect = 1e-54
 Identities = 106/197 (53%), Positives = 137/197 (69%), Gaps = 1/197 (0%)
 Frame = +3

Query: 306 KYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP-WP 482
           +YT   IN +FV + SGKTF T++P    V+A VAEG+  D+N AV AA+ AF  G  W 
Sbjct: 28  QYTGIFINNEFVPAKSGKTFETINPANGKVLAQVAEGDKTDVNIAVKAAQNAFRIGSEWR 87

Query: 483 KMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWAD 662
           +M A +R  ++ + ADL+E+    LA+LE+ DNGKPY  A  ++LP+ ++   YYAGWAD
Sbjct: 88  RMDASQRGVLLNRLADLMERDRVILASLESLDNGKPYAVAYNADLPLSIKTLRYYAGWAD 147

Query: 663 KIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQT 842
           K HG T+P +G +   T HEP+GV GQIIPWNFPL M AWK+GPALA GNTVV+K AEQT
Sbjct: 148 KNHGKTIPIEGDYFTYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALAMGNTVVMKVAEQT 207

Query: 843 PLTALYAGKLFHEAGLP 893
           PL+AL+   L  EAG P
Sbjct: 208 PLSALHVAALTKEAGFP 224



>sp|Q8MI17|DHA1_RABIT Aldehyde dehydrogenase 1A1 (EC 1.2.1.3)
           (Aldehyde dehydrogenase, cytosolic) (ALDH class
           1).>gb:AY038801_1424256 Oryctolagus cuniculus aldehyde
           dehydrogenase 1A1 (ALDH1A1) mRNA, complete cds.
          Length = 496

 Score =  214 bits (546), Expect = 1e-54
 Identities = 104/201 (51%), Positives = 137/201 (68%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           ++++YT+  IN ++ DS SGK FP L+P TE+ I  + EG+  D+++AV AAR+AF  G 
Sbjct: 11  LKIQYTKIFINNEWHDSVSGKKFPVLNPATEEQICLIEEGDKADVDKAVKAARQAFQIGS 70

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A ER R++ K ADL+E+    LAT+E+ + GK +  A   +L   ++   Y AG
Sbjct: 71  PWRTMDASERGRLLYKLADLIERDRLLLATMESLNAGKLFPNAYLMDLGGCIKTLRYCAG 130

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKI G T+P DG     T HEP+GV GQIIPWNFPL M  WK+GPAL+CGNTV++K A
Sbjct: 131 WADKIQGRTMPMDGDFFCYTRHEPVGVCGQIIPWNFPLVMLIWKIGPALSCGNTVIVKPA 190

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTAL+   L  EAG PP
Sbjct: 191 EQTPLTALHVASLIKEAGFPP 211



>gb:AY550122_1613293 Saussurea medusa cytosolic aldehyde
           dehydrogenase mRNA, complete cds.
          Length = 491

 Score =  213 bits (542), Expect = 4e-54
 Identities = 109/202 (53%), Positives = 136/202 (67%)
 Frame = +3

Query: 288 SPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFD 467
           SP  E+K+T+  ING+FVDS SG TF T+DP TE V+A V+EG  ED++ AV AAR+AFD
Sbjct: 3   SPKHEIKFTKLFINGEFVDSLSGNTFKTIDPATEQVLATVSEGRKEDVDLAVKAAREAFD 62

Query: 468 EGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYY 647
            GPWP++S   R +I+LKFADL++++ DELATLE  D GK +      E+P+    F Y+
Sbjct: 63  NGPWPRLSGEARRKILLKFADLIDENADELATLEVIDGGKLFGPMRYFEVPIASETFRYF 122

Query: 648 AGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLK 827
           AG ADKI G T+         TL EPIGV G IIPWN    MFA KV PALA G T+V+K
Sbjct: 123 AGAADKIRGSTLKMSSNIQAYTLREPIGVVGHIIPWNGQAYMFATKVAPALAAGCTMVVK 182

Query: 828 TAEQTPLTALYAGKLFHEAGLP 893
            AEQTPLT L+   L   AG+P
Sbjct: 183 PAEQTPLTGLFVAHLSRLAGVP 204



>gb:BOR548846_1633873 Bixa orellana mRNA for aldehyde dehydrogenase
           (adh gene).
          Length = 504

 Score =  212 bits (540), Expect = 7e-54
 Identities = 105/198 (53%), Positives = 137/198 (69%)
 Frame = +3

Query: 300 EVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPW 479
           E+K+T+  ING+FVD+ SG+TF T DPRT DV+A +AE + +D++ AV  AR+AFD GPW
Sbjct: 24  EIKFTKLFINGRFVDNVSGQTFDTRDPRTGDVLATIAEADKDDLDLAVKNAREAFDHGPW 83

Query: 480 PKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWA 659
           P+MS YER+RIM KFADLVE  ++ELA L+T D GK        ++P  V++  YYAG A
Sbjct: 84  PRMSGYERARIMTKFADLVEAFIEELAALDTADAGKTLSMGKAVDIPAAVQIMRYYAGAA 143

Query: 660 DKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQ 839
           DK+HG  +  +      TL +PIGV G IIPWN+P  MF  K  PALA G T+V+K AEQ
Sbjct: 144 DKLHGQPLKMNQDTQGYTLKDPIGVVGHIIPWNYPTMMFFLKNAPALAAGCTMVVKPAEQ 203

Query: 840 TPLTALYAGKLFHEAGLP 893
           TPL+AL+   L   AG+P
Sbjct: 204 TPLSALFYAHLARMAGVP 221



>gb:AF152358_2477321 Gallus gallus aldehyde dehydrogenase-6 (ALDH6)
           mRNA, complete cds.>gb:AF246710_2482314 Gallus gallus
           retinaldehyde dehydrogenase 3 mRNA, complete cds.
          Length = 512

 Score =  209 bits (533), Expect = 4e-53
 Identities = 104/201 (51%), Positives = 131/201 (65%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP 476
           +EVKYT+  IN ++ +S SGK FPT +P T + I  + EG+  D++ AV AA+ AF  G 
Sbjct: 27  LEVKYTKIFINNEWHESTSGKKFPTYNPSTLEKICDIEEGDKPDVDNAVEAAKAAFQRGS 86

Query: 477 -WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
            W +M A  R R++ K ADL+E+    LATLET D GKP+ QA   +L   ++   YYAG
Sbjct: 87  QWRQMDALSRGRLLHKLADLLERDRVILATLETMDTGKPFLQAYFIDLEGCIKTLRYYAG 146

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKI G T+P D      T HEP+GV G I PWNFPL M  WK+ PAL CGNT+V+K A
Sbjct: 147 WADKIQGRTIPVDENFVCFTRHEPMGVCGAITPWNFPLLMLVWKMAPALCCGNTLVIKPA 206

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLT+LY G L  E G PP
Sbjct: 207 EQTPLTSLYIGSLIKEVGFPP 227



>gb:BC069274_1987897 Homo sapiens aldehyde dehydrogenase 1 family,
           member A3, mRNA (cDNA clone MGC:78582 IMAGE:6208628),
           complete cds.
          Length = 512

 Score =  209 bits (533), Expect = 4e-53
 Identities = 105/201 (52%), Positives = 131/201 (65%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           +EVK+T+  IN ++ +S SGK F T +P T + I  V EG+  D+++AV AA+ AF  G 
Sbjct: 27  LEVKFTKIFINNEWHESKSGKKFATCNPSTREQICEVEEGDKPDVDKAVEAAQVAFQRGS 86

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW ++ A  R R++ + ADLVE+    LA LET D GKP+  A   +L   +R   Y+AG
Sbjct: 87  PWRRLDALSRGRLLHQLADLVERDRATLAALETMDTGKPFLHAFFIDLEGCIRTLRYFAG 146

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKI G T+P D      T HEPIGV G I PWNFPL M  WK+ PAL CGNT+VLK A
Sbjct: 147 WADKIQGKTIPTDDNVVCFTRHEPIGVCGAITPWNFPLLMLVWKLAPALCCGNTMVLKPA 206

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTALY G L  EAG PP
Sbjct: 207 EQTPLTALYLGSLIKEAGFPP 227



>gb:AB020746_1514614 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MOB24.>gb:AY056398_1563706 Arabidopsis
           thaliana aldehyde dehydrogenase mRNA, complete
           cds.>gb:AF349448_1790192 Arabidopsis thaliana aldehyde
           dehydrogenase AtALDH1a mRNA, complete cds.
          Length = 501

 Score =  209 bits (533), Expect = 4e-53
 Identities = 105/199 (52%), Positives = 142/199 (71%), Gaps = 1/199 (0%)
 Frame = +3

Query: 300 EVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPW 479
           E+K+T+  ING+F+D+ASGKTF T+DPR  +VIA +AEG+ ED++ AV AAR AFD GPW
Sbjct: 16  EIKFTKLFINGQFIDAASGKTFETIDPRNGEVIATIAEGDKEDVDLAVNAARYAFDHGPW 75

Query: 480 PKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWA 659
           P+M+ +ER++++ KFADL+E++++ELA L+  D GK ++    +++P     F Y AG A
Sbjct: 76  PRMTGFERAKLINKFADLIEENIEELAKLDAVDGGKLFQLGKYADIPATAGHFRYNAGAA 135

Query: 660 DKIHGLTVPADGPH-HVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAE 836
           DKIHG T+          TL EPIGV G IIPWNFP  MFA KV PA+A G T+V+K AE
Sbjct: 136 DKIHGETLKMTRQSLFGYTLKEPIGVVGNIIPWNFPSIMFATKVAPAMAAGCTMVVKPAE 195

Query: 837 QTPLTALYAGKLFHEAGLP 893
           QT L+AL+   L  EAG+P
Sbjct: 196 QTSLSALFYAHLSKEAGIP 214



>gb:AB176450_1411042 Oryctolagus cuniculus aldDH mRNA for aldehyde
           dehydrogenase, complete cds.
          Length = 496

 Score =  209 bits (533), Expect = 4e-53
 Identities = 102/201 (50%), Positives = 136/201 (67%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           ++++YT+  IN ++ DS SGK FP L+P TE+ I  + EG+  D+++AV AAR+AF  G 
Sbjct: 11  LKIQYTKIFINNEWHDSVSGKKFPVLNPATEEQICLIEEGDKADVDKAVKAARQAFQIGS 70

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A +R R++ K ADL+E+    LAT+E+ + GK +  A   +L   ++   Y AG
Sbjct: 71  PWRTMDASQRGRLLYKLADLIERDRLLLATMESLNAGKLFPNAYLMDLGGCIKTLRYCAG 130

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKI G T+P DG     T  EP+GV GQIIPWNFPL M  WK+GPAL+CGNTV++K A
Sbjct: 131 WADKIQGRTMPMDGDFFCYTRPEPVGVCGQIIPWNFPLVMLIWKIGPALSCGNTVIVKPA 190

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTAL+   L  EAG PP
Sbjct: 191 EQTPLTALHVASLIKEAGFPP 211



>gb:PSP296087_161296 Pseudonocardia sp. K1 ORF y, thmS gene, thma
           gene, ORF x, thmD gene, thmB gene, thm C gene, ORF Q,
           ORF Z and thm H gene.
          Length = 500

 Score =  209 bits (533), Expect = 4e-53
 Identities = 102/193 (52%), Positives = 129/193 (66%), Gaps = 2/193 (1%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           ING++ DS  G+T    DP     I  VA G+AED++RAVAAAR AFDEGPW K++  ER
Sbjct: 27  INGQWHDSIKGETLEVYDPAVGTKICTVAAGDAEDVDRAVAAARHAFDEGPWSKLNPSER 86

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
            R++ + ADL+E+H DE A ++  DNGKP   A   ++   + L  Y AGW++KI+G T+
Sbjct: 87  GRLVWRLADLLEEHADEFAQIDALDNGKPVTDARAVDVAFSIELLRYMAGWSNKIYGETI 146

Query: 684 PADGP--HHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTAL 857
           P   P   H  TL EP+GV GQI+PWNFPL M  WKV PALA G TV+LK AEQTPL+AL
Sbjct: 147 PLTNPADFHAYTLREPVGVVGQIVPWNFPLMMAVWKVAPALAAGCTVILKPAEQTPLSAL 206

Query: 858 YAGKLFHEAGLPP 896
              +L  EAG PP
Sbjct: 207 RLAELTEEAGFPP 219



>pir|A32616|A32616 aldehyde dehydrogenase (NAD) (EC 1.2.1.3) PB,
           cytosolic - rat>gb:RATALDH_2131446 Rat aldehyde
           dehydrogenase mRNA, complete cds.
          Length = 501

 Score =  209 bits (533), Expect = 4e-53
 Identities = 101/201 (50%), Positives = 139/201 (69%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           +++++T+  IN ++ +S +GK FP ++P TE+VI HV EG+  D+++AV AAR+AF  G 
Sbjct: 16  LKIQHTKIFINNEWHNSLNGKKFPVINPATEEVICHVEEGDKADVDKAVKAARQAFQIGS 75

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A ER  ++ K ADL+E+    LAT+E+ + GK +  A   +  + ++   Y+AG
Sbjct: 76  PWRTMDASERGCLLNKLADLMERDRVLLATMESMNAGKIFTHAYLLDTEVSIKALKYFAG 135

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKIHG T+P+DG     T  EPIGV GQIIPWN PL +F WK+G AL+CGNTV++K A
Sbjct: 136 WADKIHGQTIPSDGDVFTYTRREPIGVCGQIIPWNGPLILFIWKIGAALSCGNTVIVKPA 195

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTALY   L  EAG PP
Sbjct: 196 EQTPLTALYMASLIKEAGFPP 216



>sp|P13601|DHAC_RAT Aldehyde dehydrogenase, cytosolic 1 (EC 1.2.1.3)
           (ALDH class 1) (ALHDII) (ALDH-E1).
          Length = 500

 Score =  209 bits (533), Expect = 4e-53
 Identities = 101/201 (50%), Positives = 139/201 (69%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           +++++T+  IN ++ +S +GK FP ++P TE+VI HV EG+  D+++AV AAR+AF  G 
Sbjct: 15  LKIQHTKIFINNEWHNSLNGKKFPVINPATEEVICHVEEGDKADVDKAVKAARQAFQIGS 74

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A ER  ++ K ADL+E+    LAT+E+ + GK +  A   +  + ++   Y+AG
Sbjct: 75  PWRTMDASERGCLLNKLADLMERDRVLLATMESMNAGKIFTHAYLLDTEVSIKALKYFAG 134

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKIHG T+P+DG     T  EPIGV GQIIPWN PL +F WK+G AL+CGNTV++K A
Sbjct: 135 WADKIHGQTIPSDGDVFTYTRREPIGVCGQIIPWNGPLILFIWKIGAALSCGNTVIVKPA 194

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTALY   L  EAG PP
Sbjct: 195 EQTPLTALYMASLIKEAGFPP 215



>sp|P47895|DHA6_HUMAN Aldehyde dehydrogenase 6 (EC
           1.2.1.5).>pir|A55684|A55684 aldehyde dehydrogenase (NAD)
           (EC 1.2.1.3) 6 precursor, salivary -
           human>gb:HSU07919_2021848 Human aldehyde dehydrogenase 6
           mRNA, complete cds.
          Length = 512

 Score =  209 bits (533), Expect = 4e-53
 Identities = 105/201 (52%), Positives = 131/201 (65%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           +EVK+T+  IN ++ +S SGK F T +P T + I  V EG+  D+++AV AA+ AF  G 
Sbjct: 27  LEVKFTKIFINNEWHESKSGKKFATCNPSTREQICEVEEGDKPDVDKAVEAAQVAFQRGS 86

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW ++ A  R R++ + ADLVE+    LA LET D GKP+  A   +L   +R   Y+AG
Sbjct: 87  PWRRLDALSRGRLLHQLADLVERDRATLAALETMDTGKPFLHAFFIDLEGCIRTLRYFAG 146

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKI G T+P D      T HEPIGV G I PWNFPL M  WK+ PAL CGNT+VLK A
Sbjct: 147 WADKIQGKTIPTDDNVVCFTRHEPIGVCGAITPWNFPLLMLVWKLAPALCCGNTMVLKPA 206

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTALY G L  EAG PP
Sbjct: 207 EQTPLTALYLGSLIKEAGFPP 227



>gb:AL591031_1929965 Human DNA sequence from clone RP11-151D14 on
           chromosome 9q13-21.2 Contains a novel gene and the
           ALDH1A1 gene for aldehyde dehydrogenase 1 family member
           A1, complete sequence.
          Length = 203

 Score =  209 bits (531), Expect = 8e-53
 Identities = 101/188 (53%), Positives = 131/188 (69%), Gaps = 1/188 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           ++++YT+  IN ++ DS SGK FP  +P TE+ +  V EG+ ED+++AV AAR+AF  G 
Sbjct: 16  LKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGS 75

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW  M A ER R++ K ADL+E+    LAT+E+ + GK Y  A  ++L   ++   Y AG
Sbjct: 76  PWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAG 135

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKI G T+P DG     T HEPIGV GQIIPWNFPL M  WK+GPAL+CGNTVV+K A
Sbjct: 136 WADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPA 195

Query: 834 EQTPLTAL 857
           EQTPLTAL
Sbjct: 196 EQTPLTAL 203



>gb:AF260125_1781465 Aspergillus nidulans aldehyde dehydrogenase
           ALDH57 (aldA) gene, aldA57 allele, complete cds.
          Length = 497

 Score =  207 bits (528), Expect = 2e-52
 Identities = 107/200 (53%), Positives = 136/200 (68%), Gaps = 3/200 (1%)
 Frame = +3

Query: 303 VKYTQHI---INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG 473
           +KY Q +   IN +FV    GKTF  ++P  E VI  V E   +D++ AVAAAR AF EG
Sbjct: 13  IKYEQPLGLFINNEFVKGVEGKTFQVINPSNEKVITSVHEATEKDVDVAVAAARAAF-EG 71

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW +++  ER  ++ K ADL+E+ +D LA +E+ DNGK +  A K +L   +    YYAG
Sbjct: 72  PWRQVTPSERGILINKLADLMERDIDTLAAIESLDNGKAFTMA-KVDLANSIGCLRYYAG 130

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKIHG T+  +      T HEP+GV GQIIPWNFPL M++WK+GPA+A GNTVVLKTA
Sbjct: 131 WADKIHGQTIDTNPETLTYTRHEPVGVCGQIIPWNFPLLMWSWKIGPAVAAGNTVVLKTA 190

Query: 834 EQTPLTALYAGKLFHEAGLP 893
           EQTPL+ALYA KL  EAG P
Sbjct: 191 EQTPLSALYAAKLIKEAGFP 210



>gb:AF260124_1781464 Aspergillus nidulans aldehyde dehydrogenase
           ALDH15 (aldA) gene, aldA15 allele, complete cds.
          Length = 497

 Score =  207 bits (528), Expect = 2e-52
 Identities = 107/200 (53%), Positives = 136/200 (68%), Gaps = 3/200 (1%)
 Frame = +3

Query: 303 VKYTQHI---INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG 473
           +KY Q +   IN +FV    GKTF  ++P  E VI  V E   +D++ AVAAAR AF EG
Sbjct: 13  IKYEQPLGLFINNEFVKGVEGKTFQVINPSNEKVITSVHEATEKDVDVAVAAARAAF-EG 71

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW +++  ER  ++ K ADL+E+ +D LA +E+ DNGK +  A K +L   +    YYAG
Sbjct: 72  PWRQVTPSERGILINKLADLMERDIDTLAAIESLDNGKAFTMA-KVDLANSIGCLRYYAG 130

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKIHG T+  +      T HEP+GV GQIIPWNFPL M++WK+GPA+A GNTVVLKTA
Sbjct: 131 WADKIHGQTIDTNPETLTYTRHEPVGVCGQIIPWNFPLLMWSWKIGPAVAAGNTVVLKTA 190

Query: 834 EQTPLTALYAGKLFHEAGLP 893
           EQTPL+ALYA KL  EAG P
Sbjct: 191 EQTPLSALYAAKLIKEAGFP 210



>gb:AF260123_1781463 Aspergillus nidulans aldehyde dehydrogenase
           ALDH (aldA) gene, complete cds.
          Length = 497

 Score =  207 bits (528), Expect = 2e-52
 Identities = 107/200 (53%), Positives = 136/200 (68%), Gaps = 3/200 (1%)
 Frame = +3

Query: 303 VKYTQHI---INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG 473
           +KY Q +   IN +FV    GKTF  ++P  E VI  V E   +D++ AVAAAR AF EG
Sbjct: 13  IKYEQPLGLFINNEFVKGVEGKTFQVINPSNEKVITSVHEATEKDVDVAVAAARAAF-EG 71

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW +++  ER  ++ K ADL+E+ +D LA +E+ DNGK +  A K +L   +    YYAG
Sbjct: 72  PWRQVTPSERGILINKLADLMERDIDTLAAIESLDNGKAFTMA-KVDLANSIGCLRYYAG 130

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKIHG T+  +      T HEP+GV GQIIPWNFPL M++WK+GPA+A GNTVVLKTA
Sbjct: 131 WADKIHGQTIDTNPETLTYTRHEPVGVCGQIIPWNFPLLMWSWKIGPAVAAGNTVVLKTA 190

Query: 834 EQTPLTALYAGKLFHEAGLP 893
           EQTPL+ALYA KL  EAG P
Sbjct: 191 EQTPLSALYAAKLIKEAGFP 210



>sp|Q29490|DHAE_MACPR Aldehyde dehydrogenase, cytosolic 1 (EC
           1.2.1.3) (ALDH class 1) (ETA-
           crystallin).>gb:MPU03906_1441244 Macroscelides
           proboscideus aldehyde dehydrogenase I, eta-crystallin
           mRNA, complete cds.
          Length = 501

 Score =  207 bits (528), Expect = 2e-52
 Identities = 104/215 (48%), Positives = 141/215 (65%), Gaps = 3/215 (1%)
 Frame = +3

Query: 261 TAAAVEELVSPAVEVK--YTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDIN 434
           +++ + +L +P   +K  +T+  IN ++ DS SGKTFP  +P TE+ I  V E + ED++
Sbjct: 2   SSSGMPDLPAPLTNIKIQHTKLFINNEWHDSVSGKTFPVFNPATEEKICEVEEADKEDVD 61

Query: 435 RAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS 611
           +AV AAR+AF  G PW  M A ER +++ K ADL+E+    LATLE+ + GK +  A   
Sbjct: 62  KAVKAAREAFQMGSPWRTMDASERGQLIYKLADLIERDRLLLATLESINAGKIFASAYLM 121

Query: 612 ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVG 791
           +L   +++  Y AGWADKI G T+P DG     T HEPIGV GQI PWN P+ + A K+G
Sbjct: 122 DLDYCIKVLRYCAGWADKIQGRTIPVDGEFFSYTRHEPIGVCGQIFPWNAPMILLACKIG 181

Query: 792 PALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           PAL CGNTV++K AEQTPLTAL+   L  EAG PP
Sbjct: 182 PALCCGNTVIVKPAEQTPLTALHVASLIKEAGFPP 216



>gb:AF246711_2060468 Mus musculus retinaldehyde dehydrogenase 3
           mRNA, complete cds.>gb:AF280404_2061324 Mus musculus
           retinaldehyde dehydrogenase 3 (Raldh3) mRNA, complete
           cds.>gb:BC058277_2103153 Mus musculus aldehyde
           dehydrogenase family 1, subfamily A3, mRNA (cDNA clone
           MGC:67939 IMAGE:6515355), complete cds.
          Length = 512

 Score =  206 bits (525), Expect = 4e-52
 Identities = 104/201 (51%), Positives = 131/201 (65%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           +EVK+T+  IN  + +S SG+ F T +P T + I  V EG+  D+++AV AA+ AF  G 
Sbjct: 27  LEVKFTKIFINNDWHESKSGRKFATYNPSTLEKICEVEEGDKPDVDKAVEAAQAAFQRGS 86

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW ++ A  R +++ + ADLVE+    LATLET D GKP+  A   +L   ++ F Y+AG
Sbjct: 87  PWRRLDALSRGQLLHQLADLVERDRAILATLETMDTGKPFLHAFFVDLEGCIKTFRYFAG 146

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKI G T+P D      T HEPIGV G I PWNFPL M AWK+ PAL CGNTVVLK A
Sbjct: 147 WADKIQGRTIPTDDNVVCFTRHEPIGVCGAITPWNFPLLMLAWKLAPALCCGNTVVLKPA 206

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTALY   L  E G PP
Sbjct: 207 EQTPLTALYLASLIKEVGFPP 227



>gb:AF253409_2060655 Mus musculus retinaldehyde dehydrogenase 3
           mRNA, complete cds.
          Length = 512

 Score =  206 bits (523), Expect = 6e-52
 Identities = 104/201 (51%), Positives = 131/201 (65%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           +EVK+T+  IN  + +S SG+ F T +P T + I  V EG+  D+++AV AA+ AF  G 
Sbjct: 27  LEVKFTKIFINNDWHESKSGRKFATYNPSTLEKICEVEEGDKPDVDKAVEAAQAAFQRGS 86

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW ++ A  R +++ + ADLVE+    LATLET D GKP+  A   +L   ++ F Y+AG
Sbjct: 87  PWRRVDALSRGQLLHQLADLVERDRAILATLETMDTGKPFLHAFFVDLEGCIKTFRYFAG 146

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKI G T+P D      T HEPIGV G I PWNFPL M AWK+ PAL CGNTVVLK A
Sbjct: 147 WADKIQGRTIPTDDNVVCFTRHEPIGVCGAITPWNFPLLMLAWKLAPALCCGNTVVLKPA 206

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTALY   L  E G PP
Sbjct: 207 EQTPLTALYLASLIKEEGFPP 227



>gb:AF152359_2056754 Mus musculus aldehyde dehydrogenase-6 (Aldh6)
           mRNA, complete cds.
          Length = 512

 Score =  205 bits (521), Expect = 1e-51
 Identities = 103/201 (51%), Positives = 131/201 (65%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           +EVK+T+  IN  + +S SG+ F T +P T + I  V EG+  D+++AV AA+ AF  G 
Sbjct: 27  LEVKFTKIFINNDWHESKSGRKFATYNPSTLEKICEVEEGDKPDVDKAVEAAQAAFQRGS 86

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW ++ A  R +++ + ADLVE+    LATLET D GKP+  A   +L   ++ F Y+AG
Sbjct: 87  PWRRLDALSRGQLLHQLADLVERDRAILATLETMDTGKPFLHAFFVDLEGCIKTFRYFAG 146

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKI G T+P D      T HEPIGV G I PWNFPL M AWK+ PAL CGNTVVLK A
Sbjct: 147 WADKIQGRTIPTDDNVVCFTRHEPIGVCGAITPWNFPLLMLAWKLAPALCCGNTVVLKPA 206

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           E+TPLTALY   L  E G PP
Sbjct: 207 ERTPLTALYLASLIKEVGFPP 227



>gb:AF434845_2065705 Rattus norvegicus aldehyde dehydrogenase 6
           mRNA, complete cds.
          Length = 512

 Score =  204 bits (520), Expect = 1e-51
 Identities = 102/201 (50%), Positives = 130/201 (64%), Gaps = 1/201 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG- 473
           +EVK+T+  IN  + +  SG+ F T +P T + I  V EG+  D+++AV AA+ AF  G 
Sbjct: 27  LEVKFTKIFINNDWHEPKSGRKFATYNPSTLEKICEVEEGDKPDVDKAVEAAQAAFQRGS 86

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW ++ A  R +++ + ADL+E+    LATLET D GKP+  A   +L   ++ F Y+AG
Sbjct: 87  PWRRLDALSRGQLLHQLADLIERDRAILATLETMDTGKPFLHAFFVDLEGCIKTFRYFAG 146

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKI G T+P D      T HEPIGV G I PWNFPL M AWK+ PAL CGNTVVLK A
Sbjct: 147 WADKIQGRTIPTDDNVMCFTRHEPIGVCGAITPWNFPLLMLAWKLAPALCCGNTVVLKPA 206

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           EQTPLTALY   L  E G PP
Sbjct: 207 EQTPLTALYLASLIKEVGFPP 227



>sp|P08157|DHAL_EMENI Aldehyde dehydrogenase (EC 1.2.1.3)
           (ALDDH).>pir|A29055|A29055 aldehyde dehydrogenase (NAD)
           (EC 1.2.1.3) - Emericella nidulans>gb:EMEALDA_1676593
           A.nidulans aldA gene encoding aldehyde dehydrogenase,
           complete cds.
          Length = 497

 Score =  203 bits (517), Expect = 3e-51
 Identities = 105/200 (52%), Positives = 135/200 (67%), Gaps = 3/200 (1%)
 Frame = +3

Query: 303 VKYTQHI---INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG 473
           +KY Q +   IN +FV    GKTF  ++P  E VI  V E   +D++ AVAAAR AF EG
Sbjct: 13  IKYEQPLGLFINNEFVKGVEGKTFQVINPSNEKVITSVHEATEKDVDVAVAAARAAF-EG 71

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
           PW +++  ER  ++ K ADL+E+ +D LA +E+ DNGK +  A K +L   +    YYAG
Sbjct: 72  PWRQVTPSERGILINKLADLMERDIDTLAAIESLDNGKAFTMA-KVDLANSIGCLRYYAG 130

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKIHG T+  +      T HEP+GV GQIIPWNFPL M++WK+GPA+A GNTVVLKTA
Sbjct: 131 WADKIHGQTIDTNPETLTYTRHEPVGVCGQIIPWNFPLLMWSWKIGPAVAAGNTVVLKTA 190

Query: 834 EQTPLTALYAGKLFHEAGLP 893
           +QTPL+ALYA KL  EA  P
Sbjct: 191 QQTPLSALYAAKLIKEAPFP 210



>sp|Q28399|DHAE_ELEED Aldehyde dehydrogenase, cytosolic 1 (EC
           1.2.1.3) (ALDH class 1) (ETA-
           crystallin).>gb:U02483_1446207 Elephantulus edwardi
           aldehyde dehydrogenase 1/eta-crystallin mRNA, complete
           cds.
          Length = 501

 Score =  203 bits (516), Expect = 4e-51
 Identities = 102/215 (47%), Positives = 139/215 (64%), Gaps = 3/215 (1%)
 Frame = +3

Query: 261 TAAAVEELVSPAVEVK--YTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDIN 434
           +++ + +L +P   +K  +T+  IN ++ +S SGKTFP  +P TE+ I  V E + ED++
Sbjct: 2   SSSGMPDLPAPLTNIKIQHTKLFINNEWHESVSGKTFPVFNPATEEKICEVEEADKEDVD 61

Query: 435 RAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKS 611
           +AV AAR+AF  G PW  M A ER +++ K ADL+E+    LATLE+ + GK +  A   
Sbjct: 62  KAVKAAREAFQMGSPWRTMDASERGQLIYKLADLIERDRLLLATLESINAGKVFASAYLM 121

Query: 612 ELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVG 791
           +L   ++   Y AGWADKI G T+P DG     T HEPIGV G I PWN P+ + A K+G
Sbjct: 122 DLDYCIKALRYCAGWADKIQGRTIPVDGEFFSYTRHEPIGVCGLIFPWNAPMILLACKIG 181

Query: 792 PALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           PAL CGNTV++K AEQTPLTAL+   L  EAG PP
Sbjct: 182 PALCCGNTVIVKPAEQTPLTALHVASLIKEAGFPP 216



>sp|Q27640|DHAL_ENCBU Aldehyde dehydrogenase (EC 1.2.1.3) (Aldehyde
           dehydrogenase [NAD+]).>pir|JC4924|JC4924 aldehyde
           dehydrogenase (NAD) (EC 1.2.1.3) - earthworm
           (Enchytraeus buchholzi)>gb:EBALDH_1384127 E.buchholzi
           mRNA for aldehyde dehydrogenase.
          Length = 497

 Score =  202 bits (514), Expect = 7e-51
 Identities = 103/200 (51%), Positives = 136/200 (68%), Gaps = 1/200 (0%)
 Frame = +3

Query: 297 VEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFD-EG 473
           ++V++T+  IN +FVDS SGKTF T++P T + +A V EG+  DI++AVAAAR AF  + 
Sbjct: 13  LKVEFTKIFINNEFVDSVSGKTFATINPSTGEKLAEVQEGDKADIDKAVAAARAAFKRDA 72

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
            + K  A +R R++ K ADL+E H  +L TLET DNGKP+  +   +  M  ++  YYAG
Sbjct: 73  EYRKHDASDRGRLLFKLADLIEAHRVQLRTLETLDNGKPFAMSYLGDTLMAQKVLRYYAG 132

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           +ADKI G T+PADG     T HEP+GV G I PWNFPL + A K+ PA+A G T+VLK A
Sbjct: 133 FADKIVGQTIPADGNVFCYTRHEPVGVVGAITPWNFPLHLAASKIAPAIAAGCTLVLKPA 192

Query: 834 EQTPLTALYAGKLFHEAGLP 893
           EQTPLTALY   L  +AG P
Sbjct: 193 EQTPLTALYLASLVKQAGFP 212



>gb:AF106575_1241652 Caenorhabditis elegans cosmid K04F1, complete
           sequence.
          Length = 537

 Score =  201 bits (511), Expect = 2e-50
 Identities = 100/194 (51%), Positives = 133/194 (68%), Gaps = 1/194 (0%)
 Frame = +3

Query: 315 QHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP-WPKMS 491
           Q  IN +FVD+ SGKTF  ++P    ++A VAEG  +D++ AV AA+KAF  G  W +M 
Sbjct: 58  QLFINNEFVDAKSGKTFEFVNPANGKLLAKVAEGNRDDVDIAVEAAKKAFKIGSEWRRMD 117

Query: 492 AYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIH 671
           A  R  ++ + ADL+E+    LA+LE+ DNGKPY++A   +LP+ ++ F YYAG+ADK H
Sbjct: 118 ASHRGVLLNRLADLMERDRVILASLESLDNGKPYKEAYNIDLPISIKTFRYYAGYADKNH 177

Query: 672 GLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLT 851
           G T+P  G +   T HEP+GV GQIIPWNFPL M AWK+ PALA GNTVV+K A +TPL+
Sbjct: 178 GKTIPVGGDYFTYTRHEPVGVCGQIIPWNFPLLMQAWKLAPALAMGNTVVMKVAVKTPLS 237

Query: 852 ALYAGKLFHEAGLP 893
           AL+   L  EA  P
Sbjct: 238 ALHVASLIKEAQFP 251



>pir|A46725|A46725 omega-crystallin - giant
           octopus>gb:OCTOMEGCRY_1391073 Octopus dofleini
           omega-crystallin, complete cds.
          Length = 496

 Score =  198 bits (503), Expect = 1e-49
 Identities = 94/200 (47%), Positives = 130/200 (65%), Gaps = 1/200 (0%)
 Frame = +3

Query: 300 EVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG-P 476
           E+K+T+  IN +FVDS +GK +  ++P T   I  V EG   DI++AV A + AF  G P
Sbjct: 12  EIKFTKIFINNQFVDSVNGKAYSVINPCTTKKICDVQEGSKADIDKAVQACKLAFKRGTP 71

Query: 477 WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW 656
           W +M A  R  ++ + ADL E+ +  L++LET + GKPY+ A + ++   +++  YYAGW
Sbjct: 72  WRRMDASRRGHLLYRLADLFERDIAYLSSLETLNTGKPYKSAYQ-DIVHCIQVLRYYAGW 130

Query: 657 ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAE 836
           ADK  G  +P DG     T HEP+G+ G IIPWN+P+ M  WK+ PAL+CGN +V+K AE
Sbjct: 131 ADKNMGQNIPVDGDFFSFTKHEPVGICGLIIPWNYPMLMMTWKMAPALSCGNCIVVKPAE 190

Query: 837 QTPLTALYAGKLFHEAGLPP 896
           QTPLTALY   L  EAG PP
Sbjct: 191 QTPLTALYCASLMEEAGFPP 210



>sp|P30841|CROM_OCTDO Omega-crystallin.
          Length = 495

 Score =  198 bits (503), Expect = 1e-49
 Identities = 94/200 (47%), Positives = 130/200 (65%), Gaps = 1/200 (0%)
 Frame = +3

Query: 300 EVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG-P 476
           E+K+T+  IN +FVDS +GK +  ++P T   I  V EG   DI++AV A + AF  G P
Sbjct: 11  EIKFTKIFINNQFVDSVNGKAYSVINPCTTKKICDVQEGSKADIDKAVQACKLAFKRGTP 70

Query: 477 WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW 656
           W +M A  R  ++ + ADL E+ +  L++LET + GKPY+ A + ++   +++  YYAGW
Sbjct: 71  WRRMDASRRGHLLYRLADLFERDIAYLSSLETLNTGKPYKSAYQ-DIVHCIQVLRYYAGW 129

Query: 657 ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAE 836
           ADK  G  +P DG     T HEP+G+ G IIPWN+P+ M  WK+ PAL+CGN +V+K AE
Sbjct: 130 ADKNMGQNIPVDGDFFSFTKHEPVGICGLIIPWNYPMLMMTWKMAPALSCGNCIVVKPAE 189

Query: 837 QTPLTALYAGKLFHEAGLPP 896
           QTPLTALY   L  EAG PP
Sbjct: 190 QTPLTALYCASLMEEAGFPP 209



>gb:CR382129_1661437 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 496

 Score =  197 bits (502), Expect = 2e-49
 Identities = 100/190 (52%), Positives = 133/190 (70%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           ING+FV + SGKTF T++P TE+VI  V+E + ED+N AV AA  AF    + K +   R
Sbjct: 23  INGEFVAAKSGKTFETINPTTEEVICSVSEADEEDVNAAVDAAAAAFKTWGF-KTAPSAR 81

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
              + K ADL+E+ +D +A +ET DNGK Y  A K ++ ++V++  +YAG+ADKI+G  +
Sbjct: 82  GAALFKLADLIERDLDIIAAIETTDNGKVYAHA-KGDVALVVKVIRFYAGYADKIYGDVI 140

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
             +  H   T  EPIGV GQIIPWNFPL M++WK+ PALA GNTVVLK+AE TPL+ALYA
Sbjct: 141 HGNDGHFSYTRKEPIGVCGQIIPWNFPLVMWSWKIAPALATGNTVVLKSAESTPLSALYA 200

Query: 864 GKLFHEAGLP 893
            KL  EAG+P
Sbjct: 201 AKLAQEAGIP 210



>sp|P41751|DHAL_ASPNG Aldehyde dehydrogenase (EC 1.2.1.3)
           (ALDDH).>gb:ASNALDAA_1542172 Aspergillus niger aldehyde
           dehydrogenase (aldA) gene, complete cds.
          Length = 497

 Score =  197 bits (500), Expect = 3e-49
 Identities = 103/200 (51%), Positives = 131/200 (65%), Gaps = 3/200 (1%)
 Frame = +3

Query: 303 VKYTQHI---INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG 473
           VKY Q +   I+G+FV  A GKTF T++P  E  I  V E   +D++ AVAAARKAF EG
Sbjct: 14  VKYEQPLGLFIDGEFVKGAEGKTFETINPSNEKPIVAVHEATEKDVDTAVAAARKAF-EG 72

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
            W +++   R R++ K ADL E+  + LA++E  DNGK    A   ++        YY G
Sbjct: 73  SWRQVTPSTRGRMLTKLADLFERDAEILASIEALDNGKSITMA-HGDIAGAAGCLRYYGG 131

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           WADKIHG T+  +      T HEPIGV GQIIPWNFPL M+AWK+GPA+A GNTVV+KTA
Sbjct: 132 WADKIHGQTIDTNSETLNYTRHEPIGVCGQIIPWNFPLLMWAWKIGPAIATGNTVVIKTA 191

Query: 834 EQTPLTALYAGKLFHEAGLP 893
           EQTPL+ LYA  +  EAG+P
Sbjct: 192 EQTPLSGLYAANVIKEAGIP 211



>gb:UMU74468_1726880 Ustilago maydis cytosolic indole-3-acetaldehyde
           dehydrogenase (iad1) gene, complete cds.
          Length = 497

 Score =  196 bits (498), Expect = 5e-49
 Identities = 99/191 (51%), Positives = 125/191 (65%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           IN KFV +  GKTF T++P T   I  VAE  A+D++ AV AAR+AF+           R
Sbjct: 22  INNKFVPALDGKTFATINPSTGKEIGQVAEASAKDVDLAVKAAREAFETTWGENTPGDAR 81

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
            R+++K A+LVE ++DELA +E+ DNGK +  A   ++  +     YY GWADK HG  +
Sbjct: 82  GRLLIKLAELVEANIDELAAIESLDNGKAFSIAKSFDVAAVAANLRYYGGWADKNHGKVM 141

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
             D      T HEPIGV GQIIPWNFPL MFAWK+GPALA GNT+VLKTAEQTPL+A+  
Sbjct: 142 EVDTKRLNYTRHEPIGVCGQIIPWNFPLLMFAWKLGPALATGNTIVLKTAEQTPLSAIKM 201

Query: 864 GKLFHEAGLPP 896
            +L  EAG PP
Sbjct: 202 CELIVEAGFPP 212



>gb:BA000040_735867 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 565

 Score =  196 bits (498), Expect = 5e-49
 Identities = 109/219 (49%), Positives = 140/219 (63%), Gaps = 6/219 (2%)
 Frame = +3

Query: 258 STAAAVEELVS----PAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAE 425
           S A AV + +     P     Y Q +I+GK+VD+ASGK F T +P T +++A VAEG+ E
Sbjct: 65  SAAMAVSQAIPITRHPFANGSYKQMLIDGKWVDAASGKRFETHNPATGELLATVAEGDKE 124

Query: 426 DINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAA 605
           DI+RAVAAAR+AF EGPW K+  +ER  ++L+ ADLVEK+ DEL+ L+T D G P  +  
Sbjct: 125 DIDRAVAAARRAF-EGPWSKVKPFERQNLLLRLADLVEKNFDELSQLDTLDMGAPLSRTR 183

Query: 606 KSELPMIVRLFHYYAGWADKIHGLTVPADGPHHV--QTLHEPIGVAGQIIPWNFPLAMFA 779
              L   V +  YYAG    IHG T+    P  +   TL EPIGV G IIPWN PL    
Sbjct: 184 AYRL-RAVGMLRYYAGQTTAIHGETIENSLPGEIFSYTLKEPIGVVGAIIPWNGPLTATI 242

Query: 780 WKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           WK+GPA+A G TVVLK AE+ PLT+L   +L  EAG+PP
Sbjct: 243 WKIGPAIATGCTVVLKPAEEAPLTSLRIAELAMEAGIPP 281



>gb:CR382126_1658362 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 522

 Score =  195 bits (496), Expect = 9e-49
 Identities = 96/190 (50%), Positives = 125/190 (65%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           IN +FV S  GKTF  L P TE+ I HV EG  ED++ AV AA KAF  G W K+    R
Sbjct: 53  INNQFVPSKQGKTFEVLSPSTEEEITHVYEGREEDVDAAVEAADKAFKSGVWSKVDPLVR 112

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
           S+ + K AD +EK +D +A++E+ DNGK    +AK ++ ++V      AG+ADK+ G  +
Sbjct: 113 SQCLSKLADYIEKDLDTIASIESLDNGKAIS-SAKGDVQLVVNYLRSAAGYADKVDGRVI 171

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
                H   T+ EP+GV GQIIPWNFPL M+AWK+ PALA GNTVVLKTAE TPL+ALY 
Sbjct: 172 DTGSTHFSYTVREPLGVCGQIIPWNFPLLMWAWKIAPALATGNTVVLKTAESTPLSALYV 231

Query: 864 GKLFHEAGLP 893
            +   +AG+P
Sbjct: 232 SQYIPKAGIP 241



>gb:AE014297_1141634 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003758_1223627 Drosophila melanogaster
           chromosome 3R, section 96 of 118 of the complete
           sequence.
          Length = 485

 Score =  193 bits (491), Expect = 3e-48
 Identities = 104/205 (50%), Positives = 131/205 (63%), Gaps = 1/205 (0%)
 Frame = +3

Query: 282 LVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKA 461
           +  P  + KYT+  IN +FVDS SGKTF T +P T   I  V+EG+  DI+ AV AA+KA
Sbjct: 1   MADPNAKPKYTKLFINNEFVDSVSGKTFATFNPATSKEIVQVSEGDKADIDLAVKAAKKA 60

Query: 462 FD-EGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLF 638
           F  +  W K+S  +R+ +M K   L+++    LA+LET DNGKPY +A       I+ L 
Sbjct: 61  FHRDSEWRKLSPLQRTNLMNKLCALMDRDKAFLASLETQDNGKPYAEALFDVTYSILTL- 119

Query: 639 HYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTV 818
            YYAGW DK  G T+PA G     T  EP+GV GQIIPWN+PL M AWK GPALA G T+
Sbjct: 120 QYYAGWTDKFFGDTIPAGG-FVSMTRKEPVGVVGQIIPWNYPLLMLAWKWGPALAVGCTI 178

Query: 819 VLKTAEQTPLTALYAGKLFHEAGLP 893
           ++K AEQTPLTAL+   L  EAG P
Sbjct: 179 IMKPAEQTPLTALHMAALAKEAGFP 203



>gb:NCB11B23_1688984 Neurospora crassa DNA linkage group II BAC
           clone B11B23.
          Length = 494

 Score =  192 bits (488), Expect = 7e-48
 Identities = 99/191 (51%), Positives = 126/191 (65%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           IN +FV+    KTF  ++P TE+VI  V E   +D++ AVAAARKAF EG W  ++  +R
Sbjct: 25  INNEFVEGVDKKTFEVINPATEEVICSVHEATEKDVDIAVAAARKAF-EGVWRDVTPQQR 83

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
              +LK ADL+EK++D LA +E+ DNGK    A + ++  +V    YY GWADKI G T+
Sbjct: 84  GIYLLKLADLLEKNLDLLAAVESLDNGKSITMA-RGDVGAVVGTIRYYGGWADKIEGKTI 142

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
                    T  EP+GV GQIIPWNFPL M AWKVGPALA GNT+V+KTAEQTPL+AL  
Sbjct: 143 DISPDSFHYTRQEPLGVCGQIIPWNFPLLMLAWKVGPALATGNTIVMKTAEQTPLSALVF 202

Query: 864 GKLFHEAGLPP 896
            +   EAG PP
Sbjct: 203 AQFVKEAGFPP 213



>gb:AF348414_1790091 Zea mays cytosolic aldehyde dehydrogenase RF2D
           (rf2d) gene, partial cds.
          Length = 466

 Score =  192 bits (487), Expect = 1e-47
 Identities = 100/179 (55%), Positives = 119/179 (66%)
 Frame = +3

Query: 357 KTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLV 536
           KTF T DPRT DV+AHVAE +  D++ AV +AR AF+ G WP+MS YER RIM K ADLV
Sbjct: 1   KTFDTRDPRTGDVLAHVAEADKADVDLAVKSARDAFEHGKWPRMSGYERGRIMSKLADLV 60

Query: 537 EKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTL 716
           E+H +ELA L+  D GK        ++P   ++  YYAG ADKIHG  +   G +   TL
Sbjct: 61  EQHTEELAALDGADAGKLLLLGKIIDIPAATQMLRYYAGAADKIHGDVLRVSGRYQGYTL 120

Query: 717 HEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
            EPIGV G IIPWNFP  MF  KV PALA G TVV+K AEQTPL+ALY   L   AG+P
Sbjct: 121 KEPIGVVGVIIPWNFPTMMFFLKVSPALAAGCTVVVKPAEQTPLSALYYAHLAKMAGVP 179



>gb:CR382123_1655809 Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 514

 Score =  191 bits (485), Expect = 2e-47
 Identities = 94/190 (49%), Positives = 129/190 (67%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           ING+FV S   KTF  L+P  E+ I H+ E   +D++ AVAAA+KAF+ G W      +R
Sbjct: 42  INGEFVPSRQHKTFEVLNPSNEEEITHIYEAREDDVDIAVAAAKKAFNNG-WSTAEPEDR 100

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
           ++ +LK ADL+++H + LA++E+ DNGK     ++ ++ ++ +     AGWADKI+G  +
Sbjct: 101 AKCLLKLADLIDQHAETLASIESLDNGKSLF-CSRGDVALVAKYLRSCAGWADKIYGKVI 159

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
                H   T  EP+GV GQIIPWNFPL M++WKVGPALA GNTVVLK AE TPL+ALYA
Sbjct: 160 DTGADHFSYTKREPLGVCGQIIPWNFPLLMWSWKVGPALATGNTVVLKPAEATPLSALYA 219

Query: 864 GKLFHEAGLP 893
            +L  EAG+P
Sbjct: 220 CQLVQEAGVP 229



>gb:AP006618_557598 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 507

 Score =  191 bits (485), Expect = 2e-47
 Identities = 98/199 (49%), Positives = 128/199 (64%), Gaps = 6/199 (3%)
 Frame = +3

Query: 315 QHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSA 494
           Q  I G++VD+ASG++F T+DP T  V+  VA G AED++RAV AAR AF EG W   + 
Sbjct: 31  QLFIGGRWVDAASGRSFETVDPATGQVLTTVAHGGAEDVDRAVRAARTAF-EGEWSLWTP 89

Query: 495 YERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHG 674
            +R R++ +  + + +H +ELA LE+ DNGK    A   ++  +  LF YYAGWA KI G
Sbjct: 90  AQRQRLLFRIGEAIFEHAEELAQLESLDNGKSAAVAQAVDITWVAELFQYYAGWATKIEG 149

Query: 675 LTVPADGPH------HVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAE 836
            T+P   P       H  TL EP+GV G I PWNFPL M A+K+  ALACGNT+V+K AE
Sbjct: 150 RTIPVSMPWAPGTQWHAYTLREPVGVCGAITPWNFPLLMVAFKLPVALACGNTIVVKPAE 209

Query: 837 QTPLTALYAGKLFHEAGLP 893
           QTPLT L   ++  EAGLP
Sbjct: 210 QTPLTTLRLAEIMVEAGLP 228



>gb:BC082822_2562898 Xenopus tropicalis hypothetical LOC496436, mRNA
            (cDNA clone MGC:79668 IMAGE:6980483), complete cds.
          Length = 902

 Score =  190 bits (483), Expect = 3e-47
 Identities = 97/223 (43%), Positives = 141/223 (63%), Gaps = 4/223 (1%)
 Frame = +3

Query: 237  ESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEG 416
            E G +        +E+ +  V++ + Q  ING+F+D+  GKT+ T++P     I  V+  
Sbjct: 398  EDGEEELVVDYVEKEINNMTVKIPH-QLFINGQFIDAEGGKTYDTVNPTDGTAICKVSLA 456

Query: 417  EAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYE 596
            +  DI+RAVAAA++AF+ G W KM+  +R RI+ + AD++E+H +ELAT+E+ D+G  Y 
Sbjct: 457  QVSDIDRAVAAAKEAFENGEWGKMNPRDRGRILYRLADIMEEHQEELATIESIDSGAVYT 516

Query: 597  QAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTL----HEPIGVAGQIIPWNFP 764
             A K+ + M ++ F Y+AGW DKI G T+P +     + L     EPIGV G +IPWN+P
Sbjct: 517  LALKTHVGMSIQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTRREPIGVCGIVIPWNYP 576

Query: 765  LAMFAWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
            L M AWK    LA GNTVVLK A+ TPLTAL   +L  +AG+P
Sbjct: 577  LMMLAWKTAACLAAGNTVVLKPAQVTPLTALKFAELSVKAGIP 619



>gb:AY034137_2074207 Rattus norvegicus aldehyde dehydrogenase gene,
           exons 3 through 13 and partial cds; nuclear gene for
           mitochondrial product.
          Length = 443

 Score =  190 bits (483), Expect = 3e-47
 Identities = 91/158 (57%), Positives = 111/158 (70%), Gaps = 1/158 (0%)
 Frame = +3

Query: 426 DINRAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQA 602
           D+++AV AA+ AF  G PW +M A +R R++ + ADL+E+    LA LET DNGKPY  +
Sbjct: 1   DVDKAVKAAQAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYLAALETLDNGKPYVIS 60

Query: 603 AKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAW 782
              +L M+++   YYAGWADK HG T+P DG     T HEP+GV GQIIPWNFPL M AW
Sbjct: 61  YLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAW 120

Query: 783 KVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
           K+GPALA GN VV+K AEQTPLTALY   L  EAG PP
Sbjct: 121 KLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPP 158



>gb:PAU40996_1698911 Hansenula polymorpha aldehyde dehydrogenase
           (ALD) gene, nuclear gene encoding mitochondrial protein,
           complete cds.
          Length = 518

 Score =  190 bits (483), Expect = 3e-47
 Identities = 97/190 (51%), Positives = 123/190 (64%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           IN +FV S   KTF  ++P TE+ I HV E   ED++ AV AA KAF +G W       R
Sbjct: 46  INNEFVPSKQHKTFEVINPATEEEICHVYEARKEDVDVAVDAAEKAF-KGSWSTADPAIR 104

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
            + +   A+L+E H D LA +E+ DNGK   Q A+ ++ +++      AGWADK+ G  +
Sbjct: 105 GKALWNLAELLEAHKDTLAAIESLDNGKAL-QLAQGDVALVINYIRSCAGWADKLTGQYI 163

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
                HH  T  EPIGV GQIIPWNFPL M++WKVGPALA GNTVVLKTAE TPL+ALYA
Sbjct: 164 DTGDTHHTYTKREPIGVCGQIIPWNFPLLMWSWKVGPALAAGNTVVLKTAESTPLSALYA 223

Query: 864 GKLFHEAGLP 893
            +L  EAG+P
Sbjct: 224 SQLVKEAGIP 233



>gb:AY249529_602362 Rhodococcus ruber aldh6-adh6 operon, complete
           sequence.
          Length = 509

 Score =  190 bits (483), Expect = 3e-47
 Identities = 98/199 (49%), Positives = 124/199 (62%), Gaps = 6/199 (3%)
 Frame = +3

Query: 315 QHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSA 494
           Q  I+G++VD+A G+TF T DP T   I  VA G  ED++RAVAAAR+AFD+G W  M  
Sbjct: 32  QLFIDGQWVDAADGRTFGTYDPATGAEITQVAHGGPEDVDRAVAAARRAFDDGDWATMKP 91

Query: 495 YERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHG 674
            +R +I+ +  DL++   + L  +E  DNGK    A   ++     +F YYAGW  KI G
Sbjct: 92  NKREQILWRIGDLLDARGEMLGQIEALDNGKSAAIATAVDVTFAADVFRYYAGWCTKIEG 151

Query: 675 LTVPADGP------HHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAE 836
            TV    P       H  T   P+GV GQIIPWNFPL M AWK+ PALA GNT+VLK AE
Sbjct: 152 TTVDVSMPFAGDKQFHAYTQRVPVGVCGQIIPWNFPLLMAAWKLAPALATGNTLVLKPAE 211

Query: 837 QTPLTALYAGKLFHEAGLP 893
           QTPLTAL  G++  EAG+P
Sbjct: 212 QTPLTALLLGEIMAEAGVP 230



>gb:AE016816_1746648 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome III, complete sequence.
          Length = 513

 Score =  190 bits (482), Expect = 4e-47
 Identities = 95/190 (50%), Positives = 125/190 (65%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           I+GKFV S   KTF  +DP TE+ I HV E   ED++ AVAAA++AF   PW +     R
Sbjct: 42  IDGKFVPSHQAKTFEVIDPGTEEEITHVYEAREEDVDAAVAAAKRAFL--PWSRADPEVR 99

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
           ++ + K ADL+EKH + LA +E+ DNGK     ++ ++ ++ R      GWADKI+G  +
Sbjct: 100 AQCLFKLADLIEKHQETLANIESLDNGKSL-LCSRGDVALVARYLRTCGGWADKIYGNVM 158

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
                H   T  EP+GV GQIIPWNFPL M++WK+GPALA GNTVVLK AE TPL+ALY 
Sbjct: 159 ETGPDHFSYTRREPLGVCGQIIPWNFPLLMWSWKIGPALATGNTVVLKPAESTPLSALYV 218

Query: 864 GKLFHEAGLP 893
             L +EAG+P
Sbjct: 219 CNLANEAGIP 228



>pir|D88449|D88449 protein F54D8.3 [imported] - Caenorhabditis
           elegans
          Length = 544

 Score =  189 bits (481), Expect = 5e-47
 Identities = 101/212 (47%), Positives = 132/212 (62%), Gaps = 16/212 (7%)
 Frame = +3

Query: 306 KYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGP-WP 482
           +YT   IN +FV + SGKTF T++P    V+A VAEG+  D+N AV AA+ AF  G  W 
Sbjct: 47  QYTGIFINNEFVPAKSGKTFETINPANGKVLAQVAEGDKTDVNIAVKAAQNAFRIGSEWR 106

Query: 483 KMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG--- 653
           +M A +R  ++ + ADL+E+    LA+LE+ DNGKPY  A  ++LP+ ++          
Sbjct: 107 RMDASQRGVLLNRLADLMERDRVILASLESLDNGKPYAVAYNADLPLSIKTLRKLTAKKC 166

Query: 654 ------------WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPA 797
                        ADK HG T+P +G +   T HEP+GV GQIIPWNFPL M AWK+GPA
Sbjct: 167 NFLNQILFLLRRMADKNHGKTIPIEGDYFTYTRHEPVGVCGQIIPWNFPLLMQAWKLGPA 226

Query: 798 LACGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
           LA GNTVV+K AEQTPL+AL+   L  EAG P
Sbjct: 227 LAMGNTVVMKVAEQTPLSALHVAALTKEAGFP 258



>gb:AF275347_1782534 Cladosporium fulvum aldehyde dehydrogenase
           (aldh) mRNA, complete cds.
          Length = 497

 Score =  188 bits (477), Expect = 1e-46
 Identities = 97/191 (50%), Positives = 124/191 (64%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           IN ++V   SGK F  ++P  E VI  VAE + +D++ AVAAARKAF EGPW + +   R
Sbjct: 23  INNEWVKPVSGKFFDVINPTDESVICQVAEADEKDVDIAVAAARKAF-EGPWRQETPENR 81

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
            ++++K A+L EK++D  A+++  DNGK +  A K ++ M      YY GWADKI G  V
Sbjct: 82  GKLLVKLAELFEKNLDLFASVKALDNGKAFNMA-KVDIGMCAGCLRYYGGWADKIEGKVV 140

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
                       EPIGV GQIIPWNFPL M+AWK+GPA+A GNTVV+KTAEQTPL A  A
Sbjct: 141 DTTPDTFNYIKKEPIGVCGQIIPWNFPLLMWAWKIGPAVATGNTVVIKTAEQTPLGAYVA 200

Query: 864 GKLFHEAGLPP 896
             L  EAG PP
Sbjct: 201 ANLIKEAGFPP 211



>gb:OMMOMEGCRY_1391246 Ommastrephes sloanei omega-crystallin gene,
           complete cds.
          Length = 495

 Score =  187 bits (476), Expect = 2e-46
 Identities = 87/200 (43%), Positives = 130/200 (65%), Gaps = 1/200 (0%)
 Frame = +3

Query: 300 EVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG-P 476
           E+K+ +  IN +FV+S S K +P  +P   + +  V EG+  DI++AV A + AF  G P
Sbjct: 12  EIKHNKIFINNQFVNSTSNKAYPVYNPCDNEKVCEVQEGDKSDIDKAVQACKAAFKRGTP 71

Query: 477 WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW 656
           W +M A     ++ + ADL+E+ +  +A+LET D GKPY+ + + ++   +++  Y+AGW
Sbjct: 72  WRRMDASRLGHLLYRLADLMERDIAYMASLETMDTGKPYKNSYQ-DMVHCIQVLRYFAGW 130

Query: 657 ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAE 836
           ADK  G ++P DG     T +EP+GV G +IP+N+P+ M  WK+ PALACGN +++K AE
Sbjct: 131 ADKNMGESIPVDGDFFCYTRNEPVGVCGLLIPYNYPMLMMTWKMAPALACGNCMIVKPAE 190

Query: 837 QTPLTALYAGKLFHEAGLPP 896
           QTPLTALY   L  EAG PP
Sbjct: 191 QTPLTALYCASLIKEAGFPP 210



>sp|P30842|CROM_OMMSL Omega-crystallin.
          Length = 494

 Score =  187 bits (476), Expect = 2e-46
 Identities = 87/200 (43%), Positives = 130/200 (65%), Gaps = 1/200 (0%)
 Frame = +3

Query: 300 EVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG-P 476
           E+K+ +  IN +FV+S S K +P  +P   + +  V EG+  DI++AV A + AF  G P
Sbjct: 11  EIKHNKIFINNQFVNSTSNKAYPVYNPCDNEKVCEVQEGDKSDIDKAVQACKAAFKRGTP 70

Query: 477 WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGW 656
           W +M A     ++ + ADL+E+ +  +A+LET D GKPY+ + + ++   +++  Y+AGW
Sbjct: 71  WRRMDASRLGHLLYRLADLMERDIAYMASLETMDTGKPYKNSYQ-DMVHCIQVLRYFAGW 129

Query: 657 ADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAE 836
           ADK  G ++P DG     T +EP+GV G +IP+N+P+ M  WK+ PALACGN +++K AE
Sbjct: 130 ADKNMGESIPVDGDFFCYTRNEPVGVCGLLIPYNYPMLMMTWKMAPALACGNCMIVKPAE 189

Query: 837 QTPLTALYAGKLFHEAGLPP 896
           QTPLTALY   L  EAG PP
Sbjct: 190 QTPLTALYCASLIKEAGFPP 209



>gb:SCO939121_178585 Streptomyces coelicolor A3(2) complete genome;
           segment 18/29.
          Length = 480

 Score =  187 bits (474), Expect = 3e-46
 Identities = 92/190 (48%), Positives = 126/190 (66%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           I+G+F ++A GK F T+ P TE+V++ VAE    D++RAV AARKAF++  W  +   ER
Sbjct: 29  IDGEFTEAADGKVFKTVSPATEEVLSEVAEAGEADVDRAVKAARKAFEK--WSALPGAER 86

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
           ++ + + A ++++   ELA LET DNGKP  +   ++LP++   F YYAGWADK+     
Sbjct: 87  AKYLFRIARIIQERSRELAVLETLDNGKPIRETRDADLPLVAAHFFYYAGWADKLDHAGY 146

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
            AD          P+GVAGQ+IPWNFPL M AWK+ PALA GNTVVLK AE TPL+AL+ 
Sbjct: 147 GADP--------RPLGVAGQVIPWNFPLLMLAWKIAPALATGNTVVLKPAETTPLSALFF 198

Query: 864 GKLFHEAGLP 893
             +  +AGLP
Sbjct: 199 ADICRQAGLP 208



>gb:BC073490_2557326 Xenopus laevis MGC81015 protein, mRNA (cDNA clone
            MGC:81015 IMAGE:5570748), complete cds.
          Length = 902

 Score =  186 bits (473), Expect = 4e-46
 Identities = 98/232 (42%), Positives = 141/232 (60%), Gaps = 12/232 (5%)
 Frame = +3

Query: 234  VESGIQRFSTAAAVEELVSPAVEVKYT--------QHIINGKFVDSASGKTFPTLDPRTE 389
            ++  ++R       EELV   VE +          Q  ING+F+D+  GK++ T++P   
Sbjct: 388  IQMVVRRMRGEDGEEELVIDYVEKEINNMTVKIPHQLFINGQFMDAEGGKSYDTINPTDG 447

Query: 390  DVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLE 569
              I  V+  +  DI+RAVAAA++AF+ G W KM+  +R R++ + ADL+E+H +ELAT+E
Sbjct: 448  TAICKVSLAQISDIDRAVAAAKEAFENGEWGKMNPRDRGRLLYRLADLMEEHQEELATIE 507

Query: 570  TWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTL----HEPIGVA 737
            + D+G  Y  A K+ + M ++ F Y+AGW DKI G T+P +     + L     EPIGV 
Sbjct: 508  SIDSGAVYTLALKTHVGMSIQTFRYFAGWCDKIQGRTIPINQARPNRNLTFTRREPIGVC 567

Query: 738  GQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
            G +IPWN+PL M AWK    L  GNTVVLK A+ TPLTAL   +L  +AG+P
Sbjct: 568  GIVIPWNYPLMMLAWKTAACLTAGNTVVLKPAQVTPLTALKFAELSVKAGIP 619



>sp|Q25417|DHAM_LEITA Aldehyde dehydrogenase, mitochondrial
           precursor (EC 1.2.1.3) (ALDH class 2)
           (P51).>pir|S43184|S43184 aldehyde dehydrogenase (NAD)
           (EC 1.2.1.3) precursor, mitochondrial - Leishmania
           tarentolae>gb:LTALDDE_1389226 L.tarentolae (UC) gene for
           aldehyde dehydrogenase.
          Length = 498

 Score =  186 bits (473), Expect = 4e-46
 Identities = 104/212 (49%), Positives = 136/212 (64%)
 Frame = +3

Query: 258 STAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINR 437
           +T A +E  ++P V     + +INGKFV + SGKTF  ++P  E VIA+VAE E  D++ 
Sbjct: 4   ATLARLE--MAPKVTHIQEKLLINGKFVPAVSGKTFEVVNPADEKVIANVAEAEKADVDL 61

Query: 438 AVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSEL 617
           AV AAR AF+   +       R  +ML+ AD++EK+  E+A LE+ DNGKPYE A   ++
Sbjct: 62  AVKAARHAFES--FRMTDCQWRRNLMLRLADILEKNSKEMAALESLDNGKPYEVALNVDV 119

Query: 618 PMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPA 797
            + V  F Y AG ADK++G   P  G        +PIGV GQIIPWNFPL M A+K+ PA
Sbjct: 120 ALSVECFRYCAGLADKVNGTVPPRSGNFLGIVKRQPIGVCGQIIPWNFPLLMAAFKLSPA 179

Query: 798 LACGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
           LA GNTVVLK AEQTPLTA+  G++  EAG P
Sbjct: 180 LAMGNTVVLKPAEQTPLTAVRLGEMVMEAGYP 211



>gb:CR380956_1652119 Candida glabrata strain CBS138 chromosome J
           complete sequence.
          Length = 517

 Score =  186 bits (471), Expect = 7e-46
 Identities = 98/219 (44%), Positives = 141/219 (64%), Gaps = 3/219 (1%)
 Frame = +3

Query: 246 IQRFSTAAAVEELVSPAVEVKYTQH---IINGKFVDSASGKTFPTLDPRTEDVIAHVAEG 416
           ++ +ST   +E  V+    +KY Q     ING+FV S  GKTF  L+P TE+ IA + E 
Sbjct: 16  LRLYSTNVPLEVPVTLPNGIKYMQPTGLFINGEFVKSHEGKTFDVLNPSTEETIATLYEA 75

Query: 417 EAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYE 596
           +A D++ AV AA++AF E  W +     R+R +   ADLVE +++ LA +++ DNGK   
Sbjct: 76  QAADVDIAVKAAKEAF-ENHWSREDPEVRARALFNLADLVEANLETLAGIDSLDNGKSL- 133

Query: 597 QAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMF 776
             +++++ ++ +      GWADKI+G  +     H   ++ EP+GV GQIIPWNFPL M+
Sbjct: 134 LCSRADVALVAKYLRSCGGWADKIYGDVIDTGKSHFTYSVKEPLGVCGQIIPWNFPLLMW 193

Query: 777 AWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
           +WK+GPALA GNTVVLK AE TPL+AL+A KL  EAG+P
Sbjct: 194 SWKIGPALATGNTVVLKPAELTPLSALFASKLCQEAGIP 232



>gb:CR382131_1663463 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 522

 Score =  185 bits (470), Expect = 9e-46
 Identities = 107/223 (47%), Positives = 141/223 (63%), Gaps = 4/223 (1%)
 Frame = +3

Query: 237 ESGIQRFSTAAAVE-ELVSPAVEVKYTQHI---INGKFVDSASGKTFPTLDPRTEDVIAH 404
           + G++R ST   V+ E ++     KY Q +   ING+FV S SGK F T +P TE  I  
Sbjct: 11  KGGLRRLSTLTPVKNEPLTLPNGAKYEQPVGLFINGEFVKSQSGKRFETENPTTETPIIS 70

Query: 405 VAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNG 584
           V E    D N AV AA+ AF    + K +  ER  ++ K ADL+E+ +D ++ +ET DNG
Sbjct: 71  VYEAGEADANAAVEAAKNAFKNWGF-KTAPSERGVLLNKLADLIERDLDLISAIETTDNG 129

Query: 585 KPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFP 764
           K + QA + ++ ++V++  YYAG+ADKI G  V  +      T  EP+GV GQIIPWNFP
Sbjct: 130 KVFAQA-QGDVALVVKVLRYYAGFADKIGGDLVQTNDGFFNYTRKEPLGVCGQIIPWNFP 188

Query: 765 LAMFAWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
           L M+AWK+ PAL  GNTVVLKTAE TPL+ALYA KL  EAG P
Sbjct: 189 LLMWAWKIAPALTTGNTVVLKTAESTPLSALYACKLSQEAGFP 231



>gb:BA000040_732036 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 495

 Score =  184 bits (467), Expect = 2e-45
 Identities = 99/204 (48%), Positives = 134/204 (65%), Gaps = 2/204 (0%)
 Frame = +3

Query: 288 SPAVE-VKYTQHI-INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKA 461
           SPA E +   QH+ I+G+ V ++SG+TF +L+P T  VIA VAEG   D++ AVAAAR+A
Sbjct: 11  SPASEFMARPQHLLIDGRRVPASSGRTFKSLNPATGQVIATVAEGNEADVDHAVAAARRA 70

Query: 462 FDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFH 641
           F EGPW  M A ER +I+L++A+L++ + +E+  LE+ D GKP     + + P  V    
Sbjct: 71  F-EGPWRTMRASERGQILLRWAELLKANAEEIIELESIDAGKPISATLRQDFPAAVDTLI 129

Query: 642 YYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVV 821
           YYAGWADKI G  VP        T+ EP+GV   I+PWNFPL +  WK+ PALACG T+V
Sbjct: 130 YYAGWADKISGDVVPVRDDALTYTVREPVGVVAAIVPWNFPLMIGMWKLAPALACGCTIV 189

Query: 822 LKTAEQTPLTALYAGKLFHEAGLP 893
           +K AE T L+AL   +L  +AGLP
Sbjct: 190 MKPAELTSLSALRIAELALQAGLP 213



>sp|P46367|DHA4_YEAST Potassium-activated aldehyde dehydrogenase,
           mitochondrial precursor (EC 1.2.1.3) (K(+)-activated
           acetaldehyde dehydrogenase)
           (K(+)-ACDH).>pir|S67286|S67286 probable aldehyde
           dehydrogenase (NAD) (EC 1.2.1.3) YOR374w - yeast
           (Saccharomyces cerevisiae)>gb:SCYOR374W_1714630
           S.cerevisiae chromosome XV reading frame ORF YOR374w.
          Length = 519

 Score =  184 bits (467), Expect = 2e-45
 Identities = 87/191 (45%), Positives = 122/191 (63%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           IN KFV S   KTF  ++P TE+ I H+ EG  +D+  AV AA +AF  G W  +   +R
Sbjct: 49  INNKFVPSKQNKTFEVINPSTEEEICHIYEGREDDVEEAVQAADRAFSNGSWNGIDPIDR 108

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
            + + + A+L+E+  D +A++ET DNGK    +++ ++ +++      AG+ADKI G  +
Sbjct: 109 GKALYRLAELIEQDKDVIASIETLDNGKAIS-SSRGDVDLVINYLKSSAGFADKIDGRMI 167

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
                H   T  +P+GV GQIIPWNFPL M+AWK+ PAL  GNTVVLKTAE TPL+ALY 
Sbjct: 168 DTGRTHFSYTKRQPLGVCGQIIPWNFPLLMWAWKIAPALVTGNTVVLKTAESTPLSALYV 227

Query: 864 GKLFHEAGLPP 896
            K   +AG+PP
Sbjct: 228 SKYIPQAGIPP 238



>gb:AE017346_1757528 Cryptococcus neoformans var. neoformans JEC21
           chromosome 6, complete sequence.
          Length = 506

 Score =  184 bits (466), Expect = 3e-45
 Identities = 90/192 (46%), Positives = 121/192 (63%), Gaps = 2/192 (1%)
 Frame = +3

Query: 324 INGKFVDSA--SGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAY 497
           ING++  S   + KT    +P T +V+  + E    D+N+AV  A  AF+      +  +
Sbjct: 26  INGEWASSVDKNAKTIDVYNPTTGEVLTKIPEALEADVNKAVEVAHNAFNNSWGLSVPGF 85

Query: 498 ERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGL 677
           +R   ++K A+L+E+ +D LA+LE  DNGK +  A   ++    R F YY GWADKIHG 
Sbjct: 86  KRGEYLIKIAELMERDLDILASLEALDNGKTFGAAKGFDVIESARTFRYYGGWADKIHGK 145

Query: 678 TVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTAL 857
            +         TLHEP+GV GQIIPWNFPL MF+WK+ PALA GNTVV+K +E TPLTA+
Sbjct: 146 VIETSSSKLTYTLHEPVGVCGQIIPWNFPLLMFSWKIAPALAAGNTVVIKPSELTPLTAM 205

Query: 858 YAGKLFHEAGLP 893
           Y  KLF+EAGLP
Sbjct: 206 YMTKLFNEAGLP 217



>gb:BA000030_701233 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 478

 Score =  184 bits (466), Expect = 3e-45
 Identities = 89/190 (46%), Positives = 127/190 (66%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           I+G+F ++A GK F T+ P TE+V++ +A+    D++RAV AARKAF++  W  +   ER
Sbjct: 27  IDGEFTEAADGKVFKTVSPSTEEVLSEIAQAGEADVDRAVKAARKAFEK--WSALPGSER 84

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
           ++ + + A ++++   ELA LET DNGKP ++   ++LP++   F YYAGWADK+     
Sbjct: 85  AKYLFRIARIIQERSRELAVLETLDNGKPIKETRDADLPLVAAHFFYYAGWADKLDHAGF 144

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
            A+          P+GVAGQ+IPWNFPL M AWK+ PALA GNTVVLK AE TPL+AL+ 
Sbjct: 145 GANP--------RPLGVAGQVIPWNFPLLMLAWKIAPALATGNTVVLKPAETTPLSALFF 196

Query: 864 GKLFHEAGLP 893
             +  +AGLP
Sbjct: 197 ADICRQAGLP 206



>gb:CR858605_1182772 Pongo pygmaeus mRNA; cDNA DKFZp469C068 (from
           clone DKFZp469C068).
          Length = 811

 Score =  183 bits (465), Expect = 3e-45
 Identities = 92/197 (46%), Positives = 129/197 (65%), Gaps = 4/197 (2%)
 Frame = +3

Query: 315 QHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSA 494
           Q  I G+FVD+   KT+ T++P    VI  V+  +  D+++AVAAA+ AF+ G W K+SA
Sbjct: 332 QLFIGGEFVDAEGAKTYETINPTDGSVICQVSLAQVTDVDKAVAAAKDAFENGRWGKISA 391

Query: 495 YERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHG 674
            +R R++ + ADL+E+H +ELAT+E  D G  Y  A K+ + M ++ F Y+AGW DKI G
Sbjct: 392 RDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKIQG 451

Query: 675 LTVPAD--GPHHVQTL--HEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQT 842
            T+P +   P+   TL   EP+GV G IIPWN+PL M +WK    LA GNTVV+K A+ T
Sbjct: 452 STIPINQARPNRNLTLTRKEPVGVCGIIIPWNYPLMMLSWKTAACLAAGNTVVIKPAQVT 511

Query: 843 PLTALYAGKLFHEAGLP 893
           PLTAL   +L  +AG+P
Sbjct: 512 PLTALKFAELTLKAGIP 528



>gb:CR857124_1181376 Pongo pygmaeus mRNA; cDNA DKFZp469I2021 (from
            clone DKFZp469I2021).
          Length = 902

 Score =  183 bits (465), Expect = 3e-45
 Identities = 92/197 (46%), Positives = 129/197 (65%), Gaps = 4/197 (2%)
 Frame = +3

Query: 315  QHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSA 494
            Q  I G+FVD+   KT+ T++P    VI  V+  +  D+++AVAAA+ AF+ G W K+SA
Sbjct: 423  QLFIGGEFVDAEGAKTYETINPTDGSVICQVSLAQVTDVDKAVAAAKDAFENGRWGKISA 482

Query: 495  YERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHG 674
             +R R++ + ADL+E+H +ELAT+E  D G  Y  A K+ + M ++ F Y+AGW DKI G
Sbjct: 483  RDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKIQG 542

Query: 675  LTVPAD--GPHHVQTL--HEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQT 842
             T+P +   P+   TL   EP+GV G IIPWN+PL M +WK    LA GNTVV+K A+ T
Sbjct: 543  STIPINQARPNRNLTLTRKEPVGVCGIIIPWNYPLMMLSWKTAACLAAGNTVVIKPAQVT 602

Query: 843  PLTALYAGKLFHEAGLP 893
            PLTAL   +L  +AG+P
Sbjct: 603  PLTALKFAELTLKAGIP 619



>gb:BC024055_2094353 Mus musculus formyltetrahydrofolate
            dehydrogenase, mRNA (cDNA clone MGC:36387 IMAGE:5098789),
            complete cds.
          Length = 902

 Score =  183 bits (464), Expect = 4e-45
 Identities = 90/197 (45%), Positives = 130/197 (65%), Gaps = 4/197 (2%)
 Frame = +3

Query: 315  QHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSA 494
            Q  I G+FVD+   KT+ T++P    VI  V+  +  D+++AVAAA++AF+ G W K++A
Sbjct: 423  QLFIGGEFVDAEGAKTYSTINPTDGSVICQVSLAQVSDVDKAVAAAKEAFENGLWGKINA 482

Query: 495  YERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHG 674
             +R R++ + ADL+E+H +ELAT+E  D G  Y  A K+ + M ++ F Y+AGW DKI G
Sbjct: 483  RDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKIQG 542

Query: 675  LTVPAD--GPHHVQTL--HEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQT 842
             T+P +   P+   TL   EP+GV G +IPWN+PL M +WK    LA GNTVV+K A+ T
Sbjct: 543  ATIPINQARPNRNLTLTKKEPVGVCGIVIPWNYPLMMLSWKTAACLAAGNTVVIKPAQVT 602

Query: 843  PLTALYAGKLFHEAGLP 893
            PLTAL   +L  +AG+P
Sbjct: 603  PLTALKFAELTLKAGIP 619



>sp|Q8R0Y6|FTDH_MOUSE 10-formyltetrahydrofolate dehydrogenase (EC
            1.5.1.6) (10-FTHFDH).>gb:BC025939_2095237 Mus musculus
            formyltetrahydrofolate dehydrogenase, mRNA (cDNA clone
            MGC:37834 IMAGE:5099360), complete
            cds.>gb:BC028817_2096325 Mus musculus
            formyltetrahydrofolate dehydrogenase, mRNA (cDNA clone
            MGC:36396 IMAGE:5101815), complete
            cds.>gb:BC030722_2096853 Mus musculus
            formyltetrahydrofolate dehydrogenase, mRNA (cDNA clone
            MGC:36386 IMAGE:5098671), complete
            cds.>gb:BC030723_2096854 Mus musculus
            formyltetrahydrofolate dehydrogenase, mRNA (cDNA clone
            MGC:36390 IMAGE:5100007), complete
            cds.>gb:BC030727_2096858 Mus musculus
            formyltetrahydrofolate dehydrogenase, mRNA (cDNA clone
            MGC:37826 IMAGE:5099026), complete
            cds.>gb:BC030730_2096861 Mus musculus
            formyltetrahydrofolate dehydrogenase, mRNA (cDNA clone
            MGC:37892 IMAGE:5101835), complete cds.
          Length = 902

 Score =  183 bits (464), Expect = 4e-45
 Identities = 90/197 (45%), Positives = 130/197 (65%), Gaps = 4/197 (2%)
 Frame = +3

Query: 315  QHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSA 494
            Q  I G+FVD+   KT+ T++P    VI  V+  +  D+++AVAAA++AF+ G W K++A
Sbjct: 423  QLFIGGEFVDAEGAKTYSTINPTDGSVICQVSLAQVSDVDKAVAAAKEAFENGLWGKINA 482

Query: 495  YERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHG 674
             +R R++ + ADL+E+H +ELAT+E  D G  Y  A K+ + M ++ F Y+AGW DKI G
Sbjct: 483  RDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKIQG 542

Query: 675  LTVPAD--GPHHVQTL--HEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQT 842
             T+P +   P+   TL   EP+GV G +IPWN+PL M +WK    LA GNTVV+K A+ T
Sbjct: 543  ATIPINQARPNRNLTLTKKEPVGVCGIVIPWNYPLMMLSWKTAACLAAGNTVVIKPAQVT 602

Query: 843  PLTALYAGKLFHEAGLP 893
            PLTAL   +L  +AG+P
Sbjct: 603  PLTALKFAELTLKAGIP 619



>gb:AB015227_1864683 Homo sapiens mRNA for RALDH2-T, complete
           cds.>gb:AB015228_1864684 Homo sapiens mRNA for RALDH2-T,
           complete cds.
          Length = 422

 Score =  182 bits (463), Expect = 6e-45
 Identities = 85/137 (62%), Positives = 102/137 (74%)
 Frame = +3

Query: 486 MSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADK 665
           M A ER R++ K ADLVE+    LAT+E+ + GKP+ QA   +L  +++ F YYAGWADK
Sbjct: 1   MDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTFRYYAGWADK 60

Query: 666 IHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTP 845
           IHG+T+P DG +   T HEPIGV GQIIPWNFPL MFAWK+ PAL CGNTVV+K AEQTP
Sbjct: 61  IHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTP 120

Query: 846 LTALYAGKLFHEAGLPP 896
           L+ALY G L  EAG PP
Sbjct: 121 LSALYMGALIKEAGFPP 137



>gb:CR749807_1181269 Homo sapiens mRNA; cDNA DKFZp781N0997 (from clone
            DKFZp781N0997).
          Length = 912

 Score =  182 bits (463), Expect = 6e-45
 Identities = 93/197 (47%), Positives = 128/197 (64%), Gaps = 4/197 (2%)
 Frame = +3

Query: 315  QHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSA 494
            Q  I G+FVD+   KT  T++P    VI  V+  +  D+++AVAAA+ AF+ G W K+SA
Sbjct: 433  QLFIGGEFVDAEGAKTSETINPTDGSVICQVSLAQVTDVDKAVAAAKDAFENGRWGKISA 492

Query: 495  YERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHG 674
             +R R+M + ADL+E+H +ELAT+E  D G  Y  A K+ + M ++ F Y+AGW DKI G
Sbjct: 493  RDRGRLMYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKIQG 552

Query: 675  LTVPAD--GPHHVQTL--HEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQT 842
             T+P +   P+   TL   EP+GV G IIPWN+PL M +WK    LA GNTVV+K A+ T
Sbjct: 553  STIPINQARPNRNLTLTRKEPVGVCGIIIPWNYPLMMLSWKTAACLAAGNTVVIKPAQVT 612

Query: 843  PLTALYAGKLFHEAGLP 893
            PLTAL   +L  +AG+P
Sbjct: 613  PLTALKFAELTLKAGIP 629



>sp|O14293|YF19_SCHPO Hypothetical aldehyde-dehydrogenase like
           protein C9E9.09c (EC 1.2.1.-).>pir|T39216|T39216
           aldehyde dehydrogenase - fission yeast
           (Schizosaccharomyces pombe)>gb:SPAC9E9_1718517 S.pombe
           chromosome I cosmid c9E9.
          Length = 503

 Score =  182 bits (463), Expect = 6e-45
 Identities = 91/192 (47%), Positives = 119/192 (61%), Gaps = 1/192 (0%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFD-EGPWPKMSAYE 500
           IN + VDS  G       P TE +I  VA+ + ED++ AV  AR AF  + PW K S+ +
Sbjct: 27  INNQHVDSVHGGRVKVYSPSTEKLICEVADADEEDVDIAVKVARAAFQTDAPWRKFSSAQ 86

Query: 501 RSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLT 680
           R R + + AD +E++++ LA++ET DNGK     A+ ++      F YY GWADK +G T
Sbjct: 87  RGRCLSRLADCIEQNLEYLASIETLDNGKSIT-LARGDVQAAADCFRYYGGWADKDYGQT 145

Query: 681 VPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALY 860
           +  D      T HEPIGV GQIIPWNFP  M AWK+ PA+ACGNT++LKTAE TPL+AL 
Sbjct: 146 IETDIKRFAYTRHEPIGVCGQIIPWNFPFLMCAWKIAPAVACGNTIILKTAELTPLSALC 205

Query: 861 AGKLFHEAGLPP 896
             K   E G PP
Sbjct: 206 LTKFVPECGFPP 217



>sp|P28037|FTDH_RAT 10-formyltetrahydrofolate dehydrogenase (EC
            1.5.1.6) (10-FTHFDH) (FBP- CI).>gb:RAT10HCO_2131260
            Rattus norvegicus 10-formyltetrahydrofolate dehydrogenase
            mRNA, complete cds.
          Length = 902

 Score =  182 bits (462), Expect = 8e-45
 Identities = 89/197 (45%), Positives = 130/197 (65%), Gaps = 4/197 (2%)
 Frame = +3

Query: 315  QHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSA 494
            Q  I G+FVD+   KT+ T++P    VI  V+  +  D+++AVAAA++AF+ G W K++A
Sbjct: 423  QLFIGGEFVDAEGSKTYNTINPTDGSVICQVSLAQVSDVDKAVAAAKEAFENGLWGKINA 482

Query: 495  YERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHG 674
             +R R++ + AD++E+H +ELAT+E  D G  Y  A K+ + M ++ F Y+AGW DKI G
Sbjct: 483  RDRGRLLYRLADVMEQHQEELATIEALDRGAVYTLALKTHVGMSIQTFRYFAGWCDKIQG 542

Query: 675  LTVPAD--GPHHVQTL--HEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQT 842
             T+P +   P+   TL   EP+GV G +IPWN+PL M +WK    LA GNTVV+K A+ T
Sbjct: 543  ATIPINQARPNRNLTLTKKEPVGVCGIVIPWNYPLMMLSWKTAACLAAGNTVVIKPAQVT 602

Query: 843  PLTALYAGKLFHEAGLP 893
            PLTAL   +L  +AG+P
Sbjct: 603  PLTALKFAELTLKAGIP 619



>sp|O75891|FTDH_HUMAN 10-formyltetrahydrofolate dehydrogenase (EC
            1.5.1.6) (10-FTHFDH).>gb:AF052732_1879268 Homo sapiens
            10-formyltetrahydrofolate dehydrogenase mRNA, complete
            cds.
          Length = 902

 Score =  182 bits (462), Expect = 8e-45
 Identities = 93/197 (47%), Positives = 128/197 (64%), Gaps = 4/197 (2%)
 Frame = +3

Query: 315  QHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSA 494
            Q  I G+FVD+   KT  T++P    VI  V+  +  D+++AVAAA+ AF+ G W K+SA
Sbjct: 423  QLFIGGEFVDAEGAKTSETINPTDGSVICQVSLAQVTDVDKAVAAAKGAFENGRWGKISA 482

Query: 495  YERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHG 674
             +R R+M + ADL+E+H +ELAT+E  D G  Y  A K+ + M ++ F Y+AGW DKI G
Sbjct: 483  RDRGRLMYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKIQG 542

Query: 675  LTVPAD--GPHHVQTL--HEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQT 842
             T+P +   P+   TL   EP+GV G IIPWN+PL M +WK    LA GNTVV+K A+ T
Sbjct: 543  STIPINQARPNRNLTLTRKEPVGVCGIIIPWNYPLMMLSWKTAACLAAGNTVVIKPAQVT 602

Query: 843  PLTALYAGKLFHEAGLP 893
            PLTAL   +L  +AG+P
Sbjct: 603  PLTALKFAELTLKAGIP 619



>gb:BC089101_2110709 Rattus norvegicus formyltetrahydrofolate
            dehydrogenase, mRNA (cDNA clone MGC:105431
            IMAGE:7306458), complete cds.
          Length = 902

 Score =  182 bits (461), Expect = 1e-44
 Identities = 92/211 (43%), Positives = 135/211 (63%), Gaps = 4/211 (1%)
 Frame = +3

Query: 273  VEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAA 452
            VE+ V+        Q  I G+FVD+   KT+ T++P    VI  V+  +  D+++AVAAA
Sbjct: 409  VEKAVNKLTLQMPYQLFIGGEFVDAEGSKTYNTINPTDGSVICQVSLAQVSDVDKAVAAA 468

Query: 453  RKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVR 632
            ++AF+ G W K++A +R R++ + AD++E+H +ELAT+E  D G  Y  A K+ + M ++
Sbjct: 469  KEAFENGLWGKINARDRGRLLYRLADVMEQHQEELATIEALDAGAVYTLALKTHVGMSIQ 528

Query: 633  LFHYYAGWADKIHGLTVPAD--GPHHVQTL--HEPIGVAGQIIPWNFPLAMFAWKVGPAL 800
             F Y+AGW DKI G T+P +   P+   TL   EP+GV G +IPWN+PL M +WK    L
Sbjct: 529  TFRYFAGWCDKIQGATIPINQARPNRNLTLTKKEPVGVCGIVIPWNYPLMMLSWKTAACL 588

Query: 801  ACGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
            A GNTVV+K A+ TPLTAL   +L  +AG+P
Sbjct: 589  AAGNTVVIKPAQVTPLTALKFAELTLKAGIP 619



>gb:BC034531_2097679 Mus musculus RIKEN cDNA D330038I09 gene, mRNA
            (cDNA clone MGC:19039 IMAGE:4188055), complete cds.
          Length = 923

 Score =  181 bits (459), Expect = 2e-44
 Identities = 94/210 (44%), Positives = 134/210 (63%), Gaps = 4/210 (1%)
 Frame = +3

Query: 276  EELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR 455
            +E+    V++ Y Q  ING+FVD+  G+T+ T++P     I  V+     D++RAVAAA+
Sbjct: 432  KEVNGMTVKIPY-QCFINGQFVDAEDGETYATVNPTDGTTICRVSHASLADVDRAVAAAK 490

Query: 456  KAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRL 635
             AF+ G W +M+A +R R+M + ADL+E++ +ELAT+E  D+G  Y  A K+ + M V+ 
Sbjct: 491  DAFENGEWGRMNARDRGRLMYRLADLMEENQEELATIEALDSGAVYTLALKTHIGMSVQT 550

Query: 636  FHYYAGWADKIHGLTVPAD--GPHH--VQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALA 803
            F Y+AGW DKI G T+P +   P++    T  EP+G    IIPWN+PL M AWK    LA
Sbjct: 551  FRYFAGWCDKIQGSTIPINQARPNYNLTFTKKEPLGACAIIIPWNYPLMMLAWKSAACLA 610

Query: 804  CGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
             GNT+VLK A+ TPLTAL   +L  +AG P
Sbjct: 611  AGNTLVLKPAQVTPLTALKFAELTVKAGFP 640



>gb:AK095827_1914446 Homo sapiens cDNA FLJ38508 fis, clone
            HCHON2000322, moderately similar to
            10-FORMYLTETRAHYDROFOLATE DEHYDROGENASE (EC 1.5.1.6).
          Length = 752

 Score =  180 bits (457), Expect = 3e-44
 Identities = 91/197 (46%), Positives = 125/197 (63%), Gaps = 4/197 (2%)
 Frame = +3

Query: 315  QHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSA 494
            Q  ING+F D+  GKT+ T++P     I  V+     D+++AVAAA+ AF+ G W +M+A
Sbjct: 444  QCFINGQFTDADDGKTYDTINPTDGSTICKVSYASLADVDKAVAAAKDAFENGEWGRMNA 503

Query: 495  YERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHG 674
             ER R+M + ADL+E++ +ELAT+E  D+G  Y  A K+ + M V+ F Y+AGW DKI G
Sbjct: 504  RERGRLMYRLADLLEENQEELATIEALDSGAVYTLALKTHIGMSVQTFRYFAGWCDKIQG 563

Query: 675  LTVPADGPHHVQTL----HEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQT 842
             T+P +     + L     EP+GV   IIPWN+PL M AWK    LA GNT+VLK A+ T
Sbjct: 564  STIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMMLAWKSAACLAAGNTLVLKPAQVT 623

Query: 843  PLTALYAGKLFHEAGLP 893
            PLTAL   +L  +AG P
Sbjct: 624  PLTALKFAELSVKAGFP 640



>gb:AX358538_1466223 Sequence 1 from Patent
            WO0200863.>gb:AX358540_1466224 Sequence 3 from Patent
            WO0200863.
          Length = 923

 Score =  180 bits (457), Expect = 3e-44
 Identities = 91/197 (46%), Positives = 125/197 (63%), Gaps = 4/197 (2%)
 Frame = +3

Query: 315  QHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSA 494
            Q  ING+F D+  GKT+ T++P     I  V+     D+++AVAAA+ AF+ G W +M+A
Sbjct: 444  QCFINGQFTDADDGKTYDTINPTDGSTICKVSYASLADVDKAVAAAKDAFENGEWGRMNA 503

Query: 495  YERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHG 674
             ER R+M + ADL+E++ +ELAT+E  D+G  Y  A K+ + M V+ F Y+AGW DKI G
Sbjct: 504  RERGRLMYRLADLLEENQEELATIEALDSGAVYTLALKTHIGMSVQTFRYFAGWCDKIQG 563

Query: 675  LTVPADGPHHVQTL----HEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQT 842
             T+P +     + L     EP+GV   IIPWN+PL M AWK    LA GNT+VLK A+ T
Sbjct: 564  STIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMMLAWKSAACLAAGNTLVLKPAQVT 623

Query: 843  PLTALYAGKLFHEAGLP 893
            PLTAL   +L  +AG P
Sbjct: 624  PLTALKFAELSVKAGFP 640



>gb:BC026667_2095493 Mus musculus aldehyde dehydrogenase family 1,
           subfamily A3, mRNA (cDNA clone IMAGE:5005066), partial
           cds.
          Length = 232

 Score =  180 bits (456), Expect = 4e-44
 Identities = 89/163 (54%), Positives = 108/163 (66%), Gaps = 1/163 (0%)
 Frame = +3

Query: 411 EGEAEDINRAVAAARKAFDEG-PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGK 587
           EG+  D+++AV AA+ AF  G PW ++ A  R +++ + ADLVE+    LATLET D GK
Sbjct: 2   EGDKPDVDKAVEAAQAAFQRGSPWRRLDALSRGQLLHQLADLVERDRAILATLETMDTGK 61

Query: 588 PYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPL 767
           P+  A   +L   ++ F Y+AGWADKI G T+P D      T HEPIGV G I PWNFPL
Sbjct: 62  PFLHAFFVDLEGCIKTFRYFAGWADKIQGRTIPTDDNVVCFTRHEPIGVCGAITPWNFPL 121

Query: 768 AMFAWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
            M AWK+ PAL CGNTVVLK AEQTPLTALY   L  E G PP
Sbjct: 122 LMLAWKLAPALCCGNTVVLKPAEQTPLTALYLASLIKEVGFPP 164



>pir|E95942|E95942 probable aldehyde dehydrogenase (NAD) (EC
           1.2.1.3) membrane-anchored [imported] - Sinorhizobium
           meliloti  (strain 1021) magaplasmid
           pSymB>gb:RME591985_165453 Sinorhizobium meliloti 1021
           complete pSymB.
          Length = 794

 Score =  180 bits (456), Expect = 4e-44
 Identities = 94/193 (48%), Positives = 123/193 (63%)
 Frame = +3

Query: 318 HIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAY 497
           H ING FV SASGK+F T +P T  ++A +A G  +D+N AVAAARKA  +GPW K+S +
Sbjct: 35  HFINGAFVGSASGKSFDTFEPATGKLLAKIAHGGRDDVNAAVAAARKA--QGPWAKLSGH 92

Query: 498 ERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGL 677
            R+R +   A L+++H   +A +E  DNGKP  +    ++P+  R F+++AGWA      
Sbjct: 93  ARARHLYALARLIQRHARLIAVVEALDNGKPIRETRDIDIPLAARHFYHHAGWAQLQE-- 150

Query: 678 TVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTAL 857
           T  AD          P+GV GQ+IPWNFP  M AWKV PALA GN+V+LK AE TPLTAL
Sbjct: 151 TEFAD--------QVPVGVVGQVIPWNFPFLMLAWKVAPALALGNSVILKPAEFTPLTAL 202

Query: 858 YAGKLFHEAGLPP 896
              +L   AGLPP
Sbjct: 203 LFAELAAAAGLPP 215



>pir|S50576|S50576 probable aldehyde dehydrogenase (NAD) (EC
           1.2.1.3) YER073w - yeast (Saccharomyces
           cerevisiae)>gb:SCE3612_1707963 Saccharomyces cerevisiae
           chromosome V lambda clone 3612 and cosmid 9747.
          Length = 520

 Score =  179 bits (453), Expect = 8e-44
 Identities = 90/190 (47%), Positives = 124/190 (65%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           ING+FV S   KTF  ++P  E+ I  V +   +D++ AVAAA+KAF E  W  +    R
Sbjct: 48  INGEFVASKQKKTFDVINPSNEEKITTVYKAMEDDVDEAVAAAKKAF-ETKWSIVEPEVR 106

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
           ++ +   ADLVEKH + LA +E+ DNGK     A+ ++ ++ +      GWADKI+G  +
Sbjct: 107 AKALFNLADLVEKHQETLAAIESMDNGKSLF-CARGDVALVSKYLRSCGGWADKIYGNVI 165

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
                H   ++ EP+GV GQIIPWNFPL M++WK+GPALA GNTVVLK AE TPL+AL+A
Sbjct: 166 DTGKNHFTYSIKEPLGVCGQIIPWNFPLLMWSWKIGPALATGNTVVLKPAETTPLSALFA 225

Query: 864 GKLFHEAGLP 893
            +L  EAG+P
Sbjct: 226 SQLCQEAGIP 235



>gb:CR382139_1673028 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 502

 Score =  178 bits (452), Expect = 1e-43
 Identities = 87/191 (45%), Positives = 118/191 (61%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           IN +FV S SGKT  +++P T +V   V   + ED++ AV  AR AF    W K +   R
Sbjct: 25  INNEFVKSKSGKTIESINPSTGEVNGSVYAADEEDVDSAVKHARNAF-HAVWRKTTGVAR 83

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
             ++ KFA ++++  D +  +E WD+GK  EQ A  ++   +  F Y+AGWADKI G  +
Sbjct: 84  GDLLNKFAQVLQEQRDLIGAIEAWDSGKTKEQNAVYDIDECINCFKYFAGWADKIQGKVI 143

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
             D      T+HEP GV  QIIPWN+PLAM AWK+ PALA GN VVLK++E TPL+ LY 
Sbjct: 144 QNDPKKLAYTVHEPFGVCAQIIPWNYPLAMAAWKLAPALAAGNVVVLKSSEVTPLSILYL 203

Query: 864 GKLFHEAGLPP 896
            K+F + G PP
Sbjct: 204 AKIFRDVGFPP 214



>gb:CR382132_1665124 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 515

 Score =  178 bits (452), Expect = 1e-43
 Identities = 87/191 (45%), Positives = 121/191 (63%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           IN ++ +++   T P  +P T D +  VA   AED++RAV AARKAF    W  +   ER
Sbjct: 40  INNEWSEASDKGTIPVYNPSTGDEVVQVAAATAEDVDRAVVAARKAFQS--WRDVPGEER 97

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
           ++++  F +LV K++D +A +E  D+GKP +  A+ ++   + ++ YYAGWADK+ G T+
Sbjct: 98  AKLLDNFINLVSKNLDTVAAIEALDSGKPLQLNARGDIAGGLAVYKYYAGWADKVFGKTI 157

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
                    TLHEP GV GQIIPWN+P  M AWK+ PA+A GN VV+K AE TPL+ LY 
Sbjct: 158 VNTTKKLAYTLHEPHGVCGQIIPWNYPFLMAAWKIAPAIAAGNVVVMKLAENTPLSMLYL 217

Query: 864 GKLFHEAGLPP 896
             LF EAG PP
Sbjct: 218 CNLFKEAGFPP 228



>gb:CR380950_1649933 Candida glabrata strain CBS138 chromosome D
           complete sequence.
          Length = 524

 Score =  177 bits (450), Expect = 2e-43
 Identities = 88/191 (46%), Positives = 120/191 (62%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           IN +FV S   KTF  ++P TE+ I H+ EG  +D+  AV AA  AF  G W  +  +ER
Sbjct: 55  INNQFVPSKQHKTFEVINPSTEEEICHIYEGREDDVESAVQAADTAFKNGSWTDIDPFER 114

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
            + + K A+L+EK  + +A++E+ DNGK    +A+ ++ +++      AG ADKI G  V
Sbjct: 115 GQALYKLAELIEKDKEIVASIESLDNGKAIN-SARGDVQLVINYLKSSAGVADKIDGRLV 173

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
                +      EP+GV GQIIPWNFPL M+AWK+ PAL  GNTVVLKTAE TPL+ALY 
Sbjct: 174 NTGSNYFNYVKKEPLGVCGQIIPWNFPLLMWAWKIAPALVTGNTVVLKTAESTPLSALYV 233

Query: 864 GKLFHEAGLPP 896
            K   +AG+PP
Sbjct: 234 SKYIPKAGIPP 244



>pir|C87638|C87638 aldehyde dehydrogenase [imported] - Caulobacter
           crescentus>gb:AE005978_214266 Caulobacter crescentus
           CB15 section 304 of 359 of the complete
           genome.>gb:AE005673_924165 Caulobacter crescentus CB15
           complete genome.
          Length = 496

 Score =  177 bits (448), Expect = 3e-43
 Identities = 92/197 (46%), Positives = 126/197 (63%), Gaps = 2/197 (1%)
 Frame = +3

Query: 312 TQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMS 491
           +Q +I+G  V++ASG TF  + PR   V+  V   +A+D+ RAVA AR AF++G W    
Sbjct: 18  SQAVIDGDLVEAASGATFHNVSPRDGQVLNLVTACQADDVERAVAGARAAFEDGRWRDQG 77

Query: 492 AYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIH 671
             ++  ++ + A+L+E+  DELA LE+ D GKP   A   ++P+ +    +YA   DK++
Sbjct: 78  PRQKKAVLFRLAELMERDADELALLESLDVGKPISDARNVDIPLAINTCRWYAEALDKVY 137

Query: 672 GL--TVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTP 845
           G   T PAD   +   +HEP+GV G I+PWNFPL M  WKV PALA GN+VVLK AEQ+P
Sbjct: 138 GEVGTSPADRLSYA--VHEPLGVIGAIVPWNFPLHMAMWKVAPALAMGNSVVLKPAEQSP 195

Query: 846 LTALYAGKLFHEAGLPP 896
           LTAL  G L  EAGLPP
Sbjct: 196 LTALKLGALALEAGLPP 212



>gb:AE016817_1747800 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 507

 Score =  176 bits (446), Expect = 5e-43
 Identities = 91/190 (47%), Positives = 121/190 (63%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           IN +FV S  G     + P TE+V+  V EG +ED++ AV+AA+KAF  G W       R
Sbjct: 38  INNEFVRSKLGGMMEVIAPATEEVVTRVYEGTSEDVDIAVSAAQKAFKSGKWFGADPMVR 97

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
            + + K ADL+E+ ++ +A++E  DNGK +  A + ++ M+V      AG ADK+ G ++
Sbjct: 98  VKALSKLADLIEEDLEVIASIEFLDNGKVFSHA-RFDIGMVVNYLRCCAGLADKVDGRSI 156

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
                H   T  EPIGV GQIIPWNFPL M+AWKVGPALA GNTVVLKTAE TPL+ALY 
Sbjct: 157 DTGSSHLTYTRREPIGVCGQIIPWNFPLLMWAWKVGPALATGNTVVLKTAEFTPLSALYV 216

Query: 864 GKLFHEAGLP 893
                +AG+P
Sbjct: 217 SNHVRKAGIP 226



>gb:AL646068_547038 Ralstonia solanacearum GMI1000 chromosome,
           complete sequence; segment 12/19.
          Length = 502

 Score =  176 bits (446), Expect = 5e-43
 Identities = 83/194 (42%), Positives = 125/194 (64%)
 Frame = +3

Query: 312 TQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMS 491
           TQ  I+G FV + SGKTF T +P T +V+A +A  +  D++ AVA A+ AF++G W + S
Sbjct: 21  TQAFIDGAFVPAVSGKTFQTTNPATGNVLAEIAACDTRDVDIAVAKAKAAFEDGRWHRRS 80

Query: 492 AYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIH 671
             +R   +L+ ADL+E+H  ELA +E+ D+GKP  +   +++P  +    ++A   DKI+
Sbjct: 81  PAQRKATLLRLADLLEQHAHELAVMESLDSGKPIRECQATDVPETIHTIRWHAELIDKIY 140

Query: 672 GLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLT 851
             T P         + EPIGV G ++PWNFPL M AWK+GP+LA G ++++K A++T LT
Sbjct: 141 DSTAPVGSNALSLVVREPIGVVGLVLPWNFPLLMLAWKIGPSLAAGCSIIVKPAKETSLT 200

Query: 852 ALYAGKLFHEAGLP 893
           AL   +L HEAG+P
Sbjct: 201 ALRVAELAHEAGVP 214



>gb:CP000010_866804 Burkholderia mallei ATCC 23344 chromosome 1,
           complete sequence.
          Length = 501

 Score =  175 bits (443), Expect = 1e-42
 Identities = 91/196 (46%), Positives = 121/196 (61%), Gaps = 6/196 (3%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           I+G+  +  SG+  P +DP TE  IA VA  +A D++ AVAAAR+AFD G WP+M    R
Sbjct: 26  IDGRAAEPRSGRYLPVVDPATEMTIAEVAASDARDVDAAVAAARRAFDSGDWPRMRPASR 85

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
            +++ + A+ +E++ DELA LET + GK    A   ++        Y AGWA K+ G T+
Sbjct: 86  EKLLHQLAERLERYADELAALETLETGKLIGVARAIDVLGGAEYVRYMAGWATKLEGSTL 145

Query: 684 ------PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTP 845
                 PA   +   T  E +GV G I+PWNFPLA+  WKV  ALACG TVVLK +E+TP
Sbjct: 146 DTSIAAPAGAEYFAYTRREAVGVVGAIVPWNFPLAIALWKVATALACGCTVVLKPSEETP 205

Query: 846 LTALYAGKLFHEAGLP 893
           LTAL  G+L  EAGLP
Sbjct: 206 LTALRLGELAQEAGLP 221



>gb:BA000031_707237 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 1, complete sequence.
          Length = 369

 Score =  174 bits (442), Expect = 2e-42
 Identities = 76/190 (40%), Positives = 123/190 (64%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           ING++  + +G+T P ++P T+++   +A  ++ED++ AV+ AR+AF  G W + S   R
Sbjct: 22  INGEYSAALTGQTIPVVNPATDEIFTEIARCQSEDVDLAVSCARQAFQSGQWSESSPAHR 81

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
             ++ +FADL+++H +ELA LET D GKP   +  +++P       +YA   DK++G   
Sbjct: 82  KAVLKQFADLIDQHQEELALLETLDTGKPISHSFSTDIPGAANSLRWYAEAIDKVYGEVA 141

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
           P +   H    H+PIGV   ++PWNFPL +  WK+GPALA GN+V+LK +E++ LTA++ 
Sbjct: 142 PTEKDVHAFVSHQPIGVVAAVVPWNFPLWLACWKLGPALAAGNSVLLKPSEKSSLTAIFL 201

Query: 864 GKLFHEAGLP 893
           G+L  + GLP
Sbjct: 202 GQLASQVGLP 211



>pir|C83122|C83122 probable aldehyde dehydrogenase PA4189 [imported]
           - Pseudomonas aeruginosa (strain PAO1)>gb:AE004835_58424
           Pseudomonas aeruginosa PAO1, section 396 of 529 of the
           complete genome.>gb:AE004091_972524 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 496

 Score =  173 bits (439), Expect = 4e-42
 Identities = 86/207 (41%), Positives = 129/207 (62%), Gaps = 1/207 (0%)
 Frame = +3

Query: 276 EELVSPAVEVKYTQH-IINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAA 452
           EE  + A  +   Q   I+G F D+  G+TF + +P T +++A VA  +AED+  AVA+A
Sbjct: 8   EEYAAIAATLDLPQRAFIDGGFRDACGGRTFASTNPATGELLAQVAACDAEDVGHAVASA 67

Query: 453 RKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVR 632
           R+AF++G W   +  ER   +L+ A+L+E+H+ ELA +E+ D+GKP  +   ++LP  + 
Sbjct: 68  RRAFEDGRWRSRTPAERKAALLRLAELLEEHLLELAVMESLDSGKPIRECQHTDLPETIN 127

Query: 633 LFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGN 812
              ++A   DKI+  T P         + EPIGV G ++PWNFPL M AWK+GPALA G 
Sbjct: 128 TLRWHAELIDKIYDSTAPVGSAALAMVVREPIGVVGLVLPWNFPLLMLAWKIGPALAAGC 187

Query: 813 TVVLKTAEQTPLTALYAGKLFHEAGLP 893
           +VV+K A +T LTAL   +L  +AG+P
Sbjct: 188 SVVVKPAPETSLTALRVAELASQAGIP 214



>gb:BX571965_789822 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.
          Length = 501

 Score =  173 bits (438), Expect = 5e-42
 Identities = 91/196 (46%), Positives = 120/196 (61%), Gaps = 6/196 (3%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           I+G+  +  SG   P +DP TE  IA VA  +A D++ AVAAAR+AFD G WP+M    R
Sbjct: 26  IDGRAAEPRSGCYLPVVDPATEMTIAEVAASDARDVDAAVAAARRAFDSGDWPRMRPASR 85

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
            +++ + A+ +E++ DELA LET + GK    A   ++        Y AGWA K+ G T+
Sbjct: 86  EKLLHQLAERLERYADELAALETLETGKLIGVARAIDVLGGAEYVRYMAGWATKLEGSTL 145

Query: 684 ------PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTP 845
                 PA   +   T  E +GV G I+PWNFPLA+  WKV  ALACG TVVLK +E+TP
Sbjct: 146 DTSIAAPAGAEYFAYTRREAVGVVGAIVPWNFPLAIALWKVATALACGCTVVLKPSEETP 205

Query: 846 LTALYAGKLFHEAGLP 893
           LTAL  G+L  EAGLP
Sbjct: 206 LTALRLGELAQEAGLP 221



>gb:AX196064_1463889 Sequence 136 from Patent WO0151639.
          Length = 477

 Score =  172 bits (437), Expect = 6e-42
 Identities = 87/190 (45%), Positives = 125/190 (65%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           ++G+FVD A G  F +++P +E+V+A +AE  + D++RAV AAR A+++  W  M   +R
Sbjct: 25  VDGEFVDPADGGGFKSVNPASEEVLAEIAEAGSADVDRAVRAARTAYEK-VWGPMPGRDR 83

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
           ++ + + A ++++   ELA LE+ DNGKP  ++   +LP++   F YYAGWADK   L  
Sbjct: 84  AKYLFRIARIIQERSRELAVLESLDNGKPIRESRDVDLPLVAAHFFYYAGWADK---LPY 140

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
              GP+       P+GVA Q+IPWNFPL M AWK+ PALA GNTVVLK AE TPLTAL  
Sbjct: 141 AGFGPNP-----RPLGVAAQVIPWNFPLLMLAWKIAPALAAGNTVVLKPAETTPLTALLF 195

Query: 864 GKLFHEAGLP 893
            ++  +A LP
Sbjct: 196 AEICQQAELP 205



>gb:CR382135_1667771 Debaryomyces hansenii chromosome C of strain
           CBS767 of Debaryomyces hansenii.
          Length = 512

 Score =  172 bits (436), Expect = 8e-42
 Identities = 92/192 (47%), Positives = 123/192 (64%), Gaps = 1/192 (0%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           IN +F  + +G    T +P T + +A ++   AEDI+ AV AARKAF+     K +  +R
Sbjct: 21  INNEFRQAKNGNELTTPNPATGEPLATISAATAEDIDDAVKAARKAFETTWGKKSTPSQR 80

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
           S  + K+ADL++ ++D LA LE+ DNGKP   A   ++   +    YYAG ADKI G T+
Sbjct: 81  SEALHKWADLIDANIDTLAELESLDNGKPVWMARDVDIKDSIACLRYYAGLADKIEGRTI 140

Query: 684 PAD-GPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALY 860
             + G     T  EPIGV GQIIPWN+P+ MFAWKVGPALA GNTV++K AEQTPL+AL 
Sbjct: 141 EQEEGVKLAFTRPEPIGVCGQIIPWNYPIQMFAWKVGPALAAGNTVIMKPAEQTPLSALV 200

Query: 861 AGKLFHEAGLPP 896
             +L  +AG PP
Sbjct: 201 LAELAAKAGFPP 212



>gb:AY574278_629531 Ralstonia sp. SJ98 putative aldehyde
           dehydrogenase, maleylacetate reductase (pnpD),
           benzenetriol dioxygenase (pnpC), putative
           4-nitrocatechol monooxygenase ferridoxin component
           protein, conserved hypothetical protein, putative
           regulatory protein, and putative ATP binding ABC
           transporter genes, complete cds.
          Length = 487

 Score =  172 bits (436), Expect = 8e-42
 Identities = 85/194 (43%), Positives = 116/194 (59%)
 Frame = +3

Query: 312 TQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMS 491
           TQ  I+G+FV + SG+T  TL+P     IA V+    ED++RAV AA+KAF    W  M+
Sbjct: 3   TQLFIDGRFVAALSGETLATLNPHDNSEIAQVSMAGREDVDRAVQAAKKAFPA--WSAMA 60

Query: 492 AYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIH 671
           A +R R++LK AD +E + DELA LE+ D G P       ++P     F Y+ G ADK  
Sbjct: 61  AADRGRLLLKLADAIEANADELARLESMDTGHPIRDTRNLDVPRTAATFRYFGGMADKFE 120

Query: 672 GLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLT 851
           G  +P +         EP+G+ GQ++PWNFPL   +WK+ PALA GN VV+K AE TPL+
Sbjct: 121 GSVIPVEASFLNYLTREPVGIVGQVVPWNFPLMFTSWKMAPALAAGNCVVMKPAELTPLS 180

Query: 852 ALYAGKLFHEAGLP 893
           +L   +L  E G P
Sbjct: 181 SLAIAQLMAEVGFP 194



>gb:AE005674_70887 Shigella flexneri 2a str. 301, complete genome.
          Length = 495

 Score =  172 bits (436), Expect = 8e-42
 Identities = 82/190 (43%), Positives = 119/190 (62%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           ING++  +A  +TF T+DP T+  +A +A G++ DI+RAV+AAR  F+ G W   S  +R
Sbjct: 24  INGEYTAAAENETFETVDPVTQAPLAKIARGKSVDIDRAVSAARGVFERGDWSLSSPAKR 83

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
             ++ K ADL+E H +ELA LET D GKP   + + ++P   R   +YA   DK++G   
Sbjct: 84  KAVLNKLADLMEAHAEELALLETLDTGKPIRHSLRDDIPGAARAIRWYAEAIDKVYGEVA 143

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
                     + EP+GV   I+PWNFPL +  WK+GPALA GN+V+LK +E++PL+A+  
Sbjct: 144 TTSSHELAMIVREPVGVIAAIVPWNFPLLLTCWKLGPALAAGNSVILKPSEKSPLSAIRL 203

Query: 864 GKLFHEAGLP 893
             L  EAGLP
Sbjct: 204 AGLAKEAGLP 213



>gb:BA000040_734582 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 493

 Score =  171 bits (434), Expect = 1e-41
 Identities = 90/193 (46%), Positives = 122/193 (63%), Gaps = 2/193 (1%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           ++G +V++ SGK F T +P T +VI  V  GEA DI+ AVAAAR+AF  GPW +   +ER
Sbjct: 19  VDGAWVEARSGKVFETRNPATGEVIGRVPRGEAADISVAVAAARRAF-VGPWSRFKPFER 77

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
             ++L+ ADL EKH +E++  +T D G P  +   ++L  ++ +  YYAG A  +HG TV
Sbjct: 78  QALLLRIADLFEKHWEEISQSDTADMGMPIARTRANKL-RVIGMLRYYAGMATALHGQTV 136

Query: 684 PADGPHHVQ--TLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTAL 857
               P  +   T  EPIGV G IIPWN P A   WK+GPALA G T+VLK +E+ PLT L
Sbjct: 137 DNSLPGDIVSFTRKEPIGVVGAIIPWNAPTAASVWKIGPALATGCTIVLKPSEEAPLTPL 196

Query: 858 YAGKLFHEAGLPP 896
               L +EAG+PP
Sbjct: 197 LIADLMNEAGVPP 209



>gb:PSSTYCATA_161537 Pseudomonas sp. Y2 DNA for styrene catabolism
           genes.
          Length = 502

 Score =  171 bits (434), Expect = 1e-41
 Identities = 91/199 (45%), Positives = 117/199 (58%), Gaps = 6/199 (3%)
 Frame = +3

Query: 315 QHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSA 494
           Q +I G++V + SGKT    +P T D++  V +G+ ED+N AV +A        W +M  
Sbjct: 22  QMLIGGQWVSAQSGKTLNVYNPATGDILTEVPDGDVEDVNAAVESAAGTLRSDTWRRMPP 81

Query: 495 YERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHG 674
             R RI+L+ ADL+E H DELA LET +NGK    +   E+    +   Y AGWA K+ G
Sbjct: 82  SARERILLRLADLLEVHGDELARLETLNNGKLLIYSKLMEVGASAQWLRYMAGWATKLTG 141

Query: 675 ------LTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAE 836
                 L +P +      T   P+GV   IIPWNFPL M  WK+ PALACGNTVVLK AE
Sbjct: 142 STLDLSLPLPPEVRSRASTQRVPVGVVAAIIPWNFPLLMAVWKIAPALACGNTVVLKPAE 201

Query: 837 QTPLTALYAGKLFHEAGLP 893
           +TPLTAL   +L  EAGLP
Sbjct: 202 ETPLTALRLAELAMEAGLP 220



>pir|E90863|E90863 aldehyde dehydrogenase [imported] - Escherichia
           coli (strain O157:H7, substrain RIMD
           0509952)>pir|D85755|D85755 aldehyde dehydrogenase,
           prefers NADP over NAD [imported] - Escherichia coli
           (strain O157:H7, substrain EDL933)>gb:AE005174_66437
           Escherichia coli O157:H7 EDL933, complete
           genome.>gb:BA000007_659889 Escherichia coli O157:H7 DNA,
           complete genome.
          Length = 495

 Score =  171 bits (434), Expect = 1e-41
 Identities = 82/190 (43%), Positives = 120/190 (63%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           ING++  +A  +TF T+DP T+  +A++A G++ DI+RAV+AAR  F+ G W   S  +R
Sbjct: 24  INGEYTAAAENETFETVDPVTQAPLANIARGKSVDIDRAVSAARGVFERGDWSLSSPAKR 83

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
             ++ K ADL+E + +ELA LET D GKP   + + ++P   R   +YA   DK++G   
Sbjct: 84  KAVLNKLADLIEANAEELALLETLDTGKPIRHSLRDDIPGAARAIRWYAEAIDKVYGEVA 143

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
                     + EP+GV   I+PWNFPL +  WK+GPALA GN+VVLK +E++PL+A+  
Sbjct: 144 TTSSHELAMIVREPVGVIAAIVPWNFPLLLTCWKLGPALAAGNSVVLKPSEKSPLSAIRL 203

Query: 864 GKLFHEAGLP 893
             L  EAGLP
Sbjct: 204 AGLAKEAGLP 213



>gb:PFSTYABCD_158058 P.fluorescens styA, styB, styC and styD genes.
          Length = 502

 Score =  171 bits (433), Expect = 2e-41
 Identities = 91/199 (45%), Positives = 116/199 (58%), Gaps = 6/199 (3%)
 Frame = +3

Query: 315 QHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSA 494
           Q +I G++V++ S KT    +P T D +  V +G+ ED+N AV +A        W +M  
Sbjct: 22  QMLIGGQWVNAQSDKTLNVYNPATGDTLTDVPDGDVEDVNAAVESAAATLQSDAWRRMPP 81

Query: 495 YERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHG 674
             R RI+L+ ADL+E H DELA LET +NGK    +   E+    +   Y AGWA K+ G
Sbjct: 82  SARERILLRLADLLEAHGDELARLETLNNGKLLIYSKMMEVGASAQWLRYMAGWATKLTG 141

Query: 675 ------LTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAE 836
                 L +P D      T   P+GV   IIPWNFPL M  WK+ PALACGNTVVLK AE
Sbjct: 142 STLDLSLPLPPDVRSRASTQRVPVGVVAAIIPWNFPLLMAVWKIAPALACGNTVVLKPAE 201

Query: 837 QTPLTALYAGKLFHEAGLP 893
           +TPLTAL   +L  EAGLP
Sbjct: 202 ETPLTALRLAELAMEAGLP 220



>gb:ECOALDHQ3_128037 E.coli (clones lambda-ht5.3b and pEco4.1)
           aldehyde dehydrogenase (ALDH) gene, complete cds.
          Length = 495

 Score =  171 bits (433), Expect = 2e-41
 Identities = 81/190 (42%), Positives = 119/190 (62%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           ING++  +A  +TF T+DP T+  +A +A G++ DI+RA++AAR  F+ G W   S  +R
Sbjct: 24  INGEYTAAAENETFETVDPVTQAPLAKIARGKSVDIDRAMSAARGVFERGDWSLSSPAKR 83

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
             ++ K ADL+E H +ELA LET D GKP   + + ++P   R   +YA   DK++G   
Sbjct: 84  KAVLNKLADLMEAHAEELALLETLDTGKPIRHSLRDDIPGAARAIRWYAEAIDKVYGEVA 143

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
                     + EP+GV   I+PWNFPL +  WK+GPALA GN+V+LK +E++PL+A+  
Sbjct: 144 TTSSHELAMIVREPVGVIAAIVPWNFPLLLTCWKLGPALAAGNSVILKPSEKSPLSAIRL 203

Query: 864 GKLFHEAGLP 893
             L  EAGLP
Sbjct: 204 AGLAKEAGLP 213



>sp|P23883|DHAL_ECOLI Putative aldehyde dehydrogenase (EC
           1.2.1.3).>pir|G64878|G64878 aldehyde dehydrogenase (NAD)
           (EC 1.2.1.3) - Escherichia coli (strain
           K-12)>gb:AB200319_18275 Escherichia coli K12 puuC gene
           for gamma-Glutamyl-gamma-aminobutyraldehyde
           dehydrogenase, complete cds.>gb:D90768_122292 E.coli
           genomic DNA, Kohara clone #257(29.1-29.6
           min.).>gb:U00096_200370 Escherichia coli K-12 MG1655
           complete genome.
          Length = 495

 Score =  171 bits (433), Expect = 2e-41
 Identities = 81/190 (42%), Positives = 119/190 (62%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           ING++  +A  +TF T+DP T+  +A +A G++ DI+RA++AAR  F+ G W   S  +R
Sbjct: 24  INGEYTAAAENETFETVDPVTQAPLAKIARGKSVDIDRAMSAARGVFERGDWSLSSPAKR 83

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
             ++ K ADL+E H +ELA LET D GKP   + + ++P   R   +YA   DK++G   
Sbjct: 84  KAVLNKLADLMEAHAEELALLETLDTGKPIRHSLRDDIPGAARAIRWYAEAIDKVYGEVA 143

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
                     + EP+GV   I+PWNFPL +  WK+GPALA GN+V+LK +E++PL+A+  
Sbjct: 144 TTSSHELAMIVREPVGVIAAIVPWNFPLLLTCWKLGPALAAGNSVILKPSEKSPLSAIRL 203

Query: 864 GKLFHEAGLP 893
             L  EAGLP
Sbjct: 204 AGLAKEAGLP 213



>gb:CR857757_1181970 Pongo pygmaeus mRNA; cDNA DKFZp469L0729 (from
           clone DKFZp469L0729).
          Length = 194

 Score =  171 bits (432), Expect = 2e-41
 Identities = 83/165 (50%), Positives = 112/165 (67%), Gaps = 1/165 (0%)
 Frame = +3

Query: 288 SPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFD 467
           +P +E+KYT+  IN ++ +S SG+ FP  +P T + +  V E +  DI++AV AAR AF 
Sbjct: 30  TPNLEIKYTKIFINNEWQNSESGRVFPVYNPATGEQVCEVEEADKADIDKAVQAARLAFS 89

Query: 468 EGP-WPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHY 644
            G  W +M A ER R++ K ADLVE+    LAT+E+ + GKP+ QA   +L  +++   Y
Sbjct: 90  LGSVWRRMDASERGRLLDKLADLVERDRAVLATMESLNGGKPFLQAFYVDLQGVIKTLRY 149

Query: 645 YAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFA 779
           YAGWADKIHG+T+P DG +   T HEPIGV GQIIPWNFPL MFA
Sbjct: 150 YAGWADKIHGMTIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFA 194



>gb:AY596297_631726 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 508

 Score =  171 bits (432), Expect = 2e-41
 Identities = 93/207 (44%), Positives = 128/207 (61%)
 Frame = +3

Query: 237 ESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEG 416
           +S  +R S      E  +  V     +  I G++V S+ G+TF T+DP T + +A V  G
Sbjct: 8   QSATERKSAIKKRHEQAANEVLPDRRELYIGGEWVQSSGGETFETIDPTTGETLAEVQAG 67

Query: 417 EAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYE 596
            AEDI+ AVAAA  A+DE  + ++S  ER  ++   AD + +  +E A LE+ DNGKP  
Sbjct: 68  TAEDIDSAVAAAWNAYDE-TYSELSTGERQAMLDGIADAIAERSEEFAKLESLDNGKPIT 126

Query: 597 QAAKSELPMIVRLFHYYAGWADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMF 776
           +A + ++ +++  F Y+AG A    G T+  D   HVQTL EP GV GQIIPWNFPL M 
Sbjct: 127 EA-RIDIDLVIDHFRYFAGLARSGEGRTIETDDSRHVQTLREPYGVVGQIIPWNFPLLMA 185

Query: 777 AWKVGPALACGNTVVLKTAEQTPLTAL 857
           AWK+ PAL+ GNTVVLK AE+TPL+ L
Sbjct: 186 AWKLAPALSAGNTVVLKPAEETPLSIL 212



>gb:AE016982_371245 Shigella flexneri 2a str. 2457T section 5 of 16
           of the complete genome.>gb:AE014073_995995 Shigella
           flexneri 2a str. 2457T complete genome.
          Length = 495

 Score =  171 bits (432), Expect = 2e-41
 Identities = 81/190 (42%), Positives = 119/190 (62%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           ING++  +A  +TF T++P T+  +A +A G++ DI+RAV+AAR  F+ G W   S  +R
Sbjct: 24  INGEYTAAAENETFETVEPVTQAPLAKIARGKSVDIDRAVSAARGVFERGDWSLSSPAKR 83

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
             ++ K ADL+E H +ELA LET D GKP   + + ++P   R   +YA   DK++G   
Sbjct: 84  KAVLNKLADLMEAHAEELALLETLDTGKPIRHSLRDDIPGAARAIRWYAEAIDKVYGEVA 143

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
                     + EP+GV   I+PWNFPL +  WK+GPALA GN+V+LK +E++PL+A+  
Sbjct: 144 TTSSHELAMIVREPVGVIAAIVPWNFPLLLTCWKLGPALAAGNSVILKPSEKSPLSAIRL 203

Query: 864 GKLFHEAGLP 893
             L  EAGLP
Sbjct: 204 AGLAKEAGLP 213



>gb:BX571859_785001 Photorhabdus luminescens subsp. laumondii TTO1
           complete genome; segment 1/17.
          Length = 489

 Score =  170 bits (431), Expect = 3e-41
 Identities = 82/192 (42%), Positives = 116/192 (60%)
 Frame = +3

Query: 321 IINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYE 500
           +ING ++D++ G+T   ++P    +I  VAE +  D++ AVAAA+ A+    W ++ A E
Sbjct: 8   LINGDWIDASDGQTIEVMNPHDGSLITRVAEAKEADVDCAVAAAKAAYPA--WGRLQASE 65

Query: 501 RSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLT 680
           R  ++LK AD +E+H  ELA LET D G P       ++P     F Y+ G ADK+ G  
Sbjct: 66  RGALLLKLADKIEEHAAELAQLETMDTGHPIRDTLNIDVPRTAYCFRYFGGMADKLEGSV 125

Query: 681 VPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALY 860
           +P +      T  EPIGV GQI+PWNFPL   +WK+ PALA GNT+V+K +E TPL+ L 
Sbjct: 126 IPVEEGFLNYTTREPIGVVGQIVPWNFPLMFTSWKMAPALAAGNTIVIKPSEITPLSTLR 185

Query: 861 AGKLFHEAGLPP 896
             +L  E G PP
Sbjct: 186 IAELMMEVGFPP 197



>pir|H83136|H83136 probable aldehyde dehydrogenase PA4073 [imported]
           - Pseudomonas aeruginosa (strain PAO1)>gb:AE004823_58308
           Pseudomonas aeruginosa PAO1, section 384 of 529 of the
           complete genome.>gb:AE004091_972408 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 495

 Score =  170 bits (431), Expect = 3e-41
 Identities = 93/198 (46%), Positives = 123/198 (62%), Gaps = 6/198 (3%)
 Frame = +3

Query: 321 IINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYE 500
           +I+G+   + SG   P  DP T   +A VA   AED++RAVAAAR+AF EG W      +
Sbjct: 20  LIDGESGPARSGADMPLYDPATGAELARVARAGAEDVDRAVAAARRAF-EGNWAGQRPAD 78

Query: 501 RSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHG-- 674
           R R++L+ A+ +E H ++LA LET +NGK    +   E+   V    Y AGWA KI G  
Sbjct: 79  RERLLLRLAERIEAHGEQLAQLETLNNGKSINLSRALEVGASVEFIRYMAGWATKIEGRS 138

Query: 675 --LTVPA--DGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQT 842
             L++ A     +   T+ EP+GV G I+PWNFPL M  WK+ PALACG TVVLK A++T
Sbjct: 139 LDLSIAAVPGARYRAYTVPEPVGVVGAIVPWNFPLLMAIWKIVPALACGCTVVLKPADET 198

Query: 843 PLTALYAGKLFHEAGLPP 896
           PLTAL  G+L  EAG+PP
Sbjct: 199 PLTALRLGQLCLEAGIPP 216



>pir|C83617|C83617 probable aldehyde dehydrogenase PA0219 [imported]
           - Pseudomonas aeruginosa (strain PAO1)>gb:AE004460_54454
           Pseudomonas aeruginosa PAO1, section 21 of 529 of the
           complete genome.>gb:AE004091_968554 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 496

 Score =  170 bits (431), Expect = 3e-41
 Identities = 85/193 (44%), Positives = 123/193 (63%)
 Frame = +3

Query: 315 QHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSA 494
           Q +I G+   +ASG TF  +DP +  ++A VA  +A D++ AVAAAR+AFDEGPW +++ 
Sbjct: 19  QALIGGRQRPAASGATFDAIDPASNRLLARVAACDAADVDAAVAAARRAFDEGPWARLAP 78

Query: 495 YERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHG 674
            ER R++L+ A+L+  H +ELA L++ + GKP   A   ++P    +F +YA   DK++ 
Sbjct: 79  VERKRVLLRLAELMLAHREELALLDSLNMGKPVMDAWNIDVPGAAHVFAWYAESLDKLYD 138

Query: 675 LTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTA 854
              P            P+GV G ++PWNFPL M AWK+ PALA GN+VVLK AEQ+P +A
Sbjct: 139 QVAPTAQQTLATITRVPLGVIGAVVPWNFPLDMAAWKLAPALAAGNSVVLKPAEQSPFSA 198

Query: 855 LYAGKLFHEAGLP 893
           L   +L  EAG+P
Sbjct: 199 LRLAELALEAGVP 211



>gb:AE017354_458631 Legionella pneumophila subsp. pneumophila str.
           Philadelphia 1, complete genome.
          Length = 488

 Score =  170 bits (430), Expect = 4e-41
 Identities = 93/190 (48%), Positives = 114/190 (60%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           I+GKF  + SG T    DP   D+IA V E   ED   A+ AARKAFDEG W K  A +R
Sbjct: 8   IDGKFTLAKSGATRDIFDPANGDLIAKVPESAKEDAILAIKAARKAFDEGEWRKSLALDR 67

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
            +++ K ADL+  +   LA LET + GKP  +A + ++      F +Y G A KIHG T+
Sbjct: 68  GKLLFKLADLIRANAKMLAELETRNCGKPLLEA-EFDVTDAANCFEFYGGLATKIHGETM 126

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
                     + EPIGV GQIIPWNFPL M AWK+ PALA GNTVVLK +E TP+TAL  
Sbjct: 127 SVPANSFSYVVREPIGVCGQIIPWNFPLLMAAWKLAPALAAGNTVVLKPSELTPITALEL 186

Query: 864 GKLFHEAGLP 893
            KL  E G P
Sbjct: 187 FKLIDECGFP 196



>gb:BX571966_793717 Burkholderia pseudomallei strain K96243,
           chromosome 2, complete sequence.
          Length = 496

 Score =  169 bits (429), Expect = 5e-41
 Identities = 88/192 (45%), Positives = 122/192 (63%), Gaps = 2/192 (1%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           I+G + D+  GKTF  + P    V+A VA+  A D++ AVAAAR+AFD   W  ++  ER
Sbjct: 24  IDGAYRDAHGGKTFDCVSPIDGRVLAKVADCGAADVDAAVAAARRAFDAQAWAGLNPRER 83

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
             I+L++A L+  H+DELA LET D GKP       ++P       ++A   DK+ G  V
Sbjct: 84  KAILLRWAALMRAHLDELALLETLDAGKPIGDTTSVDVPGAAYCVEWFAEAIDKVGGEVV 143

Query: 684 PADGPHHVQTL--HEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTAL 857
           PAD  HH+  L   EP+GV   ++PWNFP+ M +WK GPALA GN+VVLK +E++PLTA+
Sbjct: 144 PAD--HHLVGLVTREPLGVVAAVVPWNFPILMASWKFGPALAAGNSVVLKPSEKSPLTAI 201

Query: 858 YAGKLFHEAGLP 893
              +L HEAG+P
Sbjct: 202 RVARLAHEAGIP 213



>gb:AF416331_509260 Ruegeria sp. PR1b plasmid pSD25, complete
           sequence.
          Length = 499

 Score =  169 bits (428), Expect = 7e-41
 Identities = 86/194 (44%), Positives = 120/194 (61%)
 Frame = +3

Query: 312 TQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMS 491
           T+H+ING++VDS  G TF T++P T + IA VA G+A DI++AV  AR+ F  G W  ++
Sbjct: 22  TKHLINGEWVDSEDGTTFDTINPATGETIAKVASGKAADIDKAVKNARETFKSGVWSMLA 81

Query: 492 AYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIH 671
             ER  ++ +F+ L+E++  E A L+  D GKP       ++P  V+   ++A  ADK+H
Sbjct: 82  PRERLAVIERFSALIEENAVEFALLDCLDMGKPVMDMINIDIPESVKNLKFFAETADKVH 141

Query: 672 GLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLT 851
           G     D       L +P+GV G I PWN+PL M AWK+GPAL  GN+VVLK AEQ PL+
Sbjct: 142 GSLTATDPSVVHYILRQPLGVVGLITPWNYPLMMAAWKLGPALITGNSVVLKPAEQAPLS 201

Query: 852 ALYAGKLFHEAGLP 893
               G LF +AG P
Sbjct: 202 CALLGDLFLKAGGP 215



>gb:AE017352_1759755 Cryptococcus neoformans var. neoformans JEC21
           chromosome 12, complete sequence.
          Length = 524

 Score =  168 bits (426), Expect = 1e-40
 Identities = 92/191 (48%), Positives = 125/191 (65%), Gaps = 1/191 (0%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           IN ++V+S S +TF T++P T   +   A  + EDI++AV AARKAF       + A ER
Sbjct: 43  INNEWVESTSRETFSTVNPATGQKLLDFAHAKKEDIDKAVIAARKAFKTTWGNNVLAAER 102

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
             ++ K ADL+E+  D+LA LE+ ++GK    A ++++   V    YYAG ADKIHG TV
Sbjct: 103 GVLLNKLADLMERDSDKLAALESINSGKGIRIAREADVADSVACIRYYAGLADKIHGQTV 162

Query: 684 PADGPH-HVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALY 860
            + G    V TLH+PIGV GQIIPWN+P+ M+AWK+ PALA G TVV+K +E TPL+AL 
Sbjct: 163 SSFGKEKFVYTLHQPIGVCGQIIPWNYPIMMWAWKIAPALAAGCTVVMKPSELTPLSALA 222

Query: 861 AGKLFHEAGLP 893
              L  EAG+P
Sbjct: 223 LCDLVKEAGIP 233



>gb:AP006618_557615 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 481

 Score =  168 bits (426), Expect = 1e-40
 Identities = 94/197 (47%), Positives = 118/197 (59%), Gaps = 3/197 (1%)
 Frame = +3

Query: 315 QHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAAR--KAFDEGPWPKM 488
           Q  I+G++    +G TF T+DP T  VI  VA+    D++ AVAAA   +A+    W  M
Sbjct: 4   QLFIDGEWRPGRAG-TFATVDPATGKVITDVAQASTADVDDAVAAAAAARAYTAPSWAAM 62

Query: 489 SAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKI 668
               R+R++ + ADLVE H DELA LET D G+P   AA   +P  V    YYAGWA KI
Sbjct: 63  LPATRARLLNRLADLVEAHADELALLETTDQGQPLGVAAGISVPNAVEHLRYYAGWATKI 122

Query: 669 HGLTVPADGPH-HVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTP 845
            G+T P   P    +T  EP+GV   I PWNFPL +  WK+ PALA GNTVV+K AEQTP
Sbjct: 123 TGITAPLSIPDVDYRTRREPLGVCALITPWNFPLTILTWKLAPALAAGNTVVVKPAEQTP 182

Query: 846 LTALYAGKLFHEAGLPP 896
           L+ L   +L  EAG PP
Sbjct: 183 LSTLRLAELAAEAGFPP 199



>pir|AC3043|AC3043 aldehyde dehydrogenase dhaL [imported] -
           Agrobacterium tumefaciens (strain C58,
           Dupont)>gb:AE009326_250788 Agrobacterium tumefaciens
           str. C58 linear chromosome, section 96 of 187 of the
           complete sequence.>gb:AE008689_1088631 Agrobacterium
           tumefaciens str. C58 linear chromosome, complete
           sequence.
          Length = 505

 Score =  168 bits (426), Expect = 1e-40
 Identities = 80/190 (42%), Positives = 118/190 (62%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           I+G F  + SGKTF T++P T + +A ++  +  D++ AV  AR AFD+G W  +   ER
Sbjct: 25  IDGAFRPAGSGKTFKTINPATGETLADISACDVSDVDYAVGKARAAFDDGRWRLLPPGER 84

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
             I+L FA L+E+H  ELA +E+ D+GKP  +    ++P  +    ++A   DK++  T 
Sbjct: 85  KAILLTFAKLLEQHRHELAVMESLDSGKPVSECQTVDIPDTIHTIRWHAELIDKLYDNTA 144

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
           P         + EP+GV G ++PWNFPL M AWK+GPALA G +V++K AE+T LT L  
Sbjct: 145 PVGSNALALVVREPVGVVGCVLPWNFPLLMLAWKIGPALASGCSVIVKPAEETTLTTLRV 204

Query: 864 GKLFHEAGLP 893
            +L HEAG+P
Sbjct: 205 AELAHEAGIP 214



>pir|A98243|A98243 probable aldehyde dehydrogenase PA4189 [imported]
           - Agrobacterium tumefaciens (strain C58,
           Cereon)>gb:AE008288_235409 Agrobacterium tumefaciens
           str. C58 linear chromosome, section 92 of 187 of the
           complete sequence.>gb:AE007870_1080522 Agrobacterium
           tumefaciens str. C58 linear chromosome, complete
           sequence.
          Length = 511

 Score =  168 bits (426), Expect = 1e-40
 Identities = 80/190 (42%), Positives = 118/190 (62%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           I+G F  + SGKTF T++P T + +A ++  +  D++ AV  AR AFD+G W  +   ER
Sbjct: 31  IDGAFRPAGSGKTFKTINPATGETLADISACDVSDVDYAVGKARAAFDDGRWRLLPPGER 90

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
             I+L FA L+E+H  ELA +E+ D+GKP  +    ++P  +    ++A   DK++  T 
Sbjct: 91  KAILLTFAKLLEQHRHELAVMESLDSGKPVSECQTVDIPDTIHTIRWHAELIDKLYDNTA 150

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
           P         + EP+GV G ++PWNFPL M AWK+GPALA G +V++K AE+T LT L  
Sbjct: 151 PVGSNALALVVREPVGVVGCVLPWNFPLLMLAWKIGPALASGCSVIVKPAEETTLTTLRV 210

Query: 864 GKLFHEAGLP 893
            +L HEAG+P
Sbjct: 211 AELAHEAGIP 220



>pir|B95411|B95411 probable aldehyde [imported] - Sinorhizobium
           meliloti  (strain 1021) magaplasmid
           pSymA>gb:AE007304_225154 Sinorhizobium meliloti 1021
           plasmid pSymA section 110 of 121 of the complete plasmid
           sequence.>gb:AE006469_1102922 Sinorhizobium meliloti
           1021 plasmid pSymA, complete sequence.
          Length = 494

 Score =  168 bits (425), Expect = 1e-40
 Identities = 91/190 (47%), Positives = 119/190 (62%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           I+G++V  ASG+   T+DP T    A V  G AED +RAV AA +AF +GPW KM   ER
Sbjct: 11  IDGQWVAPASGEYIETVDPFTARPWALVPRGNAEDADRAVRAAHRAFSQGPWGKMHPTER 70

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
            RI+ +FA L+E+H D LA +E  DNG+   +    ++  I R +HYYAG+ADKI G   
Sbjct: 71  GRIIQRFAALIEEHADALADIEVRDNGRLLAEMTH-QIRYIPRWYHYYAGFADKIEGTLH 129

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
           P D P    + HEP+GV   I+PWN PL +F+ K  PALA GNT+V+K AE T  TAL  
Sbjct: 130 PCDKPALSFSRHEPLGVCVGIVPWNAPLLLFSLKAAPALAAGNTLVMKPAEFTSATALKL 189

Query: 864 GKLFHEAGLP 893
            +L  +AG P
Sbjct: 190 MELVEKAGFP 199



>sp|O74187|DHAL_AGABI Aldehyde dehydrogenase (EC 1.2.1.3)
           (ALDDH).>gb:ABY17825_1529986 Agaricus bisporus aldA and
           echA genes.
          Length = 500

 Score =  168 bits (425), Expect = 1e-40
 Identities = 86/191 (45%), Positives = 114/191 (59%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           ING+FVD     T   ++P    +I  ++E    DI+ AV AA KAF+       S  +R
Sbjct: 26  INGEFVDGVKNTTIDVVNPANGKLITKISEATEADIDIAVEAAHKAFETTWGLNCSGSKR 85

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
             ++ K A L+EK++D+L+ +E  DNGK +  A   +L + +    +YAGWADK  G  +
Sbjct: 86  GDMLYKLAQLMEKNIDDLSAIEALDNGKTFLWAKSVDLSLSISTIKHYAGWADKNFGQVI 145

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
             D      + HEPIGV GQIIPWNFPL M AWK+GPALA GN +VLK +E TPL+AL  
Sbjct: 146 ETDEKKLTYSRHEPIGVVGQIIPWNFPLLMLAWKIGPALATGNCIVLKPSEFTPLSALRM 205

Query: 864 GKLFHEAGLPP 896
             L  EAG PP
Sbjct: 206 CALIQEAGFPP 216



>gb:CP000002_858867 Bacillus licheniformis ATCC 14580, complete
           genome.
          Length = 498

 Score =  167 bits (424), Expect = 2e-40
 Identities = 85/191 (44%), Positives = 124/191 (64%), Gaps = 1/191 (0%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           I+GK+V +  G+T   ++P  ++ I  V+EG+ ED  RA+AAAR+AFD+G W      ER
Sbjct: 15  IDGKWVGAKKGETRQIINPYNQEHIETVSEGDREDAVRAIAAARRAFDDGEWANTPGLER 74

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
             I+LK A+L+ +  +ELA LE+ D GK  E+ +++++  I  +F YYAG ADK  G  +
Sbjct: 75  GNIVLKIAELIRRDHEELAELESLDTGKTIEE-SRADMDDIANVFQYYAGLADKDGGEVI 133

Query: 684 PADGP-HHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALY 860
            +  P    + + EP+GV GQI PWN+PL   +WK+ PALA GNT+V+K +E TPLT + 
Sbjct: 134 SSPIPDSKSKIVREPVGVCGQITPWNYPLLQASWKIAPALAAGNTIVVKPSEITPLTTIK 193

Query: 861 AGKLFHEAGLP 893
             KL  EAG+P
Sbjct: 194 IFKLMEEAGVP 204



>gb:AE017333_449068 Bacillus licheniformis DSM 13, complete genome.
          Length = 490

 Score =  167 bits (424), Expect = 2e-40
 Identities = 85/191 (44%), Positives = 124/191 (64%), Gaps = 1/191 (0%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           I+GK+V +  G+T   ++P  ++ I  V+EG+ ED  RA+AAAR+AFD+G W      ER
Sbjct: 7   IDGKWVGAKKGETRQIINPYNQEHIETVSEGDREDAVRAIAAARRAFDDGEWANTPGLER 66

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
             I+LK A+L+ +  +ELA LE+ D GK  E+ +++++  I  +F YYAG ADK  G  +
Sbjct: 67  GNIVLKIAELIRRDHEELAELESLDTGKTIEE-SRADMDDIANVFQYYAGLADKDGGEVI 125

Query: 684 PADGP-HHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALY 860
            +  P    + + EP+GV GQI PWN+PL   +WK+ PALA GNT+V+K +E TPLT + 
Sbjct: 126 SSPIPDSKSKIVREPVGVCGQITPWNYPLLQASWKIAPALAAGNTIVVKPSEITPLTTIK 185

Query: 861 AGKLFHEAGLP 893
             KL  EAG+P
Sbjct: 186 IFKLMEEAGVP 196



>gb:CP000032_88254 Silicibacter pomeroyi DSS-3 plasmid megaplasmid,
           complete sequence.
          Length = 497

 Score =  167 bits (424), Expect = 2e-40
 Identities = 83/190 (43%), Positives = 114/190 (60%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           I+G F  +A G +F T++P T +++A VA  +A D++RAVAAAR+ F++G W +     R
Sbjct: 23  IDGAFCAAADGDSFETINPATGEILARVAHCKAADVDRAVAAARRVFNDGTWSRAEPEAR 82

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
             ++LK ADLV KH DELA LE+ D GK            + + F +YA  ADK  G   
Sbjct: 83  KEVLLKVADLVRKHSDELAVLESLDTGKTITDCLAEIGGEVPKFFQWYAELADKTFGKIA 142

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
           P           EP G+AG ++PWNFPL M AWK+ PALA G + V+K AEQTPL+ +  
Sbjct: 143 PTSPGALALITREPAGIAGAVLPWNFPLVMAAWKIAPALAVGCSAVIKPAEQTPLSTIRL 202

Query: 864 GKLFHEAGLP 893
            +L  EAG+P
Sbjct: 203 AELMQEAGVP 212



>pir|AE3153|AE3153 NADP-dependent aldehyde dehydrogenase Atu4849
           [imported] - Agrobacterium tumefaciens (strain C58,
           Dupont)>gb:AE009413_251670 Agrobacterium tumefaciens
           str. C58 linear chromosome, section 183 of 187 of the
           complete sequence.>gb:AE008689_1089513 Agrobacterium
           tumefaciens str. C58 linear chromosome, complete
           sequence.
          Length = 788

 Score =  167 bits (424), Expect = 2e-40
 Identities = 85/196 (43%), Positives = 117/196 (59%), Gaps = 4/196 (2%)
 Frame = +3

Query: 318 HIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAY 497
           H ING+FV     KT    +P   D +A +  G  ED+++A+ AAR AF  G W K+S +
Sbjct: 26  HYINGRFVSPDGRKTIAVSNPANGDKLAEIVCGNEEDVDQAIKAARAAF--GKWSKLSGH 83

Query: 498 ERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWA----DK 665
            R+R +   A  ++K    L+ LET DNGKP  +    ++P++ R F+++AGWA    D+
Sbjct: 84  ARARYLYAIARHIQKRERFLSVLETMDNGKPVRETRDIDIPLVARHFYHHAGWAEMVEDE 143

Query: 666 IHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTP 845
            HG +              P+GV GQ+IPWNFPL M AWK+ PALA GNTVVLK A+ TP
Sbjct: 144 FHGFS--------------PVGVCGQVIPWNFPLLMLAWKIAPALAAGNTVVLKPADLTP 189

Query: 846 LTALYAGKLFHEAGLP 893
           LTA+   ++ HE GLP
Sbjct: 190 LTAIAFAEICHEVGLP 205



 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 53/180 (29%), Positives = 81/180 (45%)
 Frame = +3

Query: 315  QHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSA 494
            ++ I GK      G ++ ++  +   VI     G  +DI  AV AA KA   G W   +A
Sbjct: 514  KNYIGGKQARPDGGYSY-SVTGKGNAVIGMAGIGNRKDIRNAVEAASKA---GSWSSATA 569

Query: 495  YERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHG 674
            + R++++   A+ +    DE       D+    E+ A+ E    +R   YYA  ADK  G
Sbjct: 570  HNRAQVLYYLAENLNARRDEFVA-RIIDSTGVSEKKARDEFDASLRRISYYAAQADKFDG 628

Query: 675  LTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTA 854
                    H    ++EP G+ G + P   PL      V PA+A GN VV+  + + PL A
Sbjct: 629  AIHSTKSRHVTLAMNEPWGIVGIVCPDEAPLLSLVSLVLPAIAMGNRVVVIPSSRHPLIA 688



>pir|F98134|F98134 hypothetical protein AGR_L_75 [imported] -
           Agrobacterium tumefaciens (strain C58,
           Cereon)>gb:AE008201_234541 Agrobacterium tumefaciens
           str. C58 linear chromosome, section 5 of 187 of the
           complete sequence.>gb:AE007870_1079654 Agrobacterium
           tumefaciens str. C58 linear chromosome, complete
           sequence.
          Length = 798

 Score =  167 bits (424), Expect = 2e-40
 Identities = 85/196 (43%), Positives = 117/196 (59%), Gaps = 4/196 (2%)
 Frame = +3

Query: 318 HIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAY 497
           H ING+FV     KT    +P   D +A +  G  ED+++A+ AAR AF  G W K+S +
Sbjct: 36  HYINGRFVSPDGRKTIAVSNPANGDKLAEIVCGNEEDVDQAIKAARAAF--GKWSKLSGH 93

Query: 498 ERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWA----DK 665
            R+R +   A  ++K    L+ LET DNGKP  +    ++P++ R F+++AGWA    D+
Sbjct: 94  ARARYLYAIARHIQKRERFLSVLETMDNGKPVRETRDIDIPLVARHFYHHAGWAEMVEDE 153

Query: 666 IHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTP 845
            HG +              P+GV GQ+IPWNFPL M AWK+ PALA GNTVVLK A+ TP
Sbjct: 154 FHGFS--------------PVGVCGQVIPWNFPLLMLAWKIAPALAAGNTVVLKPADLTP 199

Query: 846 LTALYAGKLFHEAGLP 893
           LTA+   ++ HE GLP
Sbjct: 200 LTAIAFAEICHEVGLP 215



 Score = 72.8 bits (177), Expect = 8e-12
 Identities = 53/180 (29%), Positives = 81/180 (45%)
 Frame = +3

Query: 315  QHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSA 494
            ++ I GK      G ++ ++  +   VI     G  +DI  AV AA KA   G W   +A
Sbjct: 524  KNYIGGKQARPDGGYSY-SVTGKGNAVIGMAGIGNRKDIRNAVEAASKA---GSWSSATA 579

Query: 495  YERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHG 674
            + R++++   A+ +    DE       D+    E+ A+ E    +R   YYA  ADK  G
Sbjct: 580  HNRAQVLYYLAENLNARRDEFVA-RIIDSTGVSEKKARDEFDASLRRISYYAAQADKFDG 638

Query: 675  LTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTA 854
                    H    ++EP G+ G + P   PL      V PA+A GN VV+  + + PL A
Sbjct: 639  AIHSTKSRHVTLAMNEPWGIVGIVCPDEAPLLSLVSLVLPAIAMGNRVVVIPSSRHPLIA 698



>sp|P42041|DHAL_ALTAL Aldehyde dehydrogenase (EC 1.2.1.3) (ALDDH)
           (Allergen Alt a 10) (Alt a X).>pir|S43108|S43108
           aldehyde dehydrogenase (NAD) (EC 1.2.1.3) - Alternaria
           alternata>gb:AAALTA2_1508147 A.alternata AltA2 mRNA for
           aldehyde dehydrogenase.
          Length = 495

 Score =  167 bits (424), Expect = 2e-40
 Identities = 88/191 (46%), Positives = 116/191 (60%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           IN +FV +  GKTF  ++P TE+VI  V E   +D++ AVAAARKAF+ GPW K +   R
Sbjct: 22  INNEFVKAVDGKTFDVINPSTEEVICSVQEATEKDVDIAVAAARKAFN-GPWAKETPENR 80

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
            +++ K ADL EK+ D +A +E  DNGK +  A   ++P       YY GWADKI G  V
Sbjct: 81  GKLLNKLADLFEKNADLIAAVEALDNGKAFSMAKNVDVPAAAGCLRYYGGWADKIEGKVV 140

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
               P     + + + V         P+ M++WK+GPA+A GNTVVLKTAEQTPL+A  A
Sbjct: 141 DT-APDSFNYIRKSLLVFAVRSSMELPILMWSWKIGPAIATGNTVVLKTAEQTPLSAYIA 199

Query: 864 GKLFHEAGLPP 896
            KL  EAG PP
Sbjct: 200 CKLIQEAGFPP 210



>sp|P71016|DHAB_BACSU Betaine aldehyde dehydrogenase (EC 1.2.1.8)
           (BADH).>pir|A69629|A69629 glycine betaine aldehyde
           dehydrogenase gbsA - Bacillus
           subtilis>gb:BSU47861_751687 Bacillus subtilis gbsAB
           operon, glycine betaine aldehyde dehydrogenase GbsA,
           alcohol dehydrogenase GbsB genes, complete
           cds.>gb:BSUB0016_755071 Bacillus subtilis complete
           genome (section 16 of 21): from 3013458 to 3213379.
          Length = 490

 Score =  167 bits (424), Expect = 2e-40
 Identities = 84/191 (43%), Positives = 126/191 (65%), Gaps = 1/191 (0%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           I+G+++ +   +    ++P  ++ IA V+EG  ED  +A+AAAR+AFD+G W  +S  ER
Sbjct: 7   IDGEWISAEKEQIRSIINPFNQEEIATVSEGGREDAIKAIAAARRAFDKGEWSSLSGLER 66

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
            +I+LK A+L+ + ++ELA LE+ D GK  E++ K+++  I  +F YYAG ADK  G  +
Sbjct: 67  GKIVLKIAELIRRDLEELAELESLDTGKTLEES-KADMDDIANVFQYYAGLADKDGGEII 125

Query: 684 PADGPH-HVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALY 860
            +  P    + + EPIGV GQI PWN+PL   +WK+ PALA GNT+V+K +E TPLT + 
Sbjct: 126 SSPIPDSESKIIREPIGVCGQITPWNYPLLQASWKIAPALAAGNTIVMKPSEITPLTTIK 185

Query: 861 AGKLFHEAGLP 893
             KL  EAG+P
Sbjct: 186 VFKLMEEAGVP 196



>sp|P40047|DHA5_YEAST Aldehyde dehydrogenase, mitochondrial
           precursor (EC 1.2.1.3).>gb:SCU56605_1710510
           Saccharomyces cerevisiae precursor aldehyde
           dehydrogenase gene, nuclear gene encoding mitochondrial
           protein, complete cds.
          Length = 519

 Score =  167 bits (424), Expect = 2e-40
 Identities = 84/189 (44%), Positives = 119/189 (62%)
 Frame = +3

Query: 327 NGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYERS 506
           NG+FV S   KTF  ++P  E+ I  V +   +D++ AVAA +K      + +     R+
Sbjct: 49  NGEFVASKQKKTFDVINPSNEEKITTVYKAMEDDVDEAVAALKKLLKRSVYCRAGV--RA 106

Query: 507 RIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVP 686
           + +   ADLVEKH + LA +E+ DNGK     A+ ++ ++ +      GWADKI+G  + 
Sbjct: 107 KALFNLADLVEKHQETLAAIESMDNGKSLF-CARGDVALVSKYLRSCGGWADKIYGNVID 165

Query: 687 ADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYAG 866
               H   ++ EP+GV GQIIPWNFPL M++WK+GPALA GNTVVLK AE TPL+AL+A 
Sbjct: 166 TGKNHFTYSIKEPLGVCGQIIPWNFPLLMWSWKIGPALATGNTVVLKPAETTPLSALFAS 225

Query: 867 KLFHEAGLP 893
           +L  EAG+P
Sbjct: 226 QLCQEAGIP 234



>gb:BT011186_1357793 Drosophila melanogaster RE12154 full insert cDNA.
          Length = 913

 Score =  167 bits (423), Expect = 3e-40
 Identities = 86/199 (43%), Positives = 127/199 (63%), Gaps = 4/199 (2%)
 Frame = +3

Query: 312  TQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMS 491
            TQ  ING+FVD+ + +T   ++P  E+V+  VA   A D+++AV AA  AF  G W +++
Sbjct: 433  TQLFINGEFVDAEAQRTLEIVNPTNEEVLCKVACASATDVDKAVRAAHSAF-YGSWRQIT 491

Query: 492  AYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIH 671
              +R ++ML  ADL+E++ +ELAT+E+ D+G  Y  A K+ + M +  + Y+AGW DKI 
Sbjct: 492  PRQRGQLMLNLADLMERNKEELATIESVDSGAVYTLALKTHVGMSIEAWRYFAGWCDKIQ 551

Query: 672  GLTVPAD--GPHHVQTL--HEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQ 839
            G T+P +   P++V T    EPIGV G I PWN+PL M +WK+   +A GNT ++K A+ 
Sbjct: 552  GNTIPVNPARPNNVLTFTRKEPIGVCGLITPWNYPLMMLSWKMAACIAAGNTCLIKPAQT 611

Query: 840  TPLTALYAGKLFHEAGLPP 896
             PLTAL   +L   AG PP
Sbjct: 612  CPLTALKFAELTVRAGFPP 630



>gb:AE014134_1130036 Drosophila melanogaster chromosome 2L, complete
            sequence.>gb:AE003670_1220143 Drosophila melanogaster
            chromosome 2L, section 79 of 83 of the complete sequence.
          Length = 913

 Score =  167 bits (423), Expect = 3e-40
 Identities = 86/199 (43%), Positives = 127/199 (63%), Gaps = 4/199 (2%)
 Frame = +3

Query: 312  TQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMS 491
            TQ  ING+FVD+ + +T   ++P  E+V+  VA   A D+++AV AA  AF  G W +++
Sbjct: 433  TQLFINGEFVDAEAQRTLEIVNPTNEEVLCKVACASATDVDKAVRAAHSAF-YGSWRQIT 491

Query: 492  AYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIH 671
              +R ++ML  ADL+E++ +ELAT+E+ D+G  Y  A K+ + M +  + Y+AGW DKI 
Sbjct: 492  PRQRGQLMLNLADLMERNKEELATIESVDSGAVYTLALKTHVGMSIEAWRYFAGWCDKIQ 551

Query: 672  GLTVPAD--GPHHVQTL--HEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQ 839
            G T+P +   P++V T    EPIGV G I PWN+PL M +WK+   +A GNT ++K A+ 
Sbjct: 552  GNTIPVNPARPNNVLTFTRKEPIGVCGLITPWNYPLMMLSWKMAACIAAGNTCLIKPAQT 611

Query: 840  TPLTALYAGKLFHEAGLPP 896
             PLTAL   +L   AG PP
Sbjct: 612  CPLTALKFAELTVRAGFPP 630



>gb:BA000043_738577 Geobacillus kaustophilus HTA426 DNA, complete
           genome.
          Length = 493

 Score =  167 bits (423), Expect = 3e-40
 Identities = 84/190 (44%), Positives = 123/190 (64%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           ING++V+S++G+ F T++P TE+VIA VA+   ED++ AV AAR AF+ G WPKM+  +R
Sbjct: 11  INGQYVESSNGEVFETVNPATEEVIATVAKATKEDVDHAVEAARTAFESGKWPKMTGAKR 70

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
           +R++ + A+L+ +  D+L   E  ++GK  + AAK ++   +  F +YA  A  + G   
Sbjct: 71  ARLLNQIANLMRERFDDLVYAEVLNSGKTVD-AAKGQIMQAIEDFEFYAAAAITLQGDVN 129

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
                    T+ EP+GV GQIIPWN+PL M AWK+ PALA G TVVLK A  TP+TA   
Sbjct: 130 QVPNGFFNYTVKEPVGVCGQIIPWNYPLMMAAWKLAPALAAGCTVVLKPASYTPITAYML 189

Query: 864 GKLFHEAGLP 893
            ++  EAG+P
Sbjct: 190 AEICQEAGVP 199



>gb:AE016867_352465 Pseudomonas syringae pv. tomato str. DC3000
           section 12 of 21 of the complete
           genome.>gb:AE016853_1037640 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 505

 Score =  167 bits (423), Expect = 3e-40
 Identities = 82/190 (43%), Positives = 120/190 (63%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           ING +  + SG TF T++P T + ++ +A   AED++ AV+ A+KAFD+G W  ++  ER
Sbjct: 25  INGAYKPAISGATFSTINPATGEFLSDLAACRAEDVDDAVSKAKKAFDDGRWRLLAPGER 84

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
             ++LKFA L+E +  ELA LE+ D+GKP  +    ++P  +    ++A   DK++  T 
Sbjct: 85  KSVLLKFARLLEDNRHELAVLESLDSGKPVRECQLVDVPDTIHTLRWHAELIDKLYDHTA 144

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
           P         + EPIGV G ++PWNFPL M AWK+GPALA G +V++K AEQT LT L  
Sbjct: 145 PVGNDALTLVVREPIGVVGCVLPWNFPLLMLAWKIGPALAAGCSVIVKPAEQTSLTTLRV 204

Query: 864 GKLFHEAGLP 893
            +L  EAG+P
Sbjct: 205 AELAFEAGVP 214



>gb:CR380952_1650556 Candida glabrata strain CBS138 chromosome F
           complete sequence.
          Length = 504

 Score =  167 bits (422), Expect = 3e-40
 Identities = 91/210 (43%), Positives = 128/210 (60%), Gaps = 4/210 (1%)
 Frame = +3

Query: 276 EELVSPAVEVKYTQHI---INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVA 446
           EE+  P +   Y Q I   I+ +FV S++G+   T++P TE+VI        +D+++AV 
Sbjct: 6   EEINIPQIGRSYKQPIGIFIDNEFVPSSNGEKIETINPATEEVITSFYAATEDDVDKAVK 65

Query: 447 AARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMI 626
           +AR+++ E  W K+S  E+  ++LK ADL+E+    LA LET D GKPY   A  ++  I
Sbjct: 66  SARESY-ENVWFKISPAEKRDMLLKLADLIEEEKPLLAALETLDAGKPYHTNAMDDIDQI 124

Query: 627 VRLFHYYAGWADKI-HGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALA 803
           + L  Y+AG  DK   G T+P D    V TL  P GV G IIPWN+PLAM +WK+   LA
Sbjct: 125 IHLTKYFAGATDKFTQGKTIPIDHEKLVYTLKSPYGVCGMIIPWNYPLAMASWKMQGCLA 184

Query: 804 CGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
            GNT+V+K AE T L+ LY  +LF +AG P
Sbjct: 185 AGNTLVIKPAENTSLSLLYLAQLFKKAGFP 214



>gb:CR628336_110420 Legionella pneumophila str. Paris complete
           genome.
          Length = 488

 Score =  167 bits (422), Expect = 3e-40
 Identities = 90/190 (47%), Positives = 113/190 (59%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           I+GKF  + SG T    DP   ++IA V E   ED   A+ AARKAFDEG W K  A +R
Sbjct: 8   IDGKFTLAKSGTTRDIFDPANGELIARVPESAKEDAILAIKAARKAFDEGEWRKSLALDR 67

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
            +++ K ADL+  +   LA LET + GKP  +A + ++      F +Y G A KIHG T+
Sbjct: 68  GKLLFKLADLIRANAKMLAELETRNCGKPLPEA-EFDVTDAANCFEFYGGLATKIHGETM 126

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
                     + EPIGV GQIIPWNFPL M AWK+ PALA GNT VLK +E TP+TAL  
Sbjct: 127 SVPANSFSYVVREPIGVCGQIIPWNFPLLMAAWKLAPALAAGNTAVLKPSELTPITALEL 186

Query: 864 GKLFHEAGLP 893
            KL  + G P
Sbjct: 187 FKLIDQCGFP 196



>gb:BC067563_2554740 Danio rerio aldehyde dehydrogenase 2, mRNA
           (cDNA clone MGC:85659 IMAGE:6959916), complete cds.
          Length = 422

 Score =  166 bits (421), Expect = 4e-40
 Identities = 79/136 (58%), Positives = 94/136 (69%)
 Frame = +3

Query: 486 MSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADK 665
           M A +R  ++ + AD +E+    LA LET DNGKPY  +   ++PM+V+   YYAGWADK
Sbjct: 1   MDASQRGLLLSRLADCIERDAAYLAELETLDNGKPYAVSFSVDVPMVVKCMRYYAGWADK 60

Query: 666 IHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTP 845
             G T+P DG +   T HEPIGV GQIIPWNFPL M AWK+GPALA GNTVV+K AEQTP
Sbjct: 61  WEGKTIPIDGNYFCYTRHEPIGVCGQIIPWNFPLLMQAWKLGPALATGNTVVMKVAEQTP 120

Query: 846 LTALYAGKLFHEAGLP 893
           LTALY   L  E G P
Sbjct: 121 LTALYIASLIKEVGFP 136



>gb:CR382138_1670689 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 504

 Score =  166 bits (421), Expect = 4e-40
 Identities = 85/201 (42%), Positives = 120/201 (59%), Gaps = 3/201 (1%)
 Frame = +3

Query: 303 VKYTQH---IINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG 473
           +KYTQ     IN +FV S  G  F  L P TE+V+  V E   +D++ AV  A +AF+E 
Sbjct: 18  IKYTQPTGLFINNEFVRSKQGNKFEVLSPSTEEVVTSVYEAREDDVDIAVQHALRAFEES 77

Query: 474 PWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAG 653
            W K    +R   + K A+L+E++ + +A++E  DNGK    A K ++ + + +    AG
Sbjct: 78  SWAKADPCQRGAALYKLANLIEENFETIASIEAMDNGKAIGNA-KGDVTLAISVLRSTAG 136

Query: 654 WADKIHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTA 833
           ++DK+ G  + +   H   T  EP+GV GQIIPWNFPL MF WK+ PAL  GN VV+K++
Sbjct: 137 FSDKMLGSVIESGDSHFNFTRREPLGVCGQIIPWNFPLLMFTWKIAPALVTGNCVVIKSS 196

Query: 834 EQTPLTALYAGKLFHEAGLPP 896
           E TPL+ALY   L  EA L P
Sbjct: 197 ETTPLSALYVSNLIKEANLFP 217



>gb:PPU24215_159570 Pseudomonas putida p-cymene catabolism (cym) and
           p-cumate catabolism (cmt) operons and enol-coenzyme A
           hydratase gene, complete cds.
          Length = 494

 Score =  166 bits (421), Expect = 4e-40
 Identities = 87/196 (44%), Positives = 118/196 (60%), Gaps = 3/196 (1%)
 Frame = +3

Query: 315 QHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSA 494
           +++I G++  S SG+T    +P TE++IAH+ +G  EDI+ AV  AR  F+   W K+  
Sbjct: 17  RNLIGGQWKGSISGETITVENPATEEIIAHIPQGRHEDIDEAVRVARATFESPAWRKIRP 76

Query: 495 YERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHG 674
            +R RI+   A  +E+H DELA LE+ D GK    A   +LP  + +F Y  GW  K+ G
Sbjct: 77  IDRGRILENVARKIEEHADELAYLESLDTGKALTFAKAIDLPSTIDVFRYMGGWCSKLGG 136

Query: 675 LTVPA--DG-PHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTP 845
            T P   DG  +H  T  EPIGV G I PWN+PLA+ +WK+  ALA G T+VLK  E TP
Sbjct: 137 TTPPISFDGREYHTYTRREPIGVVGAITPWNYPLALGSWKIASALAAGCTMVLKPTELTP 196

Query: 846 LTALYAGKLFHEAGLP 893
           L+ L   +L  EAGLP
Sbjct: 197 LSTLRLAELCLEAGLP 212



>gb:CR382139_1672150 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 521

 Score =  166 bits (420), Expect = 6e-40
 Identities = 96/196 (48%), Positives = 115/196 (58%), Gaps = 1/196 (0%)
 Frame = +3

Query: 312 TQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMS 491
           T   IN ++V     KTF  + P TE+ I  V E   EDI+ AV AA  AF +  W    
Sbjct: 45  TGMFINNEYVYPKQKKTFDVISPSTEEHITDVYEALEEDIDTAVEAASAAF-KSSWSTGD 103

Query: 492 AYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIH 671
              R+  +LK ADLV+ + D LA +E  DNGK     ++ ++ +    F   AGWADKI 
Sbjct: 104 PSVRANALLKLADLVDANADTLAHIEALDNGKSL-MCSRGDVALTAMYFRSCAGWADKIL 162

Query: 672 GLTVPADGPHHVQ-TLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPL 848
           G TVP  G  H   T  EPIGV GQIIPWNFPL M AWKVGPA A GNT+VLKTAE TPL
Sbjct: 163 G-TVPETGSTHFNYTRREPIGVCGQIIPWNFPLLMLAWKVGPATATGNTIVLKTAESTPL 221

Query: 849 TALYAGKLFHEAGLPP 896
           + L+   L  EAG PP
Sbjct: 222 SGLFLTGLIKEAGFPP 237



>gb:AF440524_511253 Pseudomonas aeruginosa strain SG17M genomic
           sequence, integrated gene island PAGI-3(SG).
          Length = 502

 Score =  166 bits (419), Expect = 7e-40
 Identities = 87/191 (45%), Positives = 114/191 (59%)
 Frame = +3

Query: 321 IINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYE 500
           +I+GK +++ SG+TF  + P    V+  VAEG   DIN+AVAAAR AF +  W   S   
Sbjct: 28  LIDGKLIEAHSGQTFDCVSPVDGRVLTKVAEGGEADINKAVAAARAAFQDRRWAGQSPIF 87

Query: 501 RSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLT 680
           R R +  FA L+  H DELA LET D GKP   +   ++  +   F +YA   DK++   
Sbjct: 88  RKRTLQAFAALIRLHRDELALLETLDMGKPISASRSVDVEAVANCFDWYAEAIDKLYEQI 147

Query: 681 VPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALY 860
            P           EP+GV G I+PWNFP+   AWKV PALA GN+VVLK AEQ+PLTA+ 
Sbjct: 148 APTAENDLALITREPLGVVGAIVPWNFPMLTTAWKVAPALATGNSVVLKPAEQSPLTAIR 207

Query: 861 AGKLFHEAGLP 893
            G+L  EAG+P
Sbjct: 208 LGQLALEAGIP 218



>gb:CR628337_113487 Legionella pneumophila str. Lens complete
           genome.
          Length = 488

 Score =  166 bits (419), Expect = 7e-40
 Identities = 90/190 (47%), Positives = 114/190 (60%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           I+GKF  + SG T   +DP   ++IA V E   ED   A+ AARKAFDEG W    A +R
Sbjct: 8   IDGKFTLAKSGATRDIIDPANGELIAKVPESAKEDAILAIKAARKAFDEGEWRISLALDR 67

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
            +++ K ADL+  +   LA LET + GKP  +A + ++      F +Y G A KIHG T+
Sbjct: 68  GKLLFKLADLIRANAKMLAELETRNCGKPLPEA-EFDVTDAANCFEFYGGLATKIHGETM 126

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
                     + EPIGV GQIIPWNFPL M AWK+ PALA GNTVVLK +E TP+TAL  
Sbjct: 127 SVPANSFSYVVREPIGVCGQIIPWNFPLLMAAWKLAPALAAGNTVVLKPSELTPITALEL 186

Query: 864 GKLFHEAGLP 893
            KL  + G P
Sbjct: 187 FKLIDQCGFP 196



>gb:AY437859_617604 Brachymonas petroleovorans cyclohexanone gene
           cluster, partial sequence.
          Length = 484

 Score =  165 bits (418), Expect = 1e-39
 Identities = 81/192 (42%), Positives = 116/192 (60%), Gaps = 1/192 (0%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEG-PWPKMSAYE 500
           + G++V+ A G  +   +P   + I  VA+  A D++ AV  A++A + G PW +M+   
Sbjct: 15  LGGRWVEPAQGMYYDNENPAKRETICRVAQASAADVDAAVRGAQQALEPGSPWAQMTPAA 74

Query: 501 RSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLT 680
           R+R++ + A+ + + ++ELA LE+ D GKPY +A   ++P     F YYAGW  K+ G  
Sbjct: 75  RARLLWRVAERIREQVEELAWLESLDTGKPYGEALHGDIPHAAGAFEYYAGWCSKLAGSV 134

Query: 681 VPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALY 860
           +P    +   T  EP+GV G IIPWNFPL M A KV PALA GN V+LK AEQTPLTA  
Sbjct: 135 LPVSPRYLDYTRLEPVGVVGAIIPWNFPLQMAAMKVAPALAAGNAVLLKPAEQTPLTAFA 194

Query: 861 AGKLFHEAGLPP 896
             ++F E   PP
Sbjct: 195 LARIFEELEFPP 206



>gb:U12966_1401767 Caenorhabditis elegans cosmid F54D8, complete
           sequence.
          Length = 422

 Score =  164 bits (416), Expect = 2e-39
 Identities = 77/136 (56%), Positives = 98/136 (72%)
 Frame = +3

Query: 486 MSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADK 665
           M A +R  ++ + ADL+E+    LA+LE+ DNGKPY  A  ++LP+ ++   YYAGWADK
Sbjct: 1   MDASQRGVLLNRLADLMERDRVILASLESLDNGKPYAVAYNADLPLSIKTLRYYAGWADK 60

Query: 666 IHGLTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTP 845
            HG T+P +G +   T HEP+GV GQIIPWNFPL M AWK+GPALA GNTVV+K AEQTP
Sbjct: 61  NHGKTIPIEGDYFTYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALAMGNTVVMKVAEQTP 120

Query: 846 LTALYAGKLFHEAGLP 893
           L+AL+   L  EAG P
Sbjct: 121 LSALHVAALTKEAGFP 136



>gb:AP006618_559173 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 500

 Score =  164 bits (416), Expect = 2e-39
 Identities = 92/193 (47%), Positives = 113/193 (58%)
 Frame = +3

Query: 315 QHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSA 494
           +H I+G FVDS  G TF  LDP T +     A G+  DI+RAVAAARKAF EGPWPK+  
Sbjct: 18  RHYIDGAFVDSVDGDTFDVLDPVTNETYVQAAAGKKADIDRAVAAARKAFTEGPWPKLLP 77

Query: 495 YERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHG 674
            ERSR++ + ADLVE     LA LE++D+G P  QA   +       F ++A        
Sbjct: 78  RERSRVLHRIADLVESRDARLAELESFDSGLPITQAL-GQARRAAENFRFFADLIVAQSD 136

Query: 675 LTVPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTA 854
            T    G        +PIGVAG I PWN P  + +WK+ PALA GNTVVLK AE TPL+A
Sbjct: 137 DTYKVPGRQINYVNRKPIGVAGLITPWNTPFMLESWKLAPALATGNTVVLKPAEFTPLSA 196

Query: 855 LYAGKLFHEAGLP 893
                +F EAGLP
Sbjct: 197 SLWAGIFEEAGLP 209



>pir|T50272|T50272 probable aldehyde dehydrogenase [imported] -
           fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC922_1718469 S.pombe chromosome I cosmid
           c922.
          Length = 496

 Score =  164 bits (416), Expect = 2e-39
 Identities = 83/190 (43%), Positives = 117/190 (61%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           ING++  SA  +T+ T+DP  E+VIA V     ++I+ AV +A++AF    W K+   E+
Sbjct: 25  INGEWHKSA--ETWETVDPSIEEVIAKVYLAGEKEIDYAVKSAKEAFKT--WKKVPGSEK 80

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
             +++K A+L EKH D LA +E  D+GKP    A+ ++   + L  Y AGWADKI+G  +
Sbjct: 81  GELLMKLAELTEKHADTLAAIEAMDSGKPLVSNARGDVDGTIALLRYCAGWADKIYGQVI 140

Query: 684 PADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYA 863
           P            PIGV GQI+PWN+PL M  WK+ PALA GN +++K+AE TPL+ LY 
Sbjct: 141 PTGPEKLAYAKRTPIGVCGQIVPWNYPLNMAGWKIAPALAAGNCIIIKSAETTPLSLLYF 200

Query: 864 GKLFHEAGLP 893
             L  EAG P
Sbjct: 201 ATLVEEAGFP 210



>gb:AY316747_608952 Rhizobium sp. NGR234 megaplasmid 2 contig 1,
           complete sequence.
          Length = 502

 Score =  164 bits (415), Expect = 2e-39
 Identities = 90/225 (40%), Positives = 122/225 (54%), Gaps = 2/225 (0%)
 Frame = +3

Query: 225 KYGVESGIQRFSTAAAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAH 404
           +YGV    +RF                K  +  I+G + DS++G TF   +P T  +I  
Sbjct: 11  QYGVSDATRRFLA--------------KPQKMFIDGAWSDSSNGATFDIFEPSTGGLITR 56

Query: 405 VAEGEAEDINRAVAAARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNG 584
              G  ED++RAV AAR+ FD G W ++   ER R++   ADL+E H DELA +E  D G
Sbjct: 57  APSGTPEDLDRAVRAARRQFDGGAWRRLKPLERERLLHSLADLIEAHSDELAEIEAIDMG 116

Query: 585 KPYEQAAKSELPMIVRLFHYYAGWADKIHGLTVPAD--GPHHVQTLHEPIGVAGQIIPWN 758
           K    A + ++   V  F Y+AGWA K+HG TV     G +   T  EP+GV   I+PWN
Sbjct: 117 KSVTFAREIDIRGTVDTFRYFAGWASKLHGRTVEPSLPGNYLAYTRKEPLGVVAAIVPWN 176

Query: 759 FPLAMFAWKVGPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLP 893
           FPL   AWK+  ALA G T ++K AE T L+ L   +L  EAG+P
Sbjct: 177 FPLQTLAWKLAAALAVGCTAIVKPAELTSLSTLRFAELVQEAGIP 221



>gb:AE016787_332879 Pseudomonas putida KT2440 section 14 of 21 of
           the complete genome.>gb:AE015451_947956 Pseudomonas
           putida KT2440 complete genome.
          Length = 497

 Score =  164 bits (414), Expect = 3e-39
 Identities = 86/196 (43%), Positives = 116/196 (59%), Gaps = 6/196 (3%)
 Frame = +3

Query: 324 INGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVAAARKAFDEGPWPKMSAYER 503
           I   + D+ASG+T    +P T +V+  V   EAED++RAV AAR+AFD+ PW +M   ER
Sbjct: 23  IGADWQDAASGRTLSFRNPATGEVLGEVPAAEAEDVDRAVRAARQAFDDSPWSRMRPRER 82

Query: 504 SRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMIVRLFHYYAGWADKIHGLTV 683
             ++ + ADL+E+   +LA LE  +NGK    A   ++ + +    Y AGWA KI G TV
Sbjct: 83  QNLLWRLADLMERDARQLAELECLNNGKSAAVAQMMDVQLAIDFLRYMAGWATKIEGSTV 142

Query: 684 PADGP------HHVQTLHEPIGVAGQIIPWNFPLAMFAWKVGPALACGNTVVLKTAEQTP 845
            A  P       H     E +GV G I+ WNFPL +  WK+GPALA G TVVLK A++TP
Sbjct: 143 EASMPLMPNDQFHGFVRREAVGVVGAIVAWNFPLLLACWKLGPALATGCTVVLKPADETP 202

Query: 846 LTALYAGKLFHEAGLP 893
           L+ L   +L  EAG P
Sbjct: 203 LSVLKLAELVDEAGYP 218



>gb:CP000032_87994 Silicibacter pomeroyi DSS-3 plasmid megaplasmid,
           complete sequence.
          Length = 504

 Score =  164 bits (414), Expect = 3e-39
 Identities = 95/216 (43%), Positives = 123/216 (56%), Gaps = 6/216 (2%)
 Frame = +3

Query: 267 AAVEELVSPAVEVKYTQHIINGKFVDSASGKTFPTLDPRTEDVIAHVAEGEAEDINRAVA 446
           A  + L SPA      + ++ G    ++ G+T    +P T   +A V  G A +I+ AV 
Sbjct: 16  AVADYLDSPA------KLLLGGTSTAASDGRTMDVFNPATGKKLAEVPWGGAAEIDLAVK 69

Query: 447 AARKAFDEGPWPKMSAYERSRIMLKFADLVEKHMDELATLETWDNGKPYEQAAKSELPMI 626
           AA+ A  EG W +M   ER R++L  ADL+E + +ELA LET +NGK    +   E+   
Sbjct: 70  AAQAAL-EGDWSRMRPVERQRVLLNLADLIEANGEELAQLETLNNGKSVMLSRLVEVGNS 128

Query: 627 VRLFHYYAGWADKIHGLT------VPADGPHHVQTLHEPIGVAGQIIPWNFPLAMFAWKV 788
                Y AGW+ KI G T      VP    +   T  EP+GV G I PWNFPL M  WK+
Sbjct: 129 SNYLRYMAGWSTKIEGSTIDVSIAVPPGAKYQAYTRKEPVGVVGAITPWNFPLNMAIWKL 188

Query: 789 GPALACGNTVVLKTAEQTPLTALYAGKLFHEAGLPP 896
            PALACGNTVVLK AE+TPLT+L  G+L  EAGLPP
Sbjct: 189 APALACGNTVVLKPAEETPLTSLRLGELCLEAGLPP 224


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,013,681,968
Number of Sequences: 1806583
Number of extensions: 22383224
Number of successful extensions: 64158
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 59277
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 62437
length of database: 581,917,975
effective HSP length: 124
effective length of database: 357,901,683
effective search space used: 62274892842
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)