BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig5341
         (643 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AC123513_1192410 Dictyostelium discoideum strain AX4 chromoso...    22   2e-25   
gb:AB022223_1515175 Arabidopsis thaliana genomic DNA, chromosome...   101   1e-20   
pir|G71410|G71410 probable protein kinase - Arabidopsis thaliana...    94   3e-18   Arabidopsis thaliana [mouse-ear cress]
gb:AC120505_1739743 Oryza sativa chromosome 3 BAC OSJNBa0066H15 ...    91   1e-17   
gb:AC098571_1736752 Oryza sativa (japonica cultivar-group) chrom...    69   9e-11   
gb:AY224453_1590655 Oryza sativa (japonica cultivar-group) isola...    69   9e-11   
gb:AC087852_1734226 Oryza sativa chromosome 3 BAC OJ1124_H03 gen...    68   1e-10   
gb:AP003855_1834345 Oryza sativa (japonica cultivar-group) genom...    67   3e-10   
sp|P04929|HRPX_PLALO|HRPX_PLALO Histidine-rich glycoprotein precursor.>pir|...    23   8e-10   Plasmodium lophurae
gb:AY085263_1570335 Arabidopsis thaliana clone 142106 mRNA, comp...    60   3e-08   
gb:AB026650_1517245 Arabidopsis thaliana genomic DNA, chromosome...    60   3e-08   
gb:AY086480_1571528 Arabidopsis thaliana clone 253505 mRNA, comp...    57   3e-07   
pir|T48115|T48115 protein kinase ATMRK1 (EC 2.7.1.-) [imported] ...    57   3e-07   Arabidopsis thaliana [mouse-ear cress]
gb:ATAC009325_1542880 Arabidopsis thaliana chromosome III BAC F4...    56   6e-07   
gb:ATAC011708_1543394 Arabidopsis thaliana chromosome III BAC T7...    23   4e-06   
gb:AX647437_1472344 Sequence 1629 from Patent EP1270724.               23   9e-05   
gb:AY209187_1309958 Trypanosoma cruzi RNA-binding protein 6 (rbp...    21   1e-04   
gb:PFAHRPA_1393792 P.lophurae histidine-rich protein mRNA, 3' end.     22   6e-04   
pir|A54523|A54523 histidine-rich protein - Plasmodium lophurae (...    22   6e-04   Plasmodium lophurae
gb:AK131456_1917990 Homo sapiens cDNA FLJ16611 fis, clone TESTI4...    23   6e-04   
sp|P51179|NR43_RAT|NR43_RAT Orphan nuclear receptor NR4A3 (Nuclear hormon...    24   9e-04   Rattus norvegicus [brown rat]
pir|S66671|S66671 neuron-derived receptor NOR-2 - rat>gb:RNRNALR...    24   0.001   Rattus norvegicus [brown rat]
gb:S81243_2041981 CHN=steroid/thyroid orphan receptor homolog ge...    24   0.004   
gb:D78579_1994890 Homo sapiens NOR-1 mRNA for neuron derived orp...    24   0.004   
sp|Q92570|NR43_HUMAN|NR43_HUMAN Orphan nuclear receptor NR4A3 (Nuclear horm...    24   0.004   Homo sapiens [man]
pir|S71930|S71930 neuron-derived receptor NOR-1 - human                24   0.004   Homo sapiens [man]
gb:HSU12767_2022202 Human mitogen induced nuclear orphan recepto...    24   0.004   
gb:HSNUCREC_2019234 H.sapiens mRNA for nuclear receptor.               24   0.004   
sp|Q9QZB6|NR43_MOUSE|NR43_MOUSE Orphan nuclear receptor NR4A3 (Orphan nucle...    24   0.005   Mus musculus [mouse]
gb:AF191212_2058508 Mus musculus orphan nuclear receptor TECdelt...    24   0.005   
gb:AC116305_1206185 Dictyostelium discoideum chromosome 2 map 10...    22   0.007   
gb:BT002906_1636496 Arabidopsis thaliana clone RAFL15-07-C17 (R2...    21   0.014   
pir|G84783|G84783 probable pectinesterase [imported] - Arabidops...    21   0.014   Arabidopsis thaliana [mouse-ear cress]
pir|D83483|D83483 probable metal transporter PA1297 [imported] -...    22   0.021   Pseudomonas aeruginosa
gb:GGA401088_2572803 Gallus gallus mRNA for MOX-2 protein.             24   0.024   
gb:BT019351_2151306 Synthetic construct Homo sapiens mesenchyme ...    24   0.024   
gb:BC002076_2088847 Mus musculus mesenchyme homeobox 2, mRNA (cD...    24   0.024   
gb:CR536553_1993846 Homo sapiens full open reading frame cDNA cl...    24   0.024   
gb:AF295686_1417755 Sus scrofa growth arrest homeobox transcript...    24   0.024   
sp|P39020|MOX2_RAT|MOX2_RAT Homeobox protein MOX-2 (Growth arrest-specifi...    24   0.024   Rattus norvegicus [brown rat]
sp|P32443|MOX2_MOUSE|MOX2_MOUSE Homeobox protein MOX-2 (Mesenchyme homeobox...    24   0.024   Mus musculus [mouse]
sp|P50222|MOX2_HUMAN|MOX2_HUMAN Homeobox protein MOX-2 (Mesenchyme homeobox...    24   0.024   Homo sapiens [man]
gb:HSU58496_2025055 Human mnb protein kinase homolog hp86 (DYRK)...    22   0.036   
gb:HSU52373_2024742 Human serine/threonine kinase MNB (mnb) mRNA...    22   0.036   
sp|Q63470|DYRA_RAT|DYRA_RAT Dual-specificity tyrosine-phosphorylation reg...    22   0.036   Rattus norvegicus [brown rat]
sp|Q61214|DYRA_MOUSE|DYRA_MOUSE Dual-specificity tyrosine-phosphorylation r...    22   0.036   Mus musculus [mouse]
sp|Q13627|DYRA_HUMAN|DYRA_HUMAN Dual-specificity tyrosine-phosphorylation r...    22   0.036   Homo sapiens [man]
gb:GGA459381_2572833 Gallus gallus mRNA for minibrain protein ki...    22   0.036   
pir|JC4898|JC4898 Down-syndrome-critical-region protein - human>...    22   0.036   Homo sapiens [man]
gb:BC034550_2097686 Mus musculus dual-specificity tyrosine-(Y)-p...    22   0.037   
gb:AK052390_1170019 Mus musculus 13 days embryo heart cDNA, RIKE...    22   0.038   
gb:AE014298_1125097 Drosophila melanogaster chromosome X, comple...    22   0.042   
gb:BC048837_2099836 Mus musculus, Similar to dual-specificity ty...    22   0.042   
gb:AY034061_2508846 Danio rerio nuclear receptor FF1aE mRNA, com...    21   0.048   
gb:AF014926_2468608 Danio rerio FTZ-F1 homolog (zFF1) mRNA, comp...    21   0.048   
gb:AJ586138_1906761 Homo sapiens mRNA for ubiquitin-specific pro...    23   0.050   
gb:AC005550_1874971 Homo sapiens PAC clone RP4-620P6 from 7, com...    24   0.051   
gb:AE014298_1123748 Drosophila melanogaster chromosome X, comple...    21   0.051   
pir|T13389|T13389 hypothetical protein 115C2.10 - fruit fly (Dro...    21   0.051   Drosophila melanogaster
gb:AY089517_1297173 Drosophila melanogaster GM05459 full insert ...    21   0.055   
gb:AY069604_1294334 Drosophila melanogaster LD36415 full length ...    21   0.056   
sp|P06782|SNF1_YEAST|SNF1_YEAST Carbon catabolite derepressing protein kina...    21   0.058   Saccharomyces cerevisiae [brewer's yeast]
gb:BC057615_2102830 Mus musculus discs, large (Drosophila) homol...    23   0.061   
gb:AY530298_2086234 Rattus norvegicus synapse-associated protein...    23   0.061   
gb:AY243848_2080523 Mus musculus SAP90/PSD-95 associated protein...    23   0.061   
gb:HSJ997D16_2016705 Human DNA sequence from clone RP5-997D16 on...    23   0.061   
sp|P97838|DLP3_RAT|DLP3_RAT Disks large-associated protein 3 (DAP-3) (SAP...    23   0.061   Rattus norvegicus [brown rat]
gb:AY530299_2086235 Rattus norvegicus synapse-associated protein...    23   0.061   
gb:BC058433_2103220 Mus musculus discs, large (Drosophila) homol...    23   0.063   
pir|T42516|T42516 hypothetical protein - fission yeast (Schizosa...    22   0.079   Schizosaccharomyces pombe
sp|O42980|YBE1_SCHPO|YBE1_SCHPO Putative thiol protease C17D11.01 (EC 3.4.2...    22   0.079   Schizosaccharomyces pombe
gb:BC050860_2100500 Mus musculus RIKEN cDNA 2810030E01 gene, mRN...    21   0.087   
gb:AY152408_2515474 Gallus gallus transcription factor MAFA (MAF...    23   0.096   
gb:AF034693_2469775 Coturnix coturnix japonica bZip transcriptio...    23   0.096   
gb:AF034570_2469770 Gallus gallus bZIP transcription factor L-Ma...    23   0.096   
gb:AF221557_2480759 Gallus gallus bZIP transcription factor L-MA...    23   0.12    
gb:AY493414_1330562 Caenorhabditis elegans LIN-45 isoform 3 mRNA...    38   0.13    
gb:AC024204_1204268 Caenorhabditis elegans cosmid Y73B6A, comple...    38   0.13    
pir|S33261|S33261 protein kinase lin-45 (EC 2.7.1.-) - Caenorhab...    38   0.13    Caenorhabditis elegans [roundworm]
sp|Q07292|KRAF_CAEEL|KRAF_CAEEL Raf homolog serine/threonine-protein kinase...    38   0.13    Caenorhabditis elegans [roundworm]
pir|A55641|A55641 homeotic protein GAX - human>gb:HUMGAX_2031401...    24   0.13    Homo sapiens [man]
gb:AE014298_1124253 Drosophila melanogaster chromosome X, comple...    23   0.14    
gb:AE014298_1125574 Drosophila melanogaster chromosome X, comple...    24   0.14    
gb:AY061372_1293175 Drosophila melanogaster LD29423 full length ...    23   0.14    
gb:AF362370_1265603 Dictyostelium discoideum histidine kinase Dh...    22   0.15    
gb:BC075450_2558553 Xenopus tropicalis HRG protein, mRNA (cDNA c...    21   0.15    
gb:DMSEG0007_1380154 Drosophila melanogaster sequence EG0007: co...    23   0.15    
gb:AP003571_1831039 Oryza sativa (japonica cultivar-group) genom...    21   0.15    
pir|S41512|S41512 Brn-3b protein - mouse                               24   0.17    Mus musculus [mouse]
pir|T51023|T51023 hypothetical protein B7F21.40 [imported] - Neu...    23   0.18    Neurospora crassa
gb:NCB7F21_1690152 Neurospora crassa DNA linkage group II BAC cl...    23   0.18    
pir|A46390|A46390 cAMP receptor subtype 2, CAR2 - slime mold (Di...    22   0.18    Dictyostelium discoideum
sp|P34907|CAR2_DICDI|CAR2_DICDI Cyclic AMP receptor 2.>gb:S55234_1396618 Di...    22   0.18    Dictyostelium discoideum
gb:HSGATA6PR_2013389 H.sapiens mRNA for GATA-6 DNA-binding protein.    25   0.19    
sp|Q92908|GAT6_HUMAN|GAT6_HUMAN Transcription factor GATA-6 (GATA binding f...    25   0.19    Homo sapiens [man]
sp|Q63934|PO42_MOUSE|PO42_MOUSE POU domain, class 4, transcription factor 2...    23   0.19    Mus musculus [mouse]
sp|Q12837|PO42_HUMAN|PO42_HUMAN POU domain, class 4, transcription factor 2...    23   0.19    Homo sapiens [man]
gb:S69351_2139012 Mus musculus BRN-3b (Brn-3b) gene, complete cds.     23   0.20    
gb:AF526419_2499134 Gallus gallus class IV POU-domain transcript...    23   0.22    
pir|H82172|H82172 heat shock protein HslJ VC1663 [imported] - Vi...    37   0.22    Vibrio cholerae
gb:AF434665_2494272 Petromyzon marinus Hox1w (hox1w) mRNA, parti...    24   0.25    
gb:BC065961_2554215 Danio rerio POU domain gene 12, mRNA (cDNA c...    24   0.33    
gb:BC058318_2552289 Danio rerio POU domain gene 12, mRNA (cDNA c...    24   0.33    
gb:BC056601_2551871 Danio rerio one cut domain, family member 1,...    22   0.34    
gb:AY835394_2546830 Danio rerio onecut-1 isoform b (oc1) mRNA, c...    22   0.34    
gb:BC066466_2554355 Danio rerio one cut domain, family member 1,...    22   0.34    
gb:AY835393_2546829 Danio rerio onecut-1 isoform a (oc1) mRNA, c...    22   0.34    
gb:AC115598_1205761 Dictyostelium discoideum chromosome 2 map 58...    23   0.41    
gb:AC117082_1207978 Dictyostelium discoideum chromosome 2 map co...    24   0.76    
sp|P54842|MAFB_RAT|MAFB_RAT Transcription factor MafB (V-maf musculoapone...    23   0.81    Rattus norvegicus [brown rat]
sp|P54841|MAFB_MOUSE|MAFB_MOUSE Transcription factor MafB (V-maf musculoapo...    23   0.81    Mus musculus [mouse]
gb:HSBRN3B_2011116 H.sapiens Brn3B mRNA.                               23   1.2     
gb:RNHNF6B_2135014 R.norvegicus mRNA for hepatocyte nuclear fact...    22   1.2     
sp|P70512|HNF6_RAT|HNF6_RAT Hepatocyte nuclear factor 6 (HNF-6) (One cut ...    22   1.2     Rattus norvegicus [brown rat]
sp|O08755|HNF6_MOUSE|HNF6_MOUSE Hepatocyte nuclear factor 6 (HNF-6) (One cu...    22   1.2     Mus musculus [mouse]
sp|Q9UBC0|HNF6_HUMAN|HNF6_HUMAN Hepatocyte nuclear factor 6 (HNF-6) (One cu...    22   1.2     Homo sapiens [man]
gb:HSA17739_2000436 Homo sapiens HNF-6 gene, partial.                  22   1.2     
gb:AY436753_1326170 Ptychodera flava transcription factor Hox1 m...    22   1.3     
sp|P40349|URB1_USTMA|URB1_USTMA Siderophore biosynthesis regulatory protein...    22   1.3     Ustilago maydis
gb:AP004728_1843871 Oryza sativa (japonica cultivar-group) genom...    25   1.4     
gb:AC125735_1208090 Leishmania major strain Friedlin chromosome ...    22   1.4     
gb:CR382137_1669678 Debaryomyces hansenii chromosome E of strain...    23   1.5     
gb:AF134157_1885604 Homo sapiens MAFB/Kreisler basic region/leuc...    23   1.6     
sp|Q9Y5Q3|MAFB_HUMAN|MAFB_HUMAN Transcription factor MafB (V-maf musculoapo...    23   1.6     Homo sapiens [man]
sp|P32870|CYA1_DROME|CYA1_DROME Ca(2+)/calmodulin-responsive adenylate cycl...    25   1.9     Drosophila melanogaster
gb:AF196575_2479495 Xenopus laevis class IV POU-homeodomain prot...    23   2.2     
gb:AF039952_2470029 Danio rerio type III POU domain protein (zp-...    24   2.3     
sp|Q90436|PO33_BRARE|PO33_BRARE Brain-specific homeobox/POU domain protein ...    24   2.3     Danio rerio [leopard danio]
gb:BC070001_2555480 Danio rerio POU domain gene 12, mRNA (cDNA c...    24   2.3     
sp|P56224|ZP12_BRARE|ZP12_BRARE POU domain protein ZP-12 (Class III POU dom...    24   2.3     Danio rerio [leopard danio]
gb:BC044354_2548664 Danio rerio POU domain gene 12, mRNA (cDNA c...    24   2.3     
gb:DRU77736_2571383 Danio rerio class III POU domain protein (ta...    24   2.3     
gb:AP003573_1831095 Oryza sativa (japonica cultivar-group) genom...    23   2.3     
gb:AC117075_1207764 Dictyostelium discoideum chromosome 2 map 52...    21   2.4     
gb:AP003685_1832011 Oryza sativa (japonica cultivar-group) genom...    34   2.4     
gb:AE014297_1141245 Drosophila melanogaster chromosome 3R, compl...    23   2.5     
gb:AB066609_2047131 Mus musculus Cacna1a mRNA for CaV2.1, comple...    22   2.6     
gb:AB066608_2047130 Mus musculus Cacna1a mRNA for CaV2.1, comple...    22   2.6     
sp|P54282|CCAA_RAT|CCAA_RAT Voltage-dependent P/Q-type calcium channel al...    22   2.6     Rattus norvegicus [brown rat]
sp|P97445|CCAA_MOUSE|CCAA_MOUSE Voltage-dependent P/Q-type calcium channel ...    22   2.6     Mus musculus [mouse]
gb:BX537168_2567604 Zebrafish DNA sequence from clone DKEY-105O6...    24   2.8     
gb:AY872029_2150193 Synthetic construct hypothetical protein (FT...    22   2.8     
gb:CJMAFBPRT_2569770 C.japonica mRNA for MAFB protein.                 24   2.8     
pir|T13804|T13804 shs protein - fruit fly (Drosophila melanogast...    23   2.8     Drosophila melanogaster
sp|Q24523|BUN2_DROME|BUN2_DROME Bunched protein, class 2 isoform (Shortsigh...    23   2.8     Drosophila melanogaster
sp|Q28555|HAN1_SHEEP|HAN1_SHEEP Heart- and neural crest derivatives-express...    21   2.9     Ovis aries [domestic sheep]
gb:BC050072_1984257 Homo sapiens forkhead box G1B, mRNA (cDNA cl...    21   2.9     
pir|A54743|A54743 transcription factor HFK1 - human                    21   2.9     Homo sapiens [man]
sp|P55315|FXGB_HUMAN|FXGB_HUMAN Forkhead box protein G1B (Forkhead-related ...    21   2.9     Homo sapiens [man]
sp|P55316|FXGA_HUMAN|FXGA_HUMAN Forkhead box protein G1A (Forkhead-related ...    21   2.9     Homo sapiens [man]
sp|Q64733|FXB2_MOUSE|FXB2_MOUSE Forkhead box protein B2 (Transcription fact...    21   3.0     Mus musculus [mouse]
gb:AF480496_1803744 Oryza sativa clone BAC 49D11, complete seque...    21   3.0     
gb:AF051526_2052504 Rattus norvegicus class A calcium channel va...    22   3.0     
gb:AE014298_1125653 Drosophila melanogaster chromosome X, comple...    24   3.1     
gb:AE014187_938894 Plasmodium falciparum 3D7 chromosome 14 compl...    33   3.2     
pir|T10671|T10671 protein kinase homolog F6E21.90 - Arabidopsis ...    33   3.2     Arabidopsis thaliana [mouse-ear cress]
sp|P34908|BRAF_COTJA|BRAF_COTJA B-Raf proto-oncogene serine/threonine-prote...    33   3.2     Coturnix japonica
sp|Q04982|BRAF_CHICK|BRAF_CHICK B-Raf proto-oncogene serine/threonine-prote...    33   3.2     Gallus gallus [bantam]
gb:AK083575_1174007 Mus musculus 9 days embryo whole body cDNA, ...    21   3.2     
sp|P09022|HXA1_MOUSE|HXA1_MOUSE Homeobox protein Hox-A1 (Hox-1.6) (Homeotic...    21   3.2     Mus musculus [mouse]
gb:AF051527_2052505 Rattus norvegicus class A calcium channel va...    22   3.2     
gb:AF424700_2065475 Mus musculus Otx1 (Otx1) gene, complete cds.       23   3.5     
sp|Q63410|OTX1_RAT|OTX1_RAT Homeobox protein OTX1.>pir|I56547|I56547 home...    23   3.5     Rattus norvegicus [brown rat]
sp|P80205|OTX1_MOUSE|OTX1_MOUSE Homeobox protein OTX1.>pir|S35345|S35345 ot...    23   3.5     Mus musculus [mouse]
gb:AF189709_2058435 Rattus norvegicus collagen XVIII mRNA, parti...    21   3.5     
gb:AE014298_1125167 Drosophila melanogaster chromosome X, comple...    24   3.7     
gb:AY650364_1958311 Macaca fascicularis orthodenticle 1 mRNA, pa...    23   3.9     
gb:AE006466_1875651 Homo sapiens 16p13.3 sequence section 5 of 8.      23   4.0     
sp|O88427|CCAH_MOUSE|CCAH_MOUSE Voltage-dependent T-type calcium channel al...    23   4.0     Mus musculus [mouse]
sp|Q9EQ60|CCAH_RAT|CCAH_RAT Voltage-dependent T-type calcium channel alph...    23   4.0     Rattus norvegicus [brown rat]
gb:AF073931_1880955 Homo sapiens low-voltage activated calcium c...    23   4.0     
gb:AF051946_1879195 Homo sapiens T-type calcium channel alpha 1H...    23   4.0     
sp|O95180|CCAH_HUMAN|CCAH_HUMAN Voltage-dependent T-type calcium channel al...    23   4.0     Homo sapiens [man]
gb:HSA420779_2006800 Homo sapiens mRNA for calcium channel, volt...    23   4.0     
gb:AF448777_2495296 Brookesia peyrierasi NADH dehydrogenase subu...    33   4.1     
pir|AD3126|AD3126 ATP-dependent DNA ligase Atu4632 [imported] - ...    33   4.1     Agrobacterium fabrum str. C58
gb:AY119556_1301125 Drosophila melanogaster GH28840 full insert ...    24   4.1     
gb:S81924_2139750 Otx1=homeobox [rats, telencephalon, mRNA Parti...    23   4.6     
gb:HS302G6_1997974 Human DNA sequence from clone LA16c-302G6 on ...    23   4.8     
pir|B30242|B30242 stem cell protein ERA-1-399, retinoic acid-ind...    21   4.8     Mus musculus [mouse]
gb:AB009614_2156692 Leucania separata nuclear polyhedrosis virus...    25   5.2     
gb:BC056760_2102461 Mus musculus cDNA clone MGC:59433 IMAGE:6331...    23   5.2     
gb:AY356530_2084033 Mus musculus CAST1/ERC2 splicing variant-1 m...    23   5.2     
gb:AY356531_2084034 Mus musculus CAST1/ERC2 splicing variant-2 m...    23   5.2     
gb:AY356532_2084035 Mus musculus CAST1/ERC2 splicing variant-3 m...    23   5.2     
gb:AY356533_2084036 Mus musculus CAST1/ERC2 splicing variant-4 m...    23   5.2     
gb:QULCRMIL_2578662 Coturnix coturnix serine/threonine protein k...    33   5.4     
gb:AF449458_2495513 Gallus gallus serine/threonine kinase (RMIL)...    33   5.4     
gb:REIC1MIL_2448653 Avian retrovirus IC10 proviral DNA with v-Rm...    33   5.4     
gb:HUMBRAF_2029656 Homo sapiens B-raf protein (BRAF) mRNA, compl...    33   5.4     
gb:AY803272_1964892 Homo sapiens AKAP9-BRAF fusion protein mRNA,...    33   5.4     
gb:AK130475_1917619 Homo sapiens cDNA FLJ26965 fis, clone SLV01057.    33   5.4     
gb:AC006344_1875134 Homo sapiens PAC clone RP4-726N20 from 7q32-...    33   5.4     
gb:AY156512_1585392 Oryza sativa (japonica cultivar-group) serin...    33   5.4     
gb:AY545218_1431298 Canis familiaris B-raf protein isoform 1 (BR...    33   5.4     
gb:U13646_1401860 Caenorhabditis elegans cosmid ZK783, complete ...    33   5.4     
pir|T08864|T08864 hypothetical protein A_TM017A05.2 - Arabidopsi...    33   5.4     Arabidopsis thaliana [mouse-ear cress]
pir|T34513|T34513 hypothetical protein ZK783.1 - Caenorhabditis ...    33   5.4     Caenorhabditis elegans [roundworm]
pir|D84555|D84555 probable protein kinase [imported] - Arabidops...    33   5.4     Arabidopsis thaliana [mouse-ear cress]
pir|A43095|TVFVMI gag-Rmil-env polyprotein - avian retrovirus IC...    33   5.4     
sp|P10533|RMIL_AVII1|RMIL_AVII1 Serine/threonine-protein kinase transformin...    33   5.4     Avian retrovirus IC10
sp|P27966|RMIL_AVEVR|RMIL_AVEVR Serine/threonine-protein kinase transformin...    33   5.4     Rous-associated virus type 1
sp|P15056|BRAF_HUMAN|BRAF_HUMAN B-Raf proto-oncogene serine/threonine-prote...    33   5.4     Homo sapiens [man]
gb:AK122265_2068930 Mus musculus mRNA for mKIAA0378 protein.           23   5.6     
gb:AB037742_1866533 Homo sapiens mRNA for KIAA1321 protein, part...    25   5.6     
gb:AY232289_1939894 Homo sapiens proliferation-inducing gene 1 m...    25   5.6     
gb:AX405794_1467722 Sequence 209 from Patent WO0222660.                25   5.6     
gb:AF012911_468734 Plasmid pETHIS-1, complete sequence.                21   5.7     
gb:AY313149_1318637 Saccoglossus kowalevskii iroquois (iro) mRNA...    23   5.8     
gb:AF051768_2470747 Xenopus laevis methyl-CpG-binding protein 2 ...    26   5.9     
gb:AH009202S3_1906680 Homo sapiens low-voltage-activated calcium...    23   6.0     
gb:AE014298_1124519 Drosophila melanogaster chromosome X, comple...    23   6.2     
pir|A56235|A56235 transcription activator MafB - chicken>gb:CHKM...    23   6.3     Gallus gallus [bantam]
gb:AY528224_2536339 Danio rerio L-type calcium channel pore subu...    22   6.5     
gb:AB002376_1863683 Human mRNA for KIAA0378 gene, partial cds.         23   6.6     
gb:AY049038_2074540 Rattus norvegicus CAST1 mRNA, complete cds.        23   6.6     
gb:AF541925_2067913 Rattus norvegicus ERC2 mRNA, complete cds; a...    23   6.7     
gb:AY070889_1294974 Drosophila melanogaster LD46223 full length ...    23   6.9     
gb:AE013599_1130572 Drosophila melanogaster chromosome 2R, compl...    23   6.9     
gb:AE013599_1130573 Drosophila melanogaster chromosome 2R, compl...    23   6.9     
gb:AL714030_2504395 Zebrafish DNA sequence from clone BUSM1-223C...    22   6.9     
gb:MUSBRAF_2125295 Mouse B-raf oncogene mRNA, complete cds.            32   7.0     
gb:AF515706_1278683 Schistosoma mansoni Fes-like tyrosine kinase...    32   7.0     
gb:AE014298_1124676 Drosophila melanogaster chromosome X, comple...    23   7.2     
sp|P06719|KNOB_PLAFN|KNOB_PLAFN Knob-associated histidine-rich protein prec...    23   7.2     Plasmodium falciparum
sp|P35405|A2AC_DIDMA|A2AC_DIDMA Alpha-2C adrenergic receptor (Alpha-2C adre...    23   7.4     Didelphis virginiana [Virginia opossum]
gb:CEW04A8_1368883 Caenorhabditis elegans cosmid W04A8, complete...    23   7.6     
gb:AE017349_1758732 Cryptococcus neoformans var. neoformans JEC2...    22   7.6     
gb:AY029294_2508637 Xenopus laevis transcription factor Otx1 (Ot...    23   7.8     
gb:AF160197_1773276 Glycine max Ni-binding urease accessory prot...    23   8.1     
gb:AF052857_1764394 Dicentra eximia PISTILLATA homolog DePI-1 mR...    23   8.5     
pir|T26141|T26141 hypothetical protein W04A8.7 - Caenorhabditis ...    23   9.1     Caenorhabditis elegans [roundworm]
gb:AB115749_2465846 Seriola quinqueradiata BRAF mRNA for serine/...    32   9.2     
gb:BT003433_1356835 Drosophila melanogaster SD04308 full insert ...    24   9.2     
gb:AB122025_2466109 Danio rerio mRNA for Pou4f2/Brn-3b, complete...    23   9.6     
gb:BC056326_2551766 Danio rerio POU domain, class 4, transcripti...    23   9.7     
gb:AB188114_2467191 Danio rerio brn3a mRNA for brain-specific ho...    23   9.7     
gb:SCU52347_1397355 Stomoxys calcitrans putative tachykinin-like...    22   9.8     
gb:AY196177_2518329 Danio rerio POU domain transcription factor ...    23   10.0    
gb:AF169823_2207369 Spodoptera exigua nucleopolyhedrovirus compl...    25   10.0    


>gb:AC123513_1192410 Dictyostelium discoideum strain AX4 chromosome
           2 map 2779865-2840915, *** SEQUENCING IN PROGRESS
           ***.>gb:AC117070_1207608 Dictyostelium discoideum
           chromosome 2 map 2097701-2233941 strain AX4, complete
           sequence.
          Length = 233

 Score = 21.9 bits (45), Expect(40) = 2e-25
 Identities = 7/21 (33%), Positives = 12/21 (57%)
 Frame = -1

Query: 340 PHHHQHLFSNPYLLNQSNNPH 278
           PHHH H   +P+  +  ++ H
Sbjct: 100 PHHHPHHHHHPHHHHHHHHHH 120



 Score = 21.6 bits (44), Expect(19) = 6e-10
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 167 LRTYHHHHH 141
           L  +HHHHH
Sbjct: 70  LHHHHHHHH 78



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 149 HHHHHH 154



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 148 HHHHHH 153



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 147 HHHHHH 152



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 146 HHHHHH 151



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 145 HHHHHH 150



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 144 HHHHHH 149



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 143 HHHHHH 148



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 142 HHHHHH 147



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 141 HHHHHH 146



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 140 HHHHHH 145



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 139 HHHHHH 144



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 138 HHHHHH 143



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 137 HHHHHH 142



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 136 HHHHHH 141



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 135 HHHHHH 140



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 134 HHHHHH 139



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 133 HHHHHH 138



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 132 HHHHHH 137



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 131 HHHHHH 136



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 130 HHHHHH 135



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 129 HHHHHH 134



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 128 HHHHHH 133



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 127 HHHHHH 132



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 126 HHHHHH 131



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 125 HHHHHH 130



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 124 HHHHHH 129



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 123 HHHHHH 128



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 122 HHHHHH 127



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 121 HHHHHH 126



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 120 HHHHHH 125



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 119 HHHHHH 124



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 118 HHHHHH 123



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 117 HHHHHH 122



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 116 HHHHHH 121



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 115 HHHHHH 120



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 114 HHHHHH 119



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 113 HHHHHH 118



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 112 HHHHHH 117



 Score = 20.8 bits (42), Expect(40) = 2e-25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 111 HHHHHH 116



 Score = 20.8 bits (42), Expect(19) = 6e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 91  HHHHHH 96



 Score = 20.8 bits (42), Expect(19) = 6e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 90  HHHHHH 95



 Score = 20.8 bits (42), Expect(19) = 6e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 89  HHHHHH 94



 Score = 20.8 bits (42), Expect(19) = 6e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 88  HHHHHH 93



 Score = 20.8 bits (42), Expect(19) = 6e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 87  HHHHHH 92



 Score = 20.8 bits (42), Expect(19) = 6e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 86  HHHHHH 91



 Score = 20.8 bits (42), Expect(19) = 6e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 85  HHHHHH 90



 Score = 20.8 bits (42), Expect(19) = 6e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 84  HHHHHH 89



 Score = 20.8 bits (42), Expect(19) = 6e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 83  HHHHHH 88



 Score = 20.8 bits (42), Expect(19) = 6e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 82  HHHHHH 87



 Score = 20.8 bits (42), Expect(19) = 6e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 81  HHHHHH 86



 Score = 20.8 bits (42), Expect(19) = 6e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 80  HHHHHH 85



 Score = 20.8 bits (42), Expect(19) = 6e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 79  HHHHHH 84



 Score = 20.8 bits (42), Expect(19) = 6e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 78  HHHHHH 83



 Score = 20.8 bits (42), Expect(19) = 6e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 77  HHHHHH 82



 Score = 20.8 bits (42), Expect(19) = 6e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 76  HHHHHH 81



 Score = 20.8 bits (42), Expect(19) = 6e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 75  HHHHHH 80



 Score = 20.8 bits (42), Expect(19) = 6e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 74  HHHHHH 79



>gb:AB022223_1515175 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MWI23.>gb:AY035004_1559783 Arabidopsis
           thaliana unknown protein (At3g22750) mRNA, complete
           cds.>gb:AY063013_1565597 Arabidopsis thaliana unknown
           protein (At3g22750) mRNA, complete cds.
          Length = 378

 Score =  101 bits (251), Expect = 1e-20
 Identities = 48/71 (67%), Positives = 59/71 (83%)
 Frame = +1

Query: 430 GKSPSKDMIFRADKIDLKSLDVQLEKHLSRVWSRSVEHQVQRPKEDWEIDPLKLEIRYLI 609
           G +  KDMIFRADKIDLK+LD+QLEKHLSRVWSRS+E    +PKE+WEI+  KLE+R +I
Sbjct: 22  GNNSKKDMIFRADKIDLKNLDIQLEKHLSRVWSRSIEKH-PKPKEEWEIELAKLEMRNVI 80

Query: 610 AQGTYGTVYRG 642
           A+G YG VY+G
Sbjct: 81  ARGAYGIVYKG 91



>pir|G71410|G71410 probable protein kinase - Arabidopsis
           thaliana>gb:ATCHRIV39_1545242 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 39.>gb:ATFCA2_1551528
           Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
           fragment No. 2.>gb:BT006041_1638935 Arabidopsis thaliana
           clone U50806 putative kinase (At4g14780) mRNA, complete
           cds.>gb:AK118177_1816169 Arabidopsis thaliana At4g14780
           mRNA for kinase like protein, complete cds, clone:
           RAFL19-49-L08.
          Length = 364

 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 47/71 (66%), Positives = 57/71 (80%)
 Frame = +1

Query: 430 GKSPSKDMIFRADKIDLKSLDVQLEKHLSRVWSRSVEHQVQRPKEDWEIDPLKLEIRYLI 609
           G + +K+ IFRADKIDLKSLD QLEKHLSRVWSR++E    + KE+WEID  KLE   +I
Sbjct: 9   GNNTTKEKIFRADKIDLKSLDRQLEKHLSRVWSRNLEVN-PKAKEEWEIDLAKLETSNVI 67

Query: 610 AQGTYGTVYRG 642
           A+GTYGTVY+G
Sbjct: 68  ARGTYGTVYKG 78



>gb:AC120505_1739743 Oryza sativa chromosome 3 BAC OSJNBa0066H15
           genomic sequence, complete sequence.>gb:AC128646_1740576
           Oryza sativa chromosome 3 BAC OSJNBb0029I19 genomic
           sequence, complete sequence.
          Length = 379

 Score = 91.3 bits (225), Expect = 1e-17
 Identities = 51/92 (55%), Positives = 60/92 (65%)
 Frame = +1

Query: 367 PEGELGSKLKGPGSISDGNMAGKSPSKDMIFRADKIDLKSLDVQLEKHLSRVWSRSVEHQ 546
           PEG    KLK  GS+   + A          RADKIDL SLD+QLEK L++ W ++   +
Sbjct: 9   PEGR--EKLKRSGSLGSSDTA--------YVRADKIDLTSLDIQLEKQLTKTWGKA-NLK 57

Query: 547 VQRPKEDWEIDPLKLEIRYLIAQGTYGTVYRG 642
              PKEDWEID  KLEIRY+IAQGTYGTVYRG
Sbjct: 58  AHGPKEDWEIDLAKLEIRYVIAQGTYGTVYRG 89



>gb:AC098571_1736752 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1126_B10, complete sequence.
          Length = 381

 Score = 68.6 bits (166), Expect = 9e-11
 Identities = 37/83 (44%), Positives = 51/83 (61%), Gaps = 22/83 (26%)
 Frame = +1

Query: 460 RADKIDLKSLDVQLEKHLSRVWSR-------SVEHQVQRP---------------KEDWE 573
           RAD+IDLKSLD QLE+HLSR W+        + + +  +P               +E+WE
Sbjct: 12  RADQIDLKSLDEQLERHLSRAWTMEKRKEEAAADQRGSKPPALAAAHYSQNRRQRREEWE 71

Query: 574 IDPLKLEIRYLIAQGTYGTVYRG 642
           IDP KL +R +IA+GT+GTV+RG
Sbjct: 72  IDPAKLVVRGVIARGTFGTVHRG 94



>gb:AY224453_1590655 Oryza sativa (japonica cultivar-group) isolate
           23379 putative protein kinase mRNA, complete cds.
          Length = 382

 Score = 68.6 bits (166), Expect = 9e-11
 Identities = 37/83 (44%), Positives = 51/83 (61%), Gaps = 22/83 (26%)
 Frame = +1

Query: 460 RADKIDLKSLDVQLEKHLSRVWSR-------SVEHQVQRP---------------KEDWE 573
           RAD+IDLKSLD QLE+HLSR W+        + + +  +P               +E+WE
Sbjct: 12  RADQIDLKSLDEQLERHLSRAWTMEERKEEAAADQRGSKPPALAAAHYSQNRRQRREEWE 71

Query: 574 IDPLKLEIRYLIAQGTYGTVYRG 642
           IDP KL +R +IA+GT+GTV+RG
Sbjct: 72  IDPAKLVVRGVIARGTFGTVHRG 94



>gb:AC087852_1734226 Oryza sativa chromosome 3 BAC OJ1124_H03
           genomic sequence, complete sequence.
          Length = 407

 Score = 68.2 bits (165), Expect = 1e-10
 Identities = 39/96 (40%), Positives = 54/96 (56%), Gaps = 3/96 (3%)
 Frame = +1

Query: 364 HPEGELGSKLKGPGSISDGNMAGKSPSKDMIFRADKIDLKSLDVQLEKHLSRVW---SRS 534
           H    + S     G+ +  ++  ++   +M  RADKIDLK+LDVQ EK  S+VW    RS
Sbjct: 13  HSFSGISSAAATGGAGAGADVFVRAADNEMYVRADKIDLKNLDVQFEKTRSKVWLEQHRS 72

Query: 535 VEHQVQRPKEDWEIDPLKLEIRYLIAQGTYGTVYRG 642
                  P  +WEID  KL+I+  +A GT+G VYRG
Sbjct: 73  SSAASPLPLLEWEIDLAKLDIQNQVAHGTFGVVYRG 108



>gb:AP003855_1834345 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0039G05.
          Length = 388

 Score = 66.6 bits (161), Expect = 3e-10
 Identities = 39/85 (45%), Positives = 47/85 (55%), Gaps = 24/85 (28%)
 Frame = +1

Query: 460 RADKIDLKSLDVQLEKHLSRVWSRSVEHQV------------------------QRPKED 567
           RAD+IDLKSLD QLE+HL R   R+                             QR +ED
Sbjct: 17  RADQIDLKSLDEQLERHLGRPAERAASQHGGSGSRRGESARLGLGEEPPQAPHHQRRRED 76

Query: 568 WEIDPLKLEIRYLIAQGTYGTVYRG 642
           WEIDP KL IR +IA+GT+GTV+RG
Sbjct: 77  WEIDPAKLVIRGVIARGTFGTVHRG 101



>sp|P04929|HRPX_PLALO Histidine-rich glycoprotein
           precursor.>pir|A22692|KGZQHL histidine-rich glycoprotein
           precursor - Plasmodium lophurae>gb:PLHRP1_1395337
           Plasmodium gene fragment for histidine-rich protein.
          Length = 351

 Score = 22.7 bits (47), Expect(4) = 6.1
 Identities = 8/22 (36%), Positives = 12/22 (54%)
 Frame = -1

Query: 343 APHHHQHLFSNPYLLNQSNNPH 278
           APHHH H    P+  +  ++ H
Sbjct: 203 APHHHHHHHHAPHHHHHHHHGH 224



 Score = 21.9 bits (45), Expect(4) = 6.1
 Identities = 6/10 (60%), Positives = 7/10 (70%)
 Frame = -3

Query: 170 DLRTYHHHHH 141
           D   +HHHHH
Sbjct: 263 DAHHHHHHHH 272



 Score = 21.9 bits (45), Expect(10) = 3e-04
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 167 LRTYHHHHHQRE 132
           L   HHHHH  E
Sbjct: 57  LHEEHHHHHPEE 68



 Score = 21.6 bits (44), Expect(4) = 6.1
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 334 HHHHHHHHD 342



 Score = 21.6 bits (44), Expect(4) = 6.1
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 295 HHHHHHHHD 303



 Score = 21.6 bits (44), Expect(10) = 3e-04
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 275 HHHHHHHHD 283



 Score = 21.6 bits (44), Expect(10) = 3e-04
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 265 HHHHHHHHD 273



 Score = 21.6 bits (44), Expect(10) = 3e-04
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 245 HHHHHHHHD 253



 Score = 21.6 bits (44), Expect(10) = 3e-04
 Identities = 6/8 (75%), Positives = 6/8 (75%)
 Frame = -3

Query: 155 HHHHHQRE 132
           HHHHH  E
Sbjct: 77  HHHHHPEE 84



 Score = 20.8 bits (42), Expect(19) = 8e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 244 HHHHHH 249



 Score = 20.8 bits (42), Expect(19) = 8e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 237 HHHHHH 242



 Score = 20.8 bits (42), Expect(19) = 8e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 236 HHHHHH 241



 Score = 20.8 bits (42), Expect(19) = 8e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 235 HHHHHH 240



 Score = 20.8 bits (42), Expect(19) = 8e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 234 HHHHHH 239



 Score = 20.8 bits (42), Expect(19) = 8e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 227 HHHHHH 232



 Score = 20.8 bits (42), Expect(19) = 8e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 226 HHHHHH 231



 Score = 20.8 bits (42), Expect(19) = 8e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 225 HHHHHH 230



 Score = 20.8 bits (42), Expect(19) = 8e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 224 HHHHHH 229



 Score = 20.8 bits (42), Expect(10) = 3e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 217 HHHHHH 222



 Score = 20.8 bits (42), Expect(19) = 8e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 216 HHHHHH 221



 Score = 20.8 bits (42), Expect(19) = 8e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 215 HHHHHH 220



 Score = 20.8 bits (42), Expect(19) = 8e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 207 HHHHHH 212



 Score = 20.8 bits (42), Expect(19) = 8e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 206 HHHHHH 211



 Score = 20.8 bits (42), Expect(19) = 8e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 205 HHHHHH 210



 Score = 20.8 bits (42), Expect(6) = 3.1
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 197 HHHHHH 202



 Score = 20.8 bits (42), Expect(6) = 3.1
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 196 HHHHHH 201



 Score = 20.8 bits (42), Expect(6) = 3.1
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 195 HHHHHH 200



 Score = 20.8 bits (42), Expect(6) = 3.1
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 185 HHHHHH 190



 Score = 20.8 bits (42), Expect(19) = 8e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 177 HHHHHH 182



 Score = 20.8 bits (42), Expect(10) = 3e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 176 HHHHHH 181



 Score = 20.8 bits (42), Expect(10) = 3e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 175 HHHHHH 180



 Score = 20.8 bits (42), Expect(10) = 3e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 148 HHHHHH 153



 Score = 20.8 bits (42), Expect(6) = 3.1
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 155 HHHHHQ 138
           HHHHH+
Sbjct: 141 HHHHHE 146



 Score = 20.8 bits (42), Expect(19) = 8e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 133 HHHHHH 138



 Score = 20.8 bits (42), Expect(19) = 8e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 155 HHHHHQ 138
           HHHHH+
Sbjct: 126 HHHHHE 131



 Score = 20.8 bits (42), Expect(10) = 3e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 118 HHHHHH 123



 Score = 20.8 bits (42), Expect(6) = 3.1
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 117 HHHHHH 122



 Score = 20.8 bits (42), Expect(19) = 8e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 102 HHHHHH 107



 Score = 20.8 bits (42), Expect(19) = 8e-10
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 101 HHHHHH 106



>gb:AY085263_1570335 Arabidopsis thaliana clone 142106 mRNA,
           complete sequence.
          Length = 385

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 38/97 (39%), Positives = 52/97 (53%), Gaps = 31/97 (31%)
 Frame = +1

Query: 445 KDMIFRADKIDLKSLDVQLEKHLSRVWSRSVEHQVQRPKED------------------- 567
           KD   RAD+IDLKSLD QLE+HLSR  + ++E   ++ +ED                   
Sbjct: 5   KDGFVRADQIDLKSLDEQLERHLSR--ALTLEKNKKKDEEDTTAVAIGGSASSSPVTLNG 62

Query: 568 ------------WEIDPLKLEIRYLIAQGTYGTVYRG 642
                       WEIDP KL I+ ++A+GT+GTV+RG
Sbjct: 63  GGFVGKRKQRLEWEIDPSKLIIKTVLARGTFGTVHRG 99



>gb:AB026650_1517245 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MPF21.
          Length = 385

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 38/97 (39%), Positives = 52/97 (53%), Gaps = 31/97 (31%)
 Frame = +1

Query: 445 KDMIFRADKIDLKSLDVQLEKHLSRVWSRSVEHQVQRPKED------------------- 567
           KD   RAD+IDLKSLD QLE+HLSR  + ++E   ++ +ED                   
Sbjct: 5   KDGFVRADQIDLKSLDEQLERHLSR--ALTLEKNKKKDEEDTTAVAIGGSASSSPVTLNG 62

Query: 568 ------------WEIDPLKLEIRYLIAQGTYGTVYRG 642
                       WEIDP KL I+ ++A+GT+GTV+RG
Sbjct: 63  GGFVGKRKQRLEWEIDPSKLIIKTVLARGTFGTVHRG 99



>gb:AY086480_1571528 Arabidopsis thaliana clone 253505 mRNA,
           complete sequence.
          Length = 391

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 38/106 (35%), Positives = 54/106 (50%), Gaps = 2/106 (1%)
 Frame = +1

Query: 331 GGEVPKGDYSGHPEGELGSKLKGPGSISDGNMAGKSPSKDMIFRADKIDLKSLDVQL-EK 507
           GGE  K    G   G    K+ G GS S G        ++  FRAD +D    D+ + + 
Sbjct: 5   GGEADKSLEIG--SGTADPKIGGTGSRSAG--------EERYFRADTLDFSKWDLHMGQT 54

Query: 508 HLSRVWSRSVEHQVQRPK-EDWEIDPLKLEIRYLIAQGTYGTVYRG 642
             S V + S       P  ++WEID  KL++++++A GTYGTVYRG
Sbjct: 55  STSSVLTNSASTSAPAPAMQEWEIDLSKLDMKHVLAHGTYGTVYRG 100



>pir|T48115|T48115 protein kinase ATMRK1 (EC 2.7.1.-) [imported] -
           Arabidopsis thaliana>gb:AB006810_1510078 Arabidopsis
           thaliana mRNA for ATMRK1, complete
           cds.>gb:ATF16M2_1548851 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F16M2.>gb:AY080717_1568439
           Arabidopsis thaliana putative ATMRK1 protein (At3g63260)
           mRNA, complete cds.>gb:AY117337_1579378 Arabidopsis
           thaliana putative ATMRK1 protein (At3g63260) mRNA,
           complete cds.
          Length = 391

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 38/106 (35%), Positives = 54/106 (50%), Gaps = 2/106 (1%)
 Frame = +1

Query: 331 GGEVPKGDYSGHPEGELGSKLKGPGSISDGNMAGKSPSKDMIFRADKIDLKSLDVQL-EK 507
           GGE  K    G   G    K+ G GS S G        ++  FRAD +D    D+ + + 
Sbjct: 5   GGEADKSLEIG--SGTADPKIGGTGSRSAG--------EERYFRADTLDFSKWDLHMGQT 54

Query: 508 HLSRVWSRSVEHQVQRPK-EDWEIDPLKLEIRYLIAQGTYGTVYRG 642
             S V + S       P  ++WEID  KL++++++A GTYGTVYRG
Sbjct: 55  STSSVLTNSASTSAPAPAMQEWEIDLSKLDMKHVLAHGTYGTVYRG 100



>gb:ATAC009325_1542880 Arabidopsis thaliana chromosome III BAC F4P13
           genomic sequence, complete sequence.>gb:AY057647_1564060
           Arabidopsis thaliana AT3g01490/F4P13_4 mRNA, complete
           cds.>gb:AY136392_1581893 Arabidopsis thaliana putative
           protein kinase (At3g01490) mRNA, complete
           cds.>gb:BT000206_1634484 Arabidopsis thaliana putative
           protein kinase (At3g01490) mRNA, complete cds.
          Length = 411

 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 35/111 (31%), Positives = 51/111 (45%), Gaps = 50/111 (45%)
 Frame = +1

Query: 460 RADKIDLKSLDVQLEKHLSRVWS--------------RSVEH------------------ 543
           RAD+IDLKSLD QL++HLS+ W+               +  H                  
Sbjct: 15  RADQIDLKSLDEQLQRHLSKAWTMEKRKSLSDGEDNVNNTRHNQNNFGHRQLVFQRPLLG 74

Query: 544 ------------------QVQRPKEDWEIDPLKLEIRYLIAQGTYGTVYRG 642
                             +V++ + +WEIDP KL I+ +IA+GT+GTV+RG
Sbjct: 75  GGYSNNNNSSKNDIIRSTEVEKSRREWEIDPSKLIIKSVIARGTFGTVHRG 125



>gb:ATAC011708_1543394 Arabidopsis thaliana chromosome III BAC T7M13
           genomic sequence, complete sequence.
          Length = 684

 Score = 23.5 bits (49), Expect(13) = 4e-06
 Identities = 12/42 (28%), Positives = 16/42 (38%)
 Frame = -3

Query: 158 YHHHHHQREVISMILNVQKIFKNKKPEK*TKEVPIPTRACFP 33
           +HHHHH      M   V  +  +  P +  K  P     C P
Sbjct: 537 HHHHHHHNLSPKMAPEVSPV-ASPAPHRSRKRAPSAPPPCNP 577



 Score = 20.8 bits (42), Expect(13) = 4e-06
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 530 HHHHHH 535



 Score = 20.8 bits (42), Expect(13) = 4e-06
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 529 HHHHHH 534



 Score = 20.8 bits (42), Expect(13) = 4e-06
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 528 HHHHHH 533



 Score = 20.8 bits (42), Expect(13) = 4e-06
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 527 HHHHHH 532



 Score = 20.8 bits (42), Expect(13) = 4e-06
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 526 HHHHHH 531



 Score = 20.8 bits (42), Expect(13) = 4e-06
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 525 HHHHHH 530



 Score = 20.8 bits (42), Expect(13) = 4e-06
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 524 HHHHHH 529



 Score = 20.8 bits (42), Expect(13) = 4e-06
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 523 HHHHHH 528



 Score = 20.8 bits (42), Expect(13) = 4e-06
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 522 HHHHHH 527



 Score = 20.8 bits (42), Expect(13) = 4e-06
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 521 HHHHHH 526



 Score = 20.8 bits (42), Expect(13) = 4e-06
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 520 HHHHHH 525



 Score = 20.8 bits (42), Expect(13) = 4e-06
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 519 HHHHHH 524



>gb:AX647437_1472344 Sequence 1629 from Patent EP1270724.
          Length = 523

 Score = 22.7 bits (47), Expect(11) = 9e-05
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           YHHHHH
Sbjct: 473 YHHHHH 478



 Score = 21.9 bits (45), Expect(11) = 9e-05
 Identities = 7/14 (50%), Positives = 9/14 (64%)
 Frame = -3

Query: 182 LIRKDLRTYHHHHH 141
           +I  D   +HHHHH
Sbjct: 467 IIITDYYHHHHHHH 480



 Score = 20.8 bits (42), Expect(11) = 9e-05
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 484 HHHHHH 489



 Score = 20.8 bits (42), Expect(11) = 9e-05
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 483 HHHHHH 488



 Score = 20.8 bits (42), Expect(11) = 9e-05
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 482 HHHHHH 487



 Score = 20.8 bits (42), Expect(11) = 9e-05
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 481 HHHHHH 486



 Score = 20.8 bits (42), Expect(11) = 9e-05
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 480 HHHHHH 485



 Score = 20.8 bits (42), Expect(11) = 9e-05
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 479 HHHHHH 484



 Score = 20.8 bits (42), Expect(11) = 9e-05
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 478 HHHHHH 483



 Score = 20.8 bits (42), Expect(11) = 9e-05
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 477 HHHHHH 482



 Score = 20.8 bits (42), Expect(11) = 9e-05
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 476 HHHHHH 481



>gb:AY209187_1309958 Trypanosoma cruzi RNA-binding protein 6 (rbp-6)
           mRNA, complete cds.
          Length = 239

 Score = 20.8 bits (42), Expect(12) = 1e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 61  HHHHHH 66



 Score = 20.8 bits (42), Expect(12) = 1e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 60  HHHHHH 65



 Score = 20.8 bits (42), Expect(12) = 1e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 59  HHHHHH 64



 Score = 20.8 bits (42), Expect(12) = 1e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 58  HHHHHH 63



 Score = 20.8 bits (42), Expect(12) = 1e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 57  HHHHHH 62



 Score = 20.8 bits (42), Expect(12) = 1e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 56  HHHHHH 61



 Score = 20.8 bits (42), Expect(12) = 1e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 55  HHHHHH 60



 Score = 20.8 bits (42), Expect(12) = 1e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 54  HHHHHH 59



 Score = 20.8 bits (42), Expect(12) = 1e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 53  HHHHHH 58



 Score = 20.8 bits (42), Expect(12) = 1e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 52  HHHHHH 57



 Score = 20.8 bits (42), Expect(12) = 1e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 51  HHHHHH 56



 Score = 20.8 bits (42), Expect(12) = 1e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 50  HHHHHH 55



>gb:PFAHRPA_1393792 P.lophurae histidine-rich protein mRNA, 3' end.
          Length = 140

 Score = 21.6 bits (44), Expect(9) = 0.013
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 84  HHHHHHHHD 92



 Score = 21.2 bits (43), Expect(11) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 75  FHHHHH 80



 Score = 21.2 bits (43), Expect(11) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 66  FHHHHH 71



 Score = 21.2 bits (43), Expect(9) = 0.013
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 57  FHHHHH 62



 Score = 20.8 bits (42), Expect(9) = 0.013
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 95  HHHHHH 100



 Score = 20.8 bits (42), Expect(9) = 0.013
 Identities = 5/8 (62%), Positives = 6/8 (75%)
 Frame = -3

Query: 155 HHHHHQRE 132
           HHHHH  +
Sbjct: 94  HHHHHHHD 101



 Score = 20.8 bits (42), Expect(9) = 0.013
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 94  HHHHHH 99



 Score = 20.8 bits (42), Expect(11) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 76  HHHHHH 81



 Score = 20.8 bits (42), Expect(11) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 67  HHHHHH 72



 Score = 20.8 bits (42), Expect(9) = 0.013
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 58  HHHHHH 63



 Score = 20.8 bits (42), Expect(9) = 0.013
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 49  HHHHHH 54



 Score = 20.8 bits (42), Expect(11) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 41  HHHHHH 46



 Score = 20.8 bits (42), Expect(11) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 40  HHHHHH 45



 Score = 20.8 bits (42), Expect(11) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 39  HHHHHH 44



 Score = 20.8 bits (42), Expect(11) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 31  HHHHHH 36



 Score = 20.8 bits (42), Expect(11) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 30  HHHHHH 35



 Score = 20.8 bits (42), Expect(11) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 11  HHHHHH 16



 Score = 20.8 bits (42), Expect(11) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 10  HHHHHH 15



 Score = 20.8 bits (42), Expect(9) = 0.013
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 9   HHHHHH 14



 Score = 20.8 bits (42), Expect(9) = 0.013
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 1   HHHHHH 6



>pir|A54523|A54523 histidine-rich protein - Plasmodium lophurae
           (fragment)
          Length = 140

 Score = 21.6 bits (44), Expect(9) = 0.013
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 84  HHHHHHHHD 92



 Score = 21.2 bits (43), Expect(11) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 75  FHHHHH 80



 Score = 21.2 bits (43), Expect(11) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 66  FHHHHH 71



 Score = 21.2 bits (43), Expect(9) = 0.013
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 57  FHHHHH 62



 Score = 20.8 bits (42), Expect(9) = 0.013
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 95  HHHHHH 100



 Score = 20.8 bits (42), Expect(9) = 0.013
 Identities = 5/8 (62%), Positives = 6/8 (75%)
 Frame = -3

Query: 155 HHHHHQRE 132
           HHHHH  +
Sbjct: 94  HHHHHHHD 101



 Score = 20.8 bits (42), Expect(9) = 0.013
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 94  HHHHHH 99



 Score = 20.8 bits (42), Expect(11) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 76  HHHHHH 81



 Score = 20.8 bits (42), Expect(11) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 67  HHHHHH 72



 Score = 20.8 bits (42), Expect(9) = 0.013
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 58  HHHHHH 63



 Score = 20.8 bits (42), Expect(9) = 0.013
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 49  HHHHHH 54



 Score = 20.8 bits (42), Expect(11) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 41  HHHHHH 46



 Score = 20.8 bits (42), Expect(11) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 40  HHHHHH 45



 Score = 20.8 bits (42), Expect(11) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 39  HHHHHH 44



 Score = 20.8 bits (42), Expect(11) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 31  HHHHHH 36



 Score = 20.8 bits (42), Expect(11) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 30  HHHHHH 35



 Score = 20.8 bits (42), Expect(11) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 11  HHHHHH 16



 Score = 20.8 bits (42), Expect(11) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 10  HHHHHH 15



 Score = 20.8 bits (42), Expect(9) = 0.013
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 9   HHHHHH 14



 Score = 20.8 bits (42), Expect(9) = 0.013
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 1   HHHHHH 6



>gb:AK131456_1917990 Homo sapiens cDNA FLJ16611 fis, clone
           TESTI4011829.
          Length = 762

 Score = 22.7 bits (47), Expect(10) = 6e-04
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 158 YHHHHHQR 135
           +HHHHH R
Sbjct: 255 HHHHHHHR 262



 Score = 21.6 bits (44), Expect(10) = 6e-04
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH+ +
Sbjct: 256 HHHHHHRAQ 264



 Score = 20.8 bits (42), Expect(10) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 254 HHHHHH 259



 Score = 20.8 bits (42), Expect(10) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 253 HHHHHH 258



 Score = 20.8 bits (42), Expect(10) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 252 HHHHHH 257



 Score = 20.8 bits (42), Expect(10) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 251 HHHHHH 256



 Score = 20.8 bits (42), Expect(10) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 250 HHHHHH 255



 Score = 20.8 bits (42), Expect(10) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 249 HHHHHH 254



 Score = 20.8 bits (42), Expect(10) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 248 HHHHHH 253



 Score = 20.8 bits (42), Expect(10) = 6e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 247 HHHHHH 252



>sp|P51179|NR43_RAT Orphan nuclear receptor NR4A3 (Nuclear hormone
           receptor NOR-1/NOR-2) (Neuron-derived orphan receptor
           1/2).>pir|JC2493|JC2493 neuron derived orphan receptor-1
           - rat>gb:RATNOR1_2133161 Rattus norvegicus mRNA for
           NOR-1, complete cds.
          Length = 628

 Score = 23.9 bits (50), Expect(9) = 9e-04
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 107 HHHHHHQQQ 115



 Score = 22.7 bits (47), Expect(9) = 9e-04
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           YHHHHH
Sbjct: 98  YHHHHH 103



 Score = 20.8 bits (42), Expect(9) = 9e-04
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHH Q++
Sbjct: 108 HHHHHQQQQ 116



 Score = 20.8 bits (42), Expect(9) = 9e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 104 HHHHHH 109



 Score = 20.8 bits (42), Expect(9) = 9e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 103 HHHHHH 108



 Score = 20.8 bits (42), Expect(9) = 9e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 102 HHHHHH 107



 Score = 20.8 bits (42), Expect(9) = 9e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 101 HHHHHH 106



 Score = 20.8 bits (42), Expect(9) = 9e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 100 HHHHHH 105



 Score = 20.8 bits (42), Expect(9) = 9e-04
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 99  HHHHHH 104



>pir|S66671|S66671 neuron-derived receptor NOR-2 -
           rat>gb:RNRNALRBF_2136338 R.norvegicus mRNA for
           neuron-derived orphan receptor-2.
          Length = 430

 Score = 23.9 bits (50), Expect(9) = 0.001
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 107 HHHHHHQQQ 115



 Score = 22.7 bits (47), Expect(9) = 0.001
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           YHHHHH
Sbjct: 98  YHHHHH 103



 Score = 20.8 bits (42), Expect(9) = 0.001
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHH Q++
Sbjct: 108 HHHHHQQQQ 116



 Score = 20.8 bits (42), Expect(9) = 0.001
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 104 HHHHHH 109



 Score = 20.8 bits (42), Expect(9) = 0.001
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 103 HHHHHH 108



 Score = 20.8 bits (42), Expect(9) = 0.001
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 102 HHHHHH 107



 Score = 20.8 bits (42), Expect(9) = 0.001
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 101 HHHHHH 106



 Score = 20.8 bits (42), Expect(9) = 0.001
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 100 HHHHHH 105



 Score = 20.8 bits (42), Expect(9) = 0.001
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 99  HHHHHH 104



>gb:S81243_2041981 CHN=steroid/thyroid orphan receptor homolog gene
           [human, fetal brain, mRNA Partial, 2714 nt].
          Length = 684

 Score = 23.9 bits (50), Expect(8) = 0.004
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 161 HHHHHHQQQ 169



 Score = 23.1 bits (48), Expect(8) = 0.004
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           +YHHHHH
Sbjct: 151 SYHHHHH 157



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 158 HHHHHH 163



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 157 HHHHHH 162



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 156 HHHHHH 161



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 155 HHHHHH 160



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 154 HHHHHH 159



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 153 HHHHHH 158



>gb:D78579_1994890 Homo sapiens NOR-1 mRNA for neuron derived orphan
           receptor, complete cds.
          Length = 626

 Score = 23.9 bits (50), Expect(8) = 0.004
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 103 HHHHHHQQQ 111



 Score = 23.1 bits (48), Expect(8) = 0.004
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           +YHHHHH
Sbjct: 93  SYHHHHH 99



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 100 HHHHHH 105



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 99  HHHHHH 104



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 98  HHHHHH 103



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 97  HHHHHH 102



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 96  HHHHHH 101



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 95  HHHHHH 100



>sp|Q92570|NR43_HUMAN Orphan nuclear receptor NR4A3 (Nuclear hormone
           receptor NOR-1) (Neuron-derived orphan receptor 1)
           (Mitogen induced nuclear orphan receptor).
          Length = 626

 Score = 23.9 bits (50), Expect(8) = 0.004
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 103 HHHHHHQQQ 111



 Score = 23.1 bits (48), Expect(8) = 0.004
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           +YHHHHH
Sbjct: 93  SYHHHHH 99



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 100 HHHHHH 105



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 99  HHHHHH 104



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 98  HHHHHH 103



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 97  HHHHHH 102



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 96  HHHHHH 101



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 95  HHHHHH 100



>pir|S71930|S71930 neuron-derived receptor NOR-1 - human
          Length = 625

 Score = 23.9 bits (50), Expect(8) = 0.004
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 103 HHHHHHQQQ 111



 Score = 23.1 bits (48), Expect(8) = 0.004
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           +YHHHHH
Sbjct: 93  SYHHHHH 99



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 100 HHHHHH 105



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 99  HHHHHH 104



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 98  HHHHHH 103



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 97  HHHHHH 102



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 96  HHHHHH 101



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 95  HHHHHH 100



>gb:HSU12767_2022202 Human mitogen induced nuclear orphan receptor
           (MINOR) mRNA, complete cds.
          Length = 587

 Score = 23.9 bits (50), Expect(8) = 0.004
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 64  HHHHHHQQQ 72



 Score = 23.1 bits (48), Expect(8) = 0.004
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           +YHHHHH
Sbjct: 54  SYHHHHH 60



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 61  HHHHHH 66



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 60  HHHHHH 65



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 59  HHHHHH 64



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 58  HHHHHH 63



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 57  HHHHHH 62



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 56  HHHHHH 61



>gb:HSNUCREC_2019234 H.sapiens mRNA for nuclear receptor.
          Length = 443

 Score = 23.9 bits (50), Expect(8) = 0.004
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 103 HHHHHHQQQ 111



 Score = 23.1 bits (48), Expect(8) = 0.004
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           +YHHHHH
Sbjct: 93  SYHHHHH 99



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 100 HHHHHH 105



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 99  HHHHHH 104



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 98  HHHHHH 103



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 97  HHHHHH 102



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 96  HHHHHH 101



 Score = 20.8 bits (42), Expect(8) = 0.004
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 95  HHHHHH 100



>sp|Q9QZB6|NR43_MOUSE Orphan nuclear receptor NR4A3 (Orphan nuclear
           receptor TEC) (Translocated in extraskeletal
           chondrosarcoma).>gb:AF191211_2058507 Mus musculus orphan
           nuclear receptor TEC long isoform (Tec) mRNA, complete
           cds.
          Length = 627

 Score = 23.9 bits (50), Expect(8) = 0.005
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 106 HHHHHHQQQ 114



 Score = 22.7 bits (47), Expect(8) = 0.005
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           YHHHHH
Sbjct: 98  YHHHHH 103



 Score = 20.8 bits (42), Expect(8) = 0.005
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHH Q++
Sbjct: 107 HHHHHQQQQ 115



 Score = 20.8 bits (42), Expect(8) = 0.005
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 103 HHHHHH 108



 Score = 20.8 bits (42), Expect(8) = 0.005
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 102 HHHHHH 107



 Score = 20.8 bits (42), Expect(8) = 0.005
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 101 HHHHHH 106



 Score = 20.8 bits (42), Expect(8) = 0.005
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 100 HHHHHH 105



 Score = 20.8 bits (42), Expect(8) = 0.005
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 99  HHHHHH 104



>gb:AF191212_2058508 Mus musculus orphan nuclear receptor TECdeltaC
           short isoform (Tec) mRNA, complete cds.
          Length = 429

 Score = 23.9 bits (50), Expect(8) = 0.005
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 106 HHHHHHQQQ 114



 Score = 22.7 bits (47), Expect(8) = 0.005
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           YHHHHH
Sbjct: 98  YHHHHH 103



 Score = 20.8 bits (42), Expect(8) = 0.005
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHH Q++
Sbjct: 107 HHHHHQQQQ 115



 Score = 20.8 bits (42), Expect(8) = 0.005
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 103 HHHHHH 108



 Score = 20.8 bits (42), Expect(8) = 0.005
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 102 HHHHHH 107



 Score = 20.8 bits (42), Expect(8) = 0.005
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 101 HHHHHH 106



 Score = 20.8 bits (42), Expect(8) = 0.005
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 100 HHHHHH 105



 Score = 20.8 bits (42), Expect(8) = 0.005
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 99  HHHHHH 104



>gb:AC116305_1206185 Dictyostelium discoideum chromosome 2 map
            1005175-1418323 strain AX4, complete sequence.
          Length = 1290

 Score = 21.9 bits (45), Expect(9) = 0.007
 Identities = 6/15 (40%), Positives = 10/15 (66%)
 Frame = -3

Query: 185  KLIRKDLRTYHHHHH 141
            +L +  +  +HHHHH
Sbjct: 1187 RLSQSGIWNHHHHHH 1201



 Score = 20.8 bits (42), Expect(9) = 0.007
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 1204 HHHHHH 1209



 Score = 20.8 bits (42), Expect(9) = 0.007
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 1203 HHHHHH 1208



 Score = 20.8 bits (42), Expect(9) = 0.007
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 1202 HHHHHH 1207



 Score = 20.8 bits (42), Expect(9) = 0.007
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 1201 HHHHHH 1206



 Score = 20.8 bits (42), Expect(9) = 0.007
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 1200 HHHHHH 1205



 Score = 20.8 bits (42), Expect(9) = 0.007
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 1199 HHHHHH 1204



 Score = 20.8 bits (42), Expect(9) = 0.007
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 1198 HHHHHH 1203



 Score = 20.8 bits (42), Expect(9) = 0.007
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 1197 HHHHHH 1202



>gb:BT002906_1636496 Arabidopsis thaliana clone RAFL15-07-C17
           (R20446) putative pectinesterase family protein
           (At2g36710) mRNA, complete cds.
          Length = 407

 Score = 21.2 bits (43), Expect(9) = 0.014
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -3

Query: 158 YHHHHHQREVI 126
           +HHH+H  E I
Sbjct: 61  HHHHYHHHEPI 71



 Score = 20.8 bits (42), Expect(9) = 0.014
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 59  HHHHHH 64



 Score = 20.8 bits (42), Expect(9) = 0.014
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 58  HHHHHH 63



 Score = 20.8 bits (42), Expect(9) = 0.014
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 57  HHHHHH 62



 Score = 20.8 bits (42), Expect(9) = 0.014
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 56  HHHHHH 61



 Score = 20.8 bits (42), Expect(9) = 0.014
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 55  HHHHHH 60



 Score = 20.8 bits (42), Expect(9) = 0.014
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 54  HHHHHH 59



 Score = 20.8 bits (42), Expect(9) = 0.014
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 53  HHHHHH 58



 Score = 20.8 bits (42), Expect(9) = 0.014
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 52  HHHHHH 57



>pir|G84783|G84783 probable pectinesterase [imported] - Arabidopsis
           thaliana>gb:AC006282_1533957 Arabidopsis thaliana
           chromosome 2 clone F13K3 map g6825, complete sequence.
          Length = 407

 Score = 21.2 bits (43), Expect(9) = 0.014
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -3

Query: 158 YHHHHHQREVI 126
           +HHH+H  E I
Sbjct: 61  HHHHYHHHEPI 71



 Score = 20.8 bits (42), Expect(9) = 0.014
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 59  HHHHHH 64



 Score = 20.8 bits (42), Expect(9) = 0.014
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 58  HHHHHH 63



 Score = 20.8 bits (42), Expect(9) = 0.014
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 57  HHHHHH 62



 Score = 20.8 bits (42), Expect(9) = 0.014
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 56  HHHHHH 61



 Score = 20.8 bits (42), Expect(9) = 0.014
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 55  HHHHHH 60



 Score = 20.8 bits (42), Expect(9) = 0.014
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 54  HHHHHH 59



 Score = 20.8 bits (42), Expect(9) = 0.014
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 53  HHHHHH 58



 Score = 20.8 bits (42), Expect(9) = 0.014
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 52  HHHHHH 57



>pir|D83483|D83483 probable metal transporter PA1297 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004559_55533
           Pseudomonas aeruginosa PAO1, section 120 of 529 of the
           complete genome.>gb:AE004091_969633 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 326

 Score = 22.3 bits (46), Expect(8) = 0.021
 Identities = 7/21 (33%), Positives = 11/21 (52%)
 Frame = -3

Query: 158 YHHHHHQREVISMILNVQKIF 96
           +HHHHH        LN++  +
Sbjct: 170 HHHHHHDHHAHRHDLNLRAAY 190



 Score = 21.6 bits (44), Expect(8) = 0.021
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 168 HHHHHHHHD 176



 Score = 21.2 bits (43), Expect(8) = 0.021
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           ++HHHHH
Sbjct: 161 SHHHHHH 167



 Score = 20.8 bits (42), Expect(8) = 0.021
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 167 HHHHHH 172



 Score = 20.8 bits (42), Expect(8) = 0.021
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 166 HHHHHH 171



 Score = 20.8 bits (42), Expect(8) = 0.021
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 165 HHHHHH 170



 Score = 20.8 bits (42), Expect(8) = 0.021
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 164 HHHHHH 169



 Score = 20.8 bits (42), Expect(8) = 0.021
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 163 HHHHHH 168



>gb:GGA401088_2572803 Gallus gallus mRNA for MOX-2 protein.
          Length = 302

 Score = 23.9 bits (50), Expect(7) = 0.024
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 74  HHHHHHQQQ 82



 Score = 21.9 bits (45), Expect(7) = 0.024
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 73  HHHHHHHQQ 81



 Score = 21.9 bits (45), Expect(7) = 0.024
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 164 RTYHHHHH 141
           R +HHHHH
Sbjct: 66  RGHHHHHH 73



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHH Q++
Sbjct: 75  HHHHHQQQQ 83



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 71  HHHHHH 76



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 70  HHHHHH 75



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 69  HHHHHH 74



>gb:BT019351_2151306 Synthetic construct Homo sapiens mesenchyme
           homeo box 2 (growth arrest-specific homeo box) mRNA,
           partial cds.
          Length = 304

 Score = 23.9 bits (50), Expect(7) = 0.024
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 74  HHHHHHQQQ 82



 Score = 21.9 bits (45), Expect(7) = 0.024
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 73  HHHHHHHQQ 81



 Score = 21.9 bits (45), Expect(7) = 0.024
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 164 RTYHHHHH 141
           R +HHHHH
Sbjct: 66  RGHHHHHH 73



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHH Q++
Sbjct: 75  HHHHHQQQQ 83



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 71  HHHHHH 76



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 70  HHHHHH 75



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 69  HHHHHH 74



>gb:BC002076_2088847 Mus musculus mesenchyme homeobox 2, mRNA (cDNA
           clone MGC:6225 IMAGE:3591924), complete cds.
          Length = 303

 Score = 23.9 bits (50), Expect(7) = 0.024
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 74  HHHHHHQQQ 82



 Score = 21.9 bits (45), Expect(7) = 0.024
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 73  HHHHHHHQQ 81



 Score = 21.9 bits (45), Expect(7) = 0.024
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 164 RTYHHHHH 141
           R +HHHHH
Sbjct: 66  RGHHHHHH 73



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHH Q++
Sbjct: 75  HHHHHQQQQ 83



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 71  HHHHHH 76



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 70  HHHHHH 75



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 69  HHHHHH 74



>gb:CR536553_1993846 Homo sapiens full open reading frame cDNA clone
           RZPDo834F1020D for gene MEOX2, mesenchyme homeo box 2
           (growth arrest-specific homeo box); complete cds, incl.
           stopcodon.
          Length = 303

 Score = 23.9 bits (50), Expect(7) = 0.024
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 75  HHHHHHQQQ 83



 Score = 21.9 bits (45), Expect(7) = 0.024
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 74  HHHHHHHQQ 82



 Score = 21.9 bits (45), Expect(7) = 0.024
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 164 RTYHHHHH 141
           R +HHHHH
Sbjct: 66  RGHHHHHH 73



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 72  HHHHHH 77



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 71  HHHHHH 76



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 70  HHHHHH 75



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 69  HHHHHH 74



>gb:AF295686_1417755 Sus scrofa growth arrest homeobox transcription
           factor GAX (GAX) mRNA, complete cds.
          Length = 303

 Score = 23.9 bits (50), Expect(7) = 0.024
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 74  HHHHHHQQQ 82



 Score = 21.9 bits (45), Expect(7) = 0.024
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 73  HHHHHHHQQ 81



 Score = 21.9 bits (45), Expect(7) = 0.024
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 164 RTYHHHHH 141
           R +HHHHH
Sbjct: 66  RGHHHHHH 73



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHH Q++
Sbjct: 75  HHHHHQQQQ 83



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 71  HHHHHH 76



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 70  HHHHHH 75



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 69  HHHHHH 74



>sp|P39020|MOX2_RAT Homeobox protein MOX-2 (Growth arrest-specific
           homeobox).>pir|A48130|A48130 growth arrest-specific
           homeobox protein Cvx - rat>gb:RNGAXMR_2134880
           R.norvegicus mRNA encoding Gax protein.
          Length = 303

 Score = 23.9 bits (50), Expect(7) = 0.024
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 74  HHHHHHQQQ 82



 Score = 21.9 bits (45), Expect(7) = 0.024
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 73  HHHHHHHQQ 81



 Score = 21.9 bits (45), Expect(7) = 0.024
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 164 RTYHHHHH 141
           R +HHHHH
Sbjct: 66  RGHHHHHH 73



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHH Q++
Sbjct: 75  HHHHHQQQQ 83



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 71  HHHHHH 76



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 70  HHHHHH 75



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 69  HHHHHH 74



>sp|P32443|MOX2_MOUSE Homeobox protein MOX-2 (Mesenchyme homeobox
           2).>pir|B49122|B49122 homeobox protein Mox-2 -
           mouse>gb:AK028352_1160941 Mus musculus 18 days pregnant
           adult female placenta and extra embryonic tissue cDNA,
           RIKEN full-length enriched library, clone:3830404I06
           product:mesenchyme homeobox 2, full insert
           sequence.>gb:AK031152_1162325 Mus musculus 13 days
           embryo forelimb cDNA, RIKEN full-length enriched
           library, clone:5930416C09 product:mesenchyme homeobox 2,
           full insert sequence.>gb:MOX2A_2124692 Mus musculus
           Mox-2A mRNA.
          Length = 303

 Score = 23.9 bits (50), Expect(7) = 0.024
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 74  HHHHHHQQQ 82



 Score = 21.9 bits (45), Expect(7) = 0.024
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 73  HHHHHHHQQ 81



 Score = 21.9 bits (45), Expect(7) = 0.024
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 164 RTYHHHHH 141
           R +HHHHH
Sbjct: 66  RGHHHHHH 73



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHH Q++
Sbjct: 75  HHHHHQQQQ 83



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 71  HHHHHH 76



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 70  HHHHHH 75



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 69  HHHHHH 74



>sp|P50222|MOX2_HUMAN Homeobox protein MOX-2 (Mesenchyme homeobox 2)
           (Growth arrest-specific homeobox).>pir|A56837|A56837
           homeotic protein MOX2 - human>gb:BC017021_1975852 Homo
           sapiens mesenchyme homeo box 2 (growth arrest-specific
           homeo box), mRNA (cDNA clone MGC:8959 IMAGE:3917118),
           complete cds.>gb:HSMOX2_2018861 H.sapiens mRNA for
           Mox-2.
          Length = 303

 Score = 23.9 bits (50), Expect(7) = 0.024
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 74  HHHHHHQQQ 82



 Score = 21.9 bits (45), Expect(7) = 0.024
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 73  HHHHHHHQQ 81



 Score = 21.9 bits (45), Expect(7) = 0.024
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 164 RTYHHHHH 141
           R +HHHHH
Sbjct: 66  RGHHHHHH 73



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHH Q++
Sbjct: 75  HHHHHQQQQ 83



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 71  HHHHHH 76



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 70  HHHHHH 75



 Score = 20.8 bits (42), Expect(7) = 0.024
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 69  HHHHHH 74



>gb:HSU58496_2025055 Human mnb protein kinase homolog hp86 (DYRK)
           mRNA, complete cds.
          Length = 763

 Score = 21.9 bits (45), Expect(8) = 0.036
 Identities = 5/11 (45%), Positives = 9/11 (81%)
 Frame = -3

Query: 158 YHHHHHQREVI 126
           +HHHHH ++ +
Sbjct: 614 HHHHHHGQQAL 624



 Score = 21.2 bits (43), Expect(8) = 0.036
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           ++HHHHH
Sbjct: 606 SHHHHHH 612



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 613 HHHHHH 618



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 612 HHHHHH 617



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 611 HHHHHH 616



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 610 HHHHHH 615



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 609 HHHHHH 614



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 608 HHHHHH 613



>gb:HSU52373_2024742 Human serine/threonine kinase MNB (mnb) mRNA,
           complete cds.
          Length = 763

 Score = 21.9 bits (45), Expect(8) = 0.036
 Identities = 5/11 (45%), Positives = 9/11 (81%)
 Frame = -3

Query: 158 YHHHHHQREVI 126
           +HHHHH ++ +
Sbjct: 614 HHHHHHGQQAL 624



 Score = 21.2 bits (43), Expect(8) = 0.036
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           ++HHHHH
Sbjct: 606 SHHHHHH 612



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 613 HHHHHH 618



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 612 HHHHHH 617



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 611 HHHHHH 616



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 610 HHHHHH 615



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 609 HHHHHH 614



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 608 HHHHHH 613



>sp|Q63470|DYRA_RAT Dual-specificity tyrosine-phosphorylation
           regulated kinase 1A (EC 2.7.1.-) (Protein kinase
           minibrain homolog) (MNBH) (RP86) (Dual specificity
           YAK1-related kinase).>gb:RNPSK47_2136264 R.norvegicus
           mRNA for Dual Specificity Yak1-related Kinase (Dyrk).
          Length = 763

 Score = 21.9 bits (45), Expect(8) = 0.036
 Identities = 5/11 (45%), Positives = 9/11 (81%)
 Frame = -3

Query: 158 YHHHHHQREVI 126
           +HHHHH ++ +
Sbjct: 614 HHHHHHGQQAL 624



 Score = 21.2 bits (43), Expect(8) = 0.036
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           ++HHHHH
Sbjct: 606 SHHHHHH 612



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 613 HHHHHH 618



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 612 HHHHHH 617



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 611 HHHHHH 616



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 610 HHHHHH 615



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 609 HHHHHH 614



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 608 HHHHHH 613



>sp|Q61214|DYRA_MOUSE Dual-specificity tyrosine-phosphorylation
           regulated kinase 1A (EC 2.7.1.-) (Protein kinase
           minibrain homolog) (MNBH) (MP86) (Dual specificity
           YAK1-related kinase).>gb:MMU58497_2122652 Mus musculus
           mnb protein kinase homolog mp86 (Dyrk) mRNA, complete
           cds.
          Length = 763

 Score = 21.9 bits (45), Expect(8) = 0.036
 Identities = 5/11 (45%), Positives = 9/11 (81%)
 Frame = -3

Query: 158 YHHHHHQREVI 126
           +HHHHH ++ +
Sbjct: 614 HHHHHHGQQAL 624



 Score = 21.2 bits (43), Expect(8) = 0.036
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           ++HHHHH
Sbjct: 606 SHHHHHH 612



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 613 HHHHHH 618



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 612 HHHHHH 617



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 611 HHHHHH 616



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 610 HHHHHH 615



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 609 HHHHHH 614



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 608 HHHHHH 613



>sp|Q13627|DYRA_HUMAN Dual-specificity tyrosine-phosphorylation
           regulated kinase 1A (EC 2.7.1.-) (Protein kinase
           minibrain homolog) (MNBH) (HP86) (Dual specificity
           YAK1-related kinase).
          Length = 763

 Score = 21.9 bits (45), Expect(8) = 0.036
 Identities = 5/11 (45%), Positives = 9/11 (81%)
 Frame = -3

Query: 158 YHHHHHQREVI 126
           +HHHHH ++ +
Sbjct: 614 HHHHHHGQQAL 624



 Score = 21.2 bits (43), Expect(8) = 0.036
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           ++HHHHH
Sbjct: 606 SHHHHHH 612



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 613 HHHHHH 618



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 612 HHHHHH 617



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 611 HHHHHH 616



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 610 HHHHHH 615



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 609 HHHHHH 614



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 608 HHHHHH 613



>gb:GGA459381_2572833 Gallus gallus mRNA for minibrain protein
           kinase (MNB gene).
          Length = 756

 Score = 21.9 bits (45), Expect(8) = 0.036
 Identities = 5/11 (45%), Positives = 9/11 (81%)
 Frame = -3

Query: 158 YHHHHHQREVI 126
           +HHHHH ++ +
Sbjct: 607 HHHHHHGQQAL 617



 Score = 21.2 bits (43), Expect(8) = 0.036
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           ++HHHHH
Sbjct: 599 SHHHHHH 605



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 606 HHHHHH 611



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 605 HHHHHH 610



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 604 HHHHHH 609



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 603 HHHHHH 608



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 602 HHHHHH 607



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 601 HHHHHH 606



>pir|JC4898|JC4898 Down-syndrome-critical-region protein -
           human>gb:D85759_1995106 Homo sapiens mRNA for MNB
           protein kinase, complete cds.>gb:D86550_1995159 Human
           mRNA for serine/threonine protein kinase, complete cds.
          Length = 754

 Score = 21.9 bits (45), Expect(8) = 0.036
 Identities = 5/11 (45%), Positives = 9/11 (81%)
 Frame = -3

Query: 158 YHHHHHQREVI 126
           +HHHHH ++ +
Sbjct: 605 HHHHHHGQQAL 615



 Score = 21.2 bits (43), Expect(8) = 0.036
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           ++HHHHH
Sbjct: 597 SHHHHHH 603



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 604 HHHHHH 609



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 603 HHHHHH 608



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 602 HHHHHH 607



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 601 HHHHHH 606



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 600 HHHHHH 605



 Score = 20.8 bits (42), Expect(8) = 0.036
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 599 HHHHHH 604



>gb:BC034550_2097686 Mus musculus dual-specificity
           tyrosine-(Y)-phosphorylation regulated kinase 1a, mRNA
           (cDNA clone IMAGE:3485711), partial cds.
          Length = 593

 Score = 21.9 bits (45), Expect(8) = 0.037
 Identities = 5/11 (45%), Positives = 9/11 (81%)
 Frame = -3

Query: 158 YHHHHHQREVI 126
           +HHHHH ++ +
Sbjct: 444 HHHHHHGQQAL 454



 Score = 21.2 bits (43), Expect(8) = 0.037
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           ++HHHHH
Sbjct: 436 SHHHHHH 442



 Score = 20.8 bits (42), Expect(8) = 0.037
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 443 HHHHHH 448



 Score = 20.8 bits (42), Expect(8) = 0.037
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 442 HHHHHH 447



 Score = 20.8 bits (42), Expect(8) = 0.037
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 441 HHHHHH 446



 Score = 20.8 bits (42), Expect(8) = 0.037
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 440 HHHHHH 445



 Score = 20.8 bits (42), Expect(8) = 0.037
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 439 HHHHHH 444



 Score = 20.8 bits (42), Expect(8) = 0.037
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 438 HHHHHH 443



>gb:AK052390_1170019 Mus musculus 13 days embryo heart cDNA, RIKEN
           full-length enriched library, clone:D330050P05
           product:dual-specificity tyrosine-(Y)-phosphorylation
           regulated kinase 1a, full insert sequence.
          Length = 523

 Score = 21.9 bits (45), Expect(8) = 0.038
 Identities = 5/11 (45%), Positives = 9/11 (81%)
 Frame = -3

Query: 158 YHHHHHQREVI 126
           +HHHHH ++ +
Sbjct: 374 HHHHHHGQQAL 384



 Score = 21.2 bits (43), Expect(8) = 0.038
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           ++HHHHH
Sbjct: 366 SHHHHHH 372



 Score = 20.8 bits (42), Expect(8) = 0.038
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 373 HHHHHH 378



 Score = 20.8 bits (42), Expect(8) = 0.038
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 372 HHHHHH 377



 Score = 20.8 bits (42), Expect(8) = 0.038
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 371 HHHHHH 376



 Score = 20.8 bits (42), Expect(8) = 0.038
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 370 HHHHHH 375



 Score = 20.8 bits (42), Expect(8) = 0.038
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 369 HHHHHH 374



 Score = 20.8 bits (42), Expect(8) = 0.038
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 368 HHHHHH 373



>gb:AE014298_1125097 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003451_1210279 Drosophila melanogaster
           chromosome X, section 35 of 74 of the complete
           sequence.>gb:AY094669_1297843 Drosophila melanogaster
           GH03394 full insert cDNA.
          Length = 1122

 Score = 21.9 bits (45), Expect(8) = 0.042
 Identities = 5/12 (41%), Positives = 8/12 (66%)
 Frame = -3

Query: 158 YHHHHHQREVIS 123
           +HHHHH    ++
Sbjct: 346 HHHHHHNASAVA 357



 Score = 20.8 bits (42), Expect(8) = 0.042
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 342 HHHHHH 347



 Score = 20.8 bits (42), Expect(8) = 0.042
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 341 HHHHHH 346



 Score = 20.8 bits (42), Expect(8) = 0.042
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 340 HHHHHH 345



 Score = 20.8 bits (42), Expect(8) = 0.042
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 339 HHHHHH 344



 Score = 20.8 bits (42), Expect(8) = 0.042
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 338 HHHHHH 343



 Score = 20.8 bits (42), Expect(8) = 0.042
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 337 HHHHHH 342



 Score = 20.8 bits (42), Expect(8) = 0.042
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 336 HHHHHH 341



>gb:BC048837_2099836 Mus musculus, Similar to dual-specificity
           tyrosine-(Y)-phosphorylation regulated kinase 1a, clone
           IMAGE:4922060, mRNA, partial cds.
          Length = 329

 Score = 21.9 bits (45), Expect(8) = 0.042
 Identities = 5/11 (45%), Positives = 9/11 (81%)
 Frame = -3

Query: 158 YHHHHHQREVI 126
           +HHHHH ++ +
Sbjct: 180 HHHHHHGQQAL 190



 Score = 21.2 bits (43), Expect(8) = 0.042
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           ++HHHHH
Sbjct: 172 SHHHHHH 178



 Score = 20.8 bits (42), Expect(8) = 0.042
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 179 HHHHHH 184



 Score = 20.8 bits (42), Expect(8) = 0.042
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 178 HHHHHH 183



 Score = 20.8 bits (42), Expect(8) = 0.042
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 177 HHHHHH 182



 Score = 20.8 bits (42), Expect(8) = 0.042
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 176 HHHHHH 181



 Score = 20.8 bits (42), Expect(8) = 0.042
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 175 HHHHHH 180



 Score = 20.8 bits (42), Expect(8) = 0.042
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 174 HHHHHH 179



>gb:AY034061_2508846 Danio rerio nuclear receptor FF1aE mRNA,
           complete cds.
          Length = 517

 Score = 21.2 bits (43), Expect(8) = 0.048
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           ++HHHHH
Sbjct: 186 SHHHHHH 192



 Score = 21.2 bits (43), Expect(8) = 0.048
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 167 LRTYHHHHH 141
           L  +HHHHH
Sbjct: 185 LSHHHHHHH 193



 Score = 21.2 bits (43), Expect(8) = 0.048
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -3

Query: 173 KDLRTYHHHHH 141
           K L   HHHHH
Sbjct: 181 KGLPLSHHHHH 191



 Score = 20.8 bits (42), Expect(8) = 0.048
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 193 HHHHHH 198



 Score = 20.8 bits (42), Expect(8) = 0.048
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 192 HHHHHH 197



 Score = 20.8 bits (42), Expect(8) = 0.048
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 191 HHHHHH 196



 Score = 20.8 bits (42), Expect(8) = 0.048
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 190 HHHHHH 195



 Score = 20.8 bits (42), Expect(8) = 0.048
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 189 HHHHHH 194



>gb:AF014926_2468608 Danio rerio FTZ-F1 homolog (zFF1) mRNA,
           complete cds.
          Length = 516

 Score = 21.2 bits (43), Expect(8) = 0.048
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           ++HHHHH
Sbjct: 186 SHHHHHH 192



 Score = 21.2 bits (43), Expect(8) = 0.048
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 167 LRTYHHHHH 141
           L  +HHHHH
Sbjct: 185 LSHHHHHHH 193



 Score = 21.2 bits (43), Expect(8) = 0.048
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -3

Query: 173 KDLRTYHHHHH 141
           K L   HHHHH
Sbjct: 181 KGLPLSHHHHH 191



 Score = 20.8 bits (42), Expect(8) = 0.048
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 193 HHHHHH 198



 Score = 20.8 bits (42), Expect(8) = 0.048
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 192 HHHHHH 197



 Score = 20.8 bits (42), Expect(8) = 0.048
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 191 HHHHHH 196



 Score = 20.8 bits (42), Expect(8) = 0.048
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 190 HHHHHH 195



 Score = 20.8 bits (42), Expect(8) = 0.048
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 189 HHHHHH 194



>gb:AJ586138_1906761 Homo sapiens mRNA for ubiquitin-specific
           proteinase 34 (USP34 gene).
          Length = 3395

 Score = 23.5 bits (49), Expect(7) = 0.050
 Identities = 6/20 (30%), Positives = 12/20 (60%)
 Frame = -3

Query: 158 YHHHHHQREVISMILNVQKI 99
           +HHHHH   ++  +L+   +
Sbjct: 604 HHHHHHDGHMVDDMLSADDV 623



 Score = 21.6 bits (44), Expect(7) = 0.050
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 602 HHHHHHHHD 610



 Score = 20.8 bits (42), Expect(7) = 0.050
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 601 HHHHHH 606



 Score = 20.8 bits (42), Expect(7) = 0.050
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 600 HHHHHH 605



 Score = 20.8 bits (42), Expect(7) = 0.050
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 599 HHHHHH 604



 Score = 20.8 bits (42), Expect(7) = 0.050
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 598 HHHHHH 603



 Score = 20.8 bits (42), Expect(7) = 0.050
 Identities = 7/18 (38%), Positives = 10/18 (55%)
 Frame = -3

Query: 194 NSIKLIRKDLRTYHHHHH 141
           N +   R+ +   HHHHH
Sbjct: 585 NELFNCRQFIGPQHHHHH 602



>gb:AC005550_1874971 Homo sapiens PAC clone RP4-620P6 from 7,
           complete sequence.
          Length = 230

 Score = 23.9 bits (50), Expect(7) = 0.051
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 75  HHHHHHQQQ 83



 Score = 21.9 bits (45), Expect(7) = 0.051
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 164 RTYHHHHH 141
           R +HHHHH
Sbjct: 66  RGHHHHHH 73



 Score = 20.8 bits (42), Expect(7) = 0.051
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHH Q++
Sbjct: 76  HHHHHQQQQ 84



 Score = 20.8 bits (42), Expect(7) = 0.051
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 72  HHHHHH 77



 Score = 20.8 bits (42), Expect(7) = 0.051
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 71  HHHHHH 76



 Score = 20.8 bits (42), Expect(7) = 0.051
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 70  HHHHHH 75



 Score = 20.8 bits (42), Expect(7) = 0.051
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 69  HHHHHH 74



>gb:AE014298_1123748 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003418_1208930 Drosophila melanogaster
           chromosome X, section 2 of 74 of the complete sequence.
          Length = 1300

 Score = 21.2 bits (43), Expect(8) = 0.051
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 543 FHHHHH 548



 Score = 21.2 bits (43), Expect(8) = 0.051
 Identities = 8/27 (29%), Positives = 14/27 (51%)
 Frame = -1

Query: 358 NSPLWAPHHHQHLFSNPYLLNQSNNPH 278
           N+     HHHQH F + +  +  ++ H
Sbjct: 530 NAAYQQQHHHQHHFHHHHHHHHHHHNH 556



 Score = 20.8 bits (42), Expect(8) = 0.051
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 549 HHHHHH 554



 Score = 20.8 bits (42), Expect(8) = 0.051
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 548 HHHHHH 553



 Score = 20.8 bits (42), Expect(8) = 0.051
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 547 HHHHHH 552



 Score = 20.8 bits (42), Expect(8) = 0.051
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 546 HHHHHH 551



 Score = 20.8 bits (42), Expect(8) = 0.051
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 545 HHHHHH 550



 Score = 20.8 bits (42), Expect(8) = 0.051
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 544 HHHHHH 549



>pir|T13389|T13389 hypothetical protein 115C2.10 - fruit fly
           (Drosophila melanogaster)>gb:DMC115C2_1378292 Drosophila
           melanogaster cosmid clone 115C2.
          Length = 1291

 Score = 21.2 bits (43), Expect(8) = 0.051
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 543 FHHHHH 548



 Score = 21.2 bits (43), Expect(8) = 0.051
 Identities = 8/27 (29%), Positives = 14/27 (51%)
 Frame = -1

Query: 358 NSPLWAPHHHQHLFSNPYLLNQSNNPH 278
           N+     HHHQH F + +  +  ++ H
Sbjct: 530 NAAYQQQHHHQHHFHHHHHHHHHHHNH 556



 Score = 20.8 bits (42), Expect(8) = 0.051
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 549 HHHHHH 554



 Score = 20.8 bits (42), Expect(8) = 0.051
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 548 HHHHHH 553



 Score = 20.8 bits (42), Expect(8) = 0.051
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 547 HHHHHH 552



 Score = 20.8 bits (42), Expect(8) = 0.051
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 546 HHHHHH 551



 Score = 20.8 bits (42), Expect(8) = 0.051
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 545 HHHHHH 550



 Score = 20.8 bits (42), Expect(8) = 0.051
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 544 HHHHHH 549



>gb:AY089517_1297173 Drosophila melanogaster GM05459 full insert
           cDNA.
          Length = 825

 Score = 21.2 bits (43), Expect(8) = 0.055
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 68  FHHHHH 73



 Score = 21.2 bits (43), Expect(8) = 0.055
 Identities = 8/27 (29%), Positives = 14/27 (51%)
 Frame = -1

Query: 358 NSPLWAPHHHQHLFSNPYLLNQSNNPH 278
           N+     HHHQH F + +  +  ++ H
Sbjct: 55  NAAYQQQHHHQHHFHHHHHHHHHHHNH 81



 Score = 20.8 bits (42), Expect(8) = 0.055
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 74  HHHHHH 79



 Score = 20.8 bits (42), Expect(8) = 0.055
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 73  HHHHHH 78



 Score = 20.8 bits (42), Expect(8) = 0.055
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 72  HHHHHH 77



 Score = 20.8 bits (42), Expect(8) = 0.055
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 71  HHHHHH 76



 Score = 20.8 bits (42), Expect(8) = 0.055
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 70  HHHHHH 75



 Score = 20.8 bits (42), Expect(8) = 0.055
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 69  HHHHHH 74



>gb:AY069604_1294334 Drosophila melanogaster LD36415 full length
           cDNA.
          Length = 782

 Score = 21.2 bits (43), Expect(8) = 0.056
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 543 FHHHHH 548



 Score = 21.2 bits (43), Expect(8) = 0.056
 Identities = 8/27 (29%), Positives = 14/27 (51%)
 Frame = -1

Query: 358 NSPLWAPHHHQHLFSNPYLLNQSNNPH 278
           N+     HHHQH F + +  +  ++ H
Sbjct: 530 NAAYQQQHHHQHHFHHHHHHHHHHHNH 556



 Score = 20.8 bits (42), Expect(8) = 0.056
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 549 HHHHHH 554



 Score = 20.8 bits (42), Expect(8) = 0.056
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 548 HHHHHH 553



 Score = 20.8 bits (42), Expect(8) = 0.056
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 547 HHHHHH 552



 Score = 20.8 bits (42), Expect(8) = 0.056
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 546 HHHHHH 551



 Score = 20.8 bits (42), Expect(8) = 0.056
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 545 HHHHHH 550



 Score = 20.8 bits (42), Expect(8) = 0.056
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 544 HHHHHH 549



>sp|P06782|SNF1_YEAST Carbon catabolite derepressing protein kinase
           (EC 2.7.1.-).>pir|A26030|A26030
           serine/threonine-specific protein kinase (EC 2.7.1.-)
           SNF1 - yeast (Saccharomyces
           cerevisiae)>gb:SCD8035_1707496 Saccharomyces cerevisiae
           chromosome IV cosmids 9410, 8035, 8166, and
           9787.>gb:YSCSNF1_1730617 Yeast (S.cerevisiae) SNF1 gene
           encoding a carbon catabolite derepressing protein
           kinase, complete cds.
          Length = 633

 Score = 21.2 bits (43), Expect(8) = 0.058
 Identities = 8/19 (42%), Positives = 10/19 (52%)
 Frame = -3

Query: 158 YHHHHHQREVISMILNVQK 102
           +HHHHH     +  LN  K
Sbjct: 25  HHHHHHGHGGSNSTLNNPK 43



 Score = 21.2 bits (43), Expect(8) = 0.058
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           ++HHHHH
Sbjct: 17  SHHHHHH 23



 Score = 20.8 bits (42), Expect(8) = 0.058
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 24  HHHHHH 29



 Score = 20.8 bits (42), Expect(8) = 0.058
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 23  HHHHHH 28



 Score = 20.8 bits (42), Expect(8) = 0.058
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 22  HHHHHH 27



 Score = 20.8 bits (42), Expect(8) = 0.058
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 21  HHHHHH 26



 Score = 20.8 bits (42), Expect(8) = 0.058
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 20  HHHHHH 25



 Score = 20.8 bits (42), Expect(8) = 0.058
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 19  HHHHHH 24



>gb:BC057615_2102830 Mus musculus discs, large (Drosophila)
           homolog-associated protein 3, mRNA (cDNA clone MGC:67550
           IMAGE:6401651), complete cds.
          Length = 977

 Score = 22.7 bits (47), Expect(7) = 0.061
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 228 HHHHHHQ 234



 Score = 21.6 bits (44), Expect(7) = 0.061
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 226 HHHHHHHHQ 234



 Score = 21.2 bits (43), Expect(7) = 0.061
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           ++HHHHH
Sbjct: 221 SHHHHHH 227



 Score = 21.2 bits (43), Expect(7) = 0.061
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -3

Query: 161 TYHHHHH 141
           T HHHHH
Sbjct: 220 TSHHHHH 226



 Score = 20.8 bits (42), Expect(7) = 0.061
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 225 HHHHHH 230



 Score = 20.8 bits (42), Expect(7) = 0.061
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 224 HHHHHH 229



 Score = 20.8 bits (42), Expect(7) = 0.061
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 223 HHHHHH 228



>gb:AY530298_2086234 Rattus norvegicus synapse-associated protein
           90/postsynaptic density-95-associated protein 3(+)
           (SAPAP3) mRNA, complete cds, alternatively spliced.
          Length = 977

 Score = 22.7 bits (47), Expect(7) = 0.061
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 228 HHHHHHQ 234



 Score = 21.6 bits (44), Expect(7) = 0.061
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 226 HHHHHHHHQ 234



 Score = 21.2 bits (43), Expect(7) = 0.061
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           ++HHHHH
Sbjct: 221 SHHHHHH 227



 Score = 21.2 bits (43), Expect(7) = 0.061
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -3

Query: 161 TYHHHHH 141
           T HHHHH
Sbjct: 220 TSHHHHH 226



 Score = 20.8 bits (42), Expect(7) = 0.061
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 225 HHHHHH 230



 Score = 20.8 bits (42), Expect(7) = 0.061
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 224 HHHHHH 229



 Score = 20.8 bits (42), Expect(7) = 0.061
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 223 HHHHHH 228



>gb:AY243848_2080523 Mus musculus SAP90/PSD-95 associated protein 3
           (Sapap3) mRNA, complete cds.
          Length = 977

 Score = 22.7 bits (47), Expect(7) = 0.061
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 228 HHHHHHQ 234



 Score = 21.6 bits (44), Expect(7) = 0.061
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 226 HHHHHHHHQ 234



 Score = 21.2 bits (43), Expect(7) = 0.061
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           ++HHHHH
Sbjct: 221 SHHHHHH 227



 Score = 21.2 bits (43), Expect(7) = 0.061
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -3

Query: 161 TYHHHHH 141
           T HHHHH
Sbjct: 220 TSHHHHH 226



 Score = 20.8 bits (42), Expect(7) = 0.061
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 225 HHHHHH 230



 Score = 20.8 bits (42), Expect(7) = 0.061
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 224 HHHHHH 229



 Score = 20.8 bits (42), Expect(7) = 0.061
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 223 HHHHHH 228



>gb:HSJ997D16_2016705 Human DNA sequence from clone RP5-997D16 on
           chromosome 1p34.1-35.3 Contains two novel genes, the 3'
           end of the gene for SAP90/PSD-95-associated protein 3
           (SAPAP3) and a CpG island, complete sequence.
          Length = 979

 Score = 22.7 bits (47), Expect(7) = 0.061
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 229 HHHHHHQ 235



 Score = 21.6 bits (44), Expect(7) = 0.061
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 227 HHHHHHHHQ 235



 Score = 21.2 bits (43), Expect(7) = 0.061
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           ++HHHHH
Sbjct: 222 SHHHHHH 228



 Score = 21.2 bits (43), Expect(7) = 0.061
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -3

Query: 161 TYHHHHH 141
           T HHHHH
Sbjct: 221 TSHHHHH 227



 Score = 20.8 bits (42), Expect(7) = 0.061
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 226 HHHHHH 231



 Score = 20.8 bits (42), Expect(7) = 0.061
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 225 HHHHHH 230



 Score = 20.8 bits (42), Expect(7) = 0.061
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 224 HHHHHH 229



>sp|P97838|DLP3_RAT Disks large-associated protein 3 (DAP-3)
           (SAP90/PSD-95-associated protein 3) (SAPAP3)
           (PSD-95/SAP90 binding protein 3).>gb:RNU67139_2137611
           Rattus norvegicus PSD-95/SAP90-associated protein-3
           mRNA, complete CDS.
          Length = 977

 Score = 22.7 bits (47), Expect(7) = 0.061
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 228 HHHHHHQ 234



 Score = 21.6 bits (44), Expect(7) = 0.061
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 226 HHHHHHHHQ 234



 Score = 21.2 bits (43), Expect(7) = 0.061
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           ++HHHHH
Sbjct: 221 SHHHHHH 227



 Score = 21.2 bits (43), Expect(7) = 0.061
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -3

Query: 161 TYHHHHH 141
           T HHHHH
Sbjct: 220 TSHHHHH 226



 Score = 20.8 bits (42), Expect(7) = 0.061
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 225 HHHHHH 230



 Score = 20.8 bits (42), Expect(7) = 0.061
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 224 HHHHHH 229



 Score = 20.8 bits (42), Expect(7) = 0.061
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 223 HHHHHH 228



>gb:AY530299_2086235 Rattus norvegicus synapse-associated protein
           90/postsynaptic density-95-associated protein 3(-)
           (SAPAP3) mRNA, complete cds, alternatively spliced.
          Length = 966

 Score = 22.7 bits (47), Expect(7) = 0.061
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 228 HHHHHHQ 234



 Score = 21.6 bits (44), Expect(7) = 0.061
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 226 HHHHHHHHQ 234



 Score = 21.2 bits (43), Expect(7) = 0.061
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           ++HHHHH
Sbjct: 221 SHHHHHH 227



 Score = 21.2 bits (43), Expect(7) = 0.061
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -3

Query: 161 TYHHHHH 141
           T HHHHH
Sbjct: 220 TSHHHHH 226



 Score = 20.8 bits (42), Expect(7) = 0.061
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 225 HHHHHH 230



 Score = 20.8 bits (42), Expect(7) = 0.061
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 224 HHHHHH 229



 Score = 20.8 bits (42), Expect(7) = 0.061
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 223 HHHHHH 228



>gb:BC058433_2103220 Mus musculus discs, large (Drosophila)
           homolog-associated protein 3, mRNA (cDNA clone
           IMAGE:5698568), partial cds.
          Length = 786

 Score = 22.7 bits (47), Expect(7) = 0.063
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 37  HHHHHHQ 43



 Score = 21.6 bits (44), Expect(7) = 0.063
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 35  HHHHHHHHQ 43



 Score = 21.2 bits (43), Expect(7) = 0.063
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           ++HHHHH
Sbjct: 30  SHHHHHH 36



 Score = 21.2 bits (43), Expect(7) = 0.063
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -3

Query: 161 TYHHHHH 141
           T HHHHH
Sbjct: 29  TSHHHHH 35



 Score = 20.8 bits (42), Expect(7) = 0.063
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 34  HHHHHH 39



 Score = 20.8 bits (42), Expect(7) = 0.063
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 33  HHHHHH 38



 Score = 20.8 bits (42), Expect(7) = 0.063
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 32  HHHHHH 37



>pir|T42516|T42516 hypothetical protein - fission yeast
           (Schizosaccharomyces pombe)>gb:D89156_1675274
           Schizosaccharomyces pombe mRNA, partial cds, clone: SY
           0639.
          Length = 427

 Score = 21.6 bits (44), Expect(8) = 0.079
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 305 HHHHHHSHD 313



 Score = 20.8 bits (42), Expect(8) = 0.079
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 304 HHHHHH 309



 Score = 20.8 bits (42), Expect(8) = 0.079
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 303 HHHHHH 308



 Score = 20.8 bits (42), Expect(8) = 0.079
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 302 HHHHHH 307



 Score = 20.8 bits (42), Expect(8) = 0.079
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 301 HHHHHH 306



 Score = 20.8 bits (42), Expect(8) = 0.079
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 300 HHHHHH 305



 Score = 20.8 bits (42), Expect(8) = 0.079
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 299 HHHHHH 304



 Score = 20.4 bits (41), Expect(8) = 0.079
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -3

Query: 173 KDLRTYHHHHH 141
           KDL    HHHH
Sbjct: 292 KDLHHEGHHHH 302



>sp|O42980|YBE1_SCHPO Putative thiol protease C17D11.01 (EC
           3.4.22.-).>pir|T39712|T39712 hypothetical protein
           SPBC17D11.01 - fission yeast  (Schizosaccharomyces
           pombe)>gb:SPBC17D11_1719317 S.pombe chromosome II cosmid
           c17D11.
          Length = 420

 Score = 21.6 bits (44), Expect(8) = 0.079
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 305 HHHHHHSHD 313



 Score = 20.8 bits (42), Expect(8) = 0.079
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 304 HHHHHH 309



 Score = 20.8 bits (42), Expect(8) = 0.079
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 303 HHHHHH 308



 Score = 20.8 bits (42), Expect(8) = 0.079
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 302 HHHHHH 307



 Score = 20.8 bits (42), Expect(8) = 0.079
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 301 HHHHHH 306



 Score = 20.8 bits (42), Expect(8) = 0.079
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 300 HHHHHH 305



 Score = 20.8 bits (42), Expect(8) = 0.079
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 299 HHHHHH 304



 Score = 20.4 bits (41), Expect(8) = 0.079
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -3

Query: 173 KDLRTYHHHHH 141
           KDL    HHHH
Sbjct: 292 KDLHHEGHHHH 302



>gb:BC050860_2100500 Mus musculus RIKEN cDNA 2810030E01 gene, mRNA
           (cDNA clone MGC:59463 IMAGE:6331376), complete cds.
          Length = 822

 Score = 20.8 bits (42), Expect(8) = 0.087
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 252 HHHHHH 257



 Score = 20.8 bits (42), Expect(8) = 0.087
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 251 HHHHHH 256



 Score = 20.8 bits (42), Expect(8) = 0.087
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 250 HHHHHH 255



 Score = 20.8 bits (42), Expect(8) = 0.087
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 249 HHHHHH 254



 Score = 20.8 bits (42), Expect(8) = 0.087
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 248 HHHHHH 253



 Score = 20.8 bits (42), Expect(8) = 0.087
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 247 HHHHHH 252



 Score = 20.8 bits (42), Expect(8) = 0.087
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 246 HHHHHH 251



 Score = 20.8 bits (42), Expect(8) = 0.087
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 245 HHHHHH 250



>gb:AY152408_2515474 Gallus gallus transcription factor MAFA (MAFA)
           gene, complete cds.
          Length = 286

 Score = 22.7 bits (47), Expect(7) = 0.096
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 127 HHHHHHQ 133



 Score = 21.9 bits (45), Expect(7) = 0.096
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 158 YHHHHHQR 135
           +HHHHH R
Sbjct: 160 HHHHHHLR 167



 Score = 21.2 bits (43), Expect(7) = 0.096
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = -3

Query: 158 YHHHHHQR 135
           +HHHHH +
Sbjct: 126 HHHHHHHQ 133



 Score = 20.8 bits (42), Expect(7) = 0.096
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 159 HHHHHH 164



 Score = 20.8 bits (42), Expect(7) = 0.096
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 158 HHHHHH 163



 Score = 20.8 bits (42), Expect(7) = 0.096
 Identities = 5/8 (62%), Positives = 6/8 (75%)
 Frame = -3

Query: 155 HHHHHQRE 132
           HHHHH  +
Sbjct: 126 HHHHHHHQ 133



 Score = 20.4 bits (41), Expect(7) = 0.096
 Identities = 5/9 (55%), Positives = 6/9 (66%)
 Frame = -3

Query: 155 HHHHHQREV 129
           HHHHH   +
Sbjct: 158 HHHHHHHHL 166



>gb:AF034693_2469775 Coturnix coturnix japonica bZip transcription
           factor MafA (mafA) gene, complete cds.
          Length = 286

 Score = 22.7 bits (47), Expect(7) = 0.096
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 127 HHHHHHQ 133



 Score = 21.9 bits (45), Expect(7) = 0.096
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 158 YHHHHHQR 135
           +HHHHH R
Sbjct: 160 HHHHHHLR 167



 Score = 21.2 bits (43), Expect(7) = 0.096
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = -3

Query: 158 YHHHHHQR 135
           +HHHHH +
Sbjct: 126 HHHHHHHQ 133



 Score = 20.8 bits (42), Expect(7) = 0.096
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 159 HHHHHH 164



 Score = 20.8 bits (42), Expect(7) = 0.096
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 158 HHHHHH 163



 Score = 20.8 bits (42), Expect(7) = 0.096
 Identities = 5/8 (62%), Positives = 6/8 (75%)
 Frame = -3

Query: 155 HHHHHQRE 132
           HHHHH  +
Sbjct: 126 HHHHHHHQ 133



 Score = 20.4 bits (41), Expect(7) = 0.096
 Identities = 5/9 (55%), Positives = 6/9 (66%)
 Frame = -3

Query: 155 HHHHHQREV 129
           HHHHH   +
Sbjct: 158 HHHHHHHHL 166



>gb:AF034570_2469770 Gallus gallus bZIP transcription factor L-Maf
           mRNA, complete cds.
          Length = 286

 Score = 22.7 bits (47), Expect(7) = 0.096
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 127 HHHHHHQ 133



 Score = 21.9 bits (45), Expect(7) = 0.096
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 158 YHHHHHQR 135
           +HHHHH R
Sbjct: 160 HHHHHHLR 167



 Score = 21.2 bits (43), Expect(7) = 0.096
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = -3

Query: 158 YHHHHHQR 135
           +HHHHH +
Sbjct: 126 HHHHHHHQ 133



 Score = 20.8 bits (42), Expect(7) = 0.096
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 159 HHHHHH 164



 Score = 20.8 bits (42), Expect(7) = 0.096
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 158 HHHHHH 163



 Score = 20.8 bits (42), Expect(7) = 0.096
 Identities = 5/8 (62%), Positives = 6/8 (75%)
 Frame = -3

Query: 155 HHHHHQRE 132
           HHHHH  +
Sbjct: 126 HHHHHHHQ 133



 Score = 20.4 bits (41), Expect(7) = 0.096
 Identities = 5/9 (55%), Positives = 6/9 (66%)
 Frame = -3

Query: 155 HHHHHQREV 129
           HHHHH   +
Sbjct: 158 HHHHHHHHL 166



>gb:AF221557_2480759 Gallus gallus bZIP transcription factor L-MAF
           mRNA, partial cds.>gb:AF221558_2480760 Gallus gallus
           bZIP transcription factor L-MAF mRNA, partial cds.
          Length = 146

 Score = 22.7 bits (47), Expect(7) = 0.12
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 9   HHHHHHQ 15



 Score = 21.9 bits (45), Expect(7) = 0.12
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 158 YHHHHHQR 135
           +HHHHH R
Sbjct: 42  HHHHHHLR 49



 Score = 21.2 bits (43), Expect(7) = 0.12
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = -3

Query: 158 YHHHHHQR 135
           +HHHHH +
Sbjct: 8   HHHHHHHQ 15



 Score = 20.8 bits (42), Expect(7) = 0.12
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 41  HHHHHH 46



 Score = 20.8 bits (42), Expect(7) = 0.12
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 40  HHHHHH 45



 Score = 20.8 bits (42), Expect(7) = 0.12
 Identities = 5/8 (62%), Positives = 6/8 (75%)
 Frame = -3

Query: 155 HHHHHQRE 132
           HHHHH  +
Sbjct: 8   HHHHHHHQ 15



 Score = 20.4 bits (41), Expect(7) = 0.12
 Identities = 5/9 (55%), Positives = 6/9 (66%)
 Frame = -3

Query: 155 HHHHHQREV 129
           HHHHH   +
Sbjct: 40  HHHHHHHHL 48



>gb:AY493414_1330562 Caenorhabditis elegans LIN-45 isoform 3 mRNA,
           complete cds.
          Length = 769

 Score = 38.1 bits (87), Expect = 0.13
 Identities = 34/117 (29%), Positives = 50/117 (42%), Gaps = 13/117 (11%)
 Frame = +1

Query: 331 GGEVPKGDYSGHPEGELGSKLKGPGSISDGNMAGKSPSKDMIFRADKIDLKSLDVQLEKH 510
           G   P    S  P G +G    G       N++G + S  +      + L        + 
Sbjct: 342 GSNSPSSTCSSPPGGLIGQPTLGQSP----NVSGSTTSSLVAAHLHTLPLTPPQSAPPQK 397

Query: 511 LS----RVWSRSVEHQV--QRPK-------EDWEIDPLKLEIRYLIAQGTYGTVYRG 642
           +S    R  SRS   ++  QRP+       EDWEI P +  I+Y +  G++GTVYRG
Sbjct: 398 ISPGFFRNRSRSPGERLDAQRPRPPQKPHHEDWEILPNEFIIQYKVGSGSFGTVYRG 454



>gb:AC024204_1204268 Caenorhabditis elegans cosmid Y73B6A, complete
           sequence.
          Length = 614

 Score = 38.1 bits (87), Expect = 0.13
 Identities = 34/117 (29%), Positives = 50/117 (42%), Gaps = 13/117 (11%)
 Frame = +1

Query: 331 GGEVPKGDYSGHPEGELGSKLKGPGSISDGNMAGKSPSKDMIFRADKIDLKSLDVQLEKH 510
           G   P    S  P G +G    G       N++G + S  +      + L        + 
Sbjct: 428 GSNSPSSTCSSPPGGLIGQPTLGQSP----NVSGSTTSSLVAAHLHTLPLTPPQSAPPQK 483

Query: 511 LS----RVWSRSVEHQV--QRPK-------EDWEIDPLKLEIRYLIAQGTYGTVYRG 642
           +S    R  SRS   ++  QRP+       EDWEI P +  I+Y +  G++GTVYRG
Sbjct: 484 ISPGFFRNRSRSPGERLDAQRPRPPQKPHHEDWEILPNEFIIQYKVGSGSFGTVYRG 540



>pir|S33261|S33261 protein kinase lin-45 (EC 2.7.1.-) -
           Caenorhabditis elegans>gb:CELRAF_1366044 Caenorhabditis
           elegans (clone pSK(+)raf107a) raf proto-oncogene mRNA,
           complete cds.
          Length = 813

 Score = 38.1 bits (87), Expect = 0.13
 Identities = 34/117 (29%), Positives = 50/117 (42%), Gaps = 13/117 (11%)
 Frame = +1

Query: 331 GGEVPKGDYSGHPEGELGSKLKGPGSISDGNMAGKSPSKDMIFRADKIDLKSLDVQLEKH 510
           G   P    S  P G +G    G       N++G + S  +      + L        + 
Sbjct: 386 GSNSPSSTCSSPPGGLIGQPTLGQSP----NVSGSTTSSLVAAHLHTLPLTPPQSAPPQK 441

Query: 511 LS----RVWSRSVEHQV--QRPK-------EDWEIDPLKLEIRYLIAQGTYGTVYRG 642
           +S    R  SRS   ++  QRP+       EDWEI P +  I+Y +  G++GTVYRG
Sbjct: 442 ISPGFFRNRSRSPGERLDAQRPRPPQKPHHEDWEILPNEFIIQYKVGSGSFGTVYRG 498



>sp|Q07292|KRAF_CAEEL Raf homolog serine/threonine-protein kinase
           (EC 2.7.1.37).>gb:AC024204_1204267 Caenorhabditis
           elegans cosmid Y73B6A, complete
           sequence.>gb:AY455928_1327763 Caenorhabditis elegans
           LIN-45 (lin-45) mRNA, complete cds.>gb:AY493413_1330561
           Caenorhabditis elegans LIN-45 isoform 2 mRNA, complete
           cds.
          Length = 813

 Score = 38.1 bits (87), Expect = 0.13
 Identities = 34/117 (29%), Positives = 50/117 (42%), Gaps = 13/117 (11%)
 Frame = +1

Query: 331 GGEVPKGDYSGHPEGELGSKLKGPGSISDGNMAGKSPSKDMIFRADKIDLKSLDVQLEKH 510
           G   P    S  P G +G    G       N++G + S  +      + L        + 
Sbjct: 386 GSNSPSSTCSSPPGGLIGQPTLGQSP----NVSGSTTSSLVAAHLHTLPLTPPQSAPPQK 441

Query: 511 LS----RVWSRSVEHQV--QRPK-------EDWEIDPLKLEIRYLIAQGTYGTVYRG 642
           +S    R  SRS   ++  QRP+       EDWEI P +  I+Y +  G++GTVYRG
Sbjct: 442 ISPGFFRNRSRSPGERLDAQRPRPPQKPHHEDWEILPNEFIIQYKVGSGSFGTVYRG 498



>pir|A55641|A55641 homeotic protein GAX - human>gb:HUMGAX_2031401
           Homo sapiens GAX mRNA, complete cds.
          Length = 302

 Score = 23.9 bits (50), Expect(6) = 0.13
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 73  HHHHHHQQQ 81



 Score = 21.9 bits (45), Expect(6) = 0.13
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 72  HHHHHHHQQ 80



 Score = 21.9 bits (45), Expect(6) = 0.13
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 164 RTYHHHHH 141
           R +HHHHH
Sbjct: 66  RGHHHHHH 73



 Score = 20.8 bits (42), Expect(6) = 0.13
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHH Q++
Sbjct: 74  HHHHHQQQQ 82



 Score = 20.8 bits (42), Expect(6) = 0.13
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 70  HHHHHH 75



 Score = 20.8 bits (42), Expect(6) = 0.13
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 69  HHHHHH 74



>gb:AE014298_1124253 Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE003430_1209435 Drosophila melanogaster
            chromosome X, section 14 of 74 of the complete sequence.
          Length = 1911

 Score = 22.7 bits (47), Expect(7) = 0.14
 Identities = 6/12 (50%), Positives = 8/12 (66%)
 Frame = -3

Query: 158  YHHHHHQREVIS 123
            +HHHHH    +S
Sbjct: 1082 HHHHHHSGSAVS 1093



 Score = 20.8 bits (42), Expect(7) = 0.14
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 1078 HHHHHH 1083



 Score = 20.8 bits (42), Expect(7) = 0.14
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 1077 HHHHHH 1082



 Score = 20.8 bits (42), Expect(7) = 0.14
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 1076 HHHHHH 1081



 Score = 20.8 bits (42), Expect(7) = 0.14
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 1075 HHHHHH 1080



 Score = 20.8 bits (42), Expect(7) = 0.14
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 1074 HHHHHH 1079



 Score = 20.8 bits (42), Expect(7) = 0.14
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 1073 HHHHHH 1078



>gb:AE014298_1125574 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003493_1212583 Drosophila melanogaster
           chromosome X, section 45 of 74 of the complete sequence.
          Length = 802

 Score = 23.9 bits (50), Expect(6) = 0.14
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 575 HHHHHHQQQ 583



 Score = 21.9 bits (45), Expect(6) = 0.14
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 574 HHHHHHHQQ 582



 Score = 21.6 bits (44), Expect(6) = 0.14
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 573 HHHHHHHHQ 581



 Score = 20.8 bits (42), Expect(6) = 0.14
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 572 HHHHHH 577



 Score = 20.8 bits (42), Expect(6) = 0.14
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 571 HHHHHH 576



 Score = 20.8 bits (42), Expect(6) = 0.14
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 570 HHHHHH 575



>gb:AY061372_1293175 Drosophila melanogaster LD29423 full length
           cDNA.
          Length = 1283

 Score = 22.7 bits (47), Expect(7) = 0.14
 Identities = 6/12 (50%), Positives = 8/12 (66%)
 Frame = -3

Query: 158 YHHHHHQREVIS 123
           +HHHHH    +S
Sbjct: 454 HHHHHHSGSAVS 465



 Score = 20.8 bits (42), Expect(7) = 0.14
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 450 HHHHHH 455



 Score = 20.8 bits (42), Expect(7) = 0.14
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 449 HHHHHH 454



 Score = 20.8 bits (42), Expect(7) = 0.14
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 448 HHHHHH 453



 Score = 20.8 bits (42), Expect(7) = 0.14
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 447 HHHHHH 452



 Score = 20.8 bits (42), Expect(7) = 0.14
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 446 HHHHHH 451



 Score = 20.8 bits (42), Expect(7) = 0.14
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 445 HHHHHH 450



>gb:AF362370_1265603 Dictyostelium discoideum histidine kinase DhkH
           (dhkH) gene, partial cds.
          Length = 1147

 Score = 21.9 bits (45), Expect(7) = 0.15
 Identities = 6/15 (40%), Positives = 9/15 (60%)
 Frame = -3

Query: 158 YHHHHHQREVISMIL 114
           +HHHHH +     I+
Sbjct: 477 HHHHHHDKHCDQKII 491



 Score = 21.6 bits (44), Expect(7) = 0.15
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 475 HHHHHHHHD 483



 Score = 20.8 bits (42), Expect(7) = 0.15
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 474 HHHHHH 479



 Score = 20.8 bits (42), Expect(7) = 0.15
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 473 HHHHHH 478



 Score = 20.8 bits (42), Expect(7) = 0.15
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 472 HHHHHH 477



 Score = 20.8 bits (42), Expect(7) = 0.15
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 471 HHHHHH 476



 Score = 20.8 bits (42), Expect(7) = 0.15
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 470 HHHHHH 475



>gb:BC075450_2558553 Xenopus tropicalis HRG protein, mRNA (cDNA
           clone IMAGE:7017897), partial cds.>gb:BC089754_2566299
           Xenopus tropicalis cDNA clone IMAGE:7025331, partial
           cds.
          Length = 474

 Score = 20.8 bits (42), Expect(8) = 0.15
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 343 HHHHHH 348



 Score = 20.8 bits (42), Expect(8) = 0.15
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 342 HHHHHH 347



 Score = 20.8 bits (42), Expect(8) = 0.15
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 341 HHHHHH 346



 Score = 20.8 bits (42), Expect(8) = 0.15
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 340 HHHHHH 345



 Score = 20.8 bits (42), Expect(8) = 0.15
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 339 HHHHHH 344



 Score = 20.8 bits (42), Expect(8) = 0.15
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 338 HHHHHH 343



 Score = 20.4 bits (41), Expect(8) = 0.15
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 155 HHHHHQ 138
           HHHHH+
Sbjct: 375 HHHHHK 380



 Score = 20.4 bits (41), Expect(8) = 0.15
 Identities = 6/8 (75%), Positives = 6/8 (75%)
 Frame = -3

Query: 164 RTYHHHHH 141
           R  HHHHH
Sbjct: 357 RHEHHHHH 364



>gb:DMSEG0007_1380154 Drosophila melanogaster sequence EG0007:
           concatenation of cosmids 30D3:40623-16930, 65G3:42474-1.
          Length = 911

 Score = 22.7 bits (47), Expect(7) = 0.15
 Identities = 6/12 (50%), Positives = 8/12 (66%)
 Frame = -3

Query: 158 YHHHHHQREVIS 123
           +HHHHH    +S
Sbjct: 82  HHHHHHSGSAVS 93



 Score = 20.8 bits (42), Expect(7) = 0.15
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 78  HHHHHH 83



 Score = 20.8 bits (42), Expect(7) = 0.15
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 77  HHHHHH 82



 Score = 20.8 bits (42), Expect(7) = 0.15
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 76  HHHHHH 81



 Score = 20.8 bits (42), Expect(7) = 0.15
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 75  HHHHHH 80



 Score = 20.8 bits (42), Expect(7) = 0.15
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 74  HHHHHH 79



 Score = 20.8 bits (42), Expect(7) = 0.15
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 73  HHHHHH 78



>gb:AP003571_1831039 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0458E02.>gb:AP003573_1831110 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0523F01.
          Length = 117

 Score = 21.2 bits (43), Expect(8) = 0.15
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 15  HHHHHHHTQ 23



 Score = 20.8 bits (42), Expect(8) = 0.15
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 14  HHHHHH 19



 Score = 20.8 bits (42), Expect(8) = 0.15
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 13  HHHHHH 18



 Score = 20.8 bits (42), Expect(8) = 0.15
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 12  HHHHHH 17



 Score = 20.8 bits (42), Expect(8) = 0.15
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 11  HHHHHH 16



 Score = 20.8 bits (42), Expect(8) = 0.15
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 10  HHHHHH 15



 Score = 20.8 bits (42), Expect(8) = 0.15
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 9   HHHHHH 14



 Score = 20.8 bits (42), Expect(8) = 0.15
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 8   HHHHHH 13



>pir|S41512|S41512 Brn-3b protein - mouse
          Length = 236

 Score = 23.9 bits (50), Expect(6) = 0.17
 Identities = 6/10 (60%), Positives = 9/10 (90%)
 Frame = -3

Query: 158 YHHHHHQREV 129
           +HHHHH R++
Sbjct: 83  HHHHHHHRDL 92



 Score = 22.7 bits (47), Expect(6) = 0.17
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           T+HHHHH
Sbjct: 77  THHHHHH 83



 Score = 20.8 bits (42), Expect(6) = 0.17
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 82  HHHHHH 87



 Score = 20.8 bits (42), Expect(6) = 0.17
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 81  HHHHHH 86



 Score = 20.8 bits (42), Expect(6) = 0.17
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 80  HHHHHH 85



 Score = 20.8 bits (42), Expect(6) = 0.17
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 79  HHHHHH 84



>pir|T51023|T51023 hypothetical protein B7F21.40 [imported] -
           Neurospora crassa
          Length = 2649

 Score = 22.7 bits (47), Expect(6) = 0.18
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 9   HHHHHHQ 15



 Score = 21.9 bits (45), Expect(6) = 0.18
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 8   HHHHHHHQD 16



 Score = 21.6 bits (44), Expect(6) = 0.18
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 7   HHHHHHHHQ 15



 Score = 21.2 bits (43), Expect(6) = 0.18
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 4   FHHHHH 9



 Score = 20.8 bits (42), Expect(6) = 0.18
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 6   HHHHHH 11



 Score = 20.8 bits (42), Expect(6) = 0.18
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 5   HHHHHH 10



>gb:NCB7F21_1690152 Neurospora crassa DNA linkage group II BAC clone
           B7F21.
          Length = 2592

 Score = 22.7 bits (47), Expect(6) = 0.18
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 9   HHHHHHQ 15



 Score = 21.9 bits (45), Expect(6) = 0.18
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 8   HHHHHHHQD 16



 Score = 21.6 bits (44), Expect(6) = 0.18
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 7   HHHHHHHHQ 15



 Score = 21.2 bits (43), Expect(6) = 0.18
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 4   FHHHHH 9



 Score = 20.8 bits (42), Expect(6) = 0.18
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 6   HHHHHH 11



 Score = 20.8 bits (42), Expect(6) = 0.18
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 5   HHHHHH 10



>pir|A46390|A46390 cAMP receptor subtype 2, CAR2 - slime mold
           (Dictyostelium discoideum)
          Length = 375

 Score = 22.3 bits (46), Expect(7) = 0.18
 Identities = 7/18 (38%), Positives = 12/18 (66%)
 Frame = -3

Query: 194 NSIKLIRKDLRTYHHHHH 141
           N+I+  +++    HHHHH
Sbjct: 333 NNIETPKENENQNHHHHH 350



 Score = 21.2 bits (43), Expect(7) = 0.18
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = -3

Query: 164 RTYHHHHH 141
           + +HHHHH
Sbjct: 344 QNHHHHHH 351



 Score = 20.8 bits (42), Expect(7) = 0.18
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 351 HHHHHH 356



 Score = 20.8 bits (42), Expect(7) = 0.18
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 350 HHHHHH 355



 Score = 20.8 bits (42), Expect(7) = 0.18
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 349 HHHHHH 354



 Score = 20.8 bits (42), Expect(7) = 0.18
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 348 HHHHHH 353



 Score = 20.8 bits (42), Expect(7) = 0.18
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 347 HHHHHH 352



>sp|P34907|CAR2_DICDI Cyclic AMP receptor 2.>gb:S55234_1396618
           Dictyostelium discoideum cAMP receptor subtype 2 (CAR2)
           gene, complete cds.
          Length = 375

 Score = 22.3 bits (46), Expect(7) = 0.18
 Identities = 7/18 (38%), Positives = 12/18 (66%)
 Frame = -3

Query: 194 NSIKLIRKDLRTYHHHHH 141
           N+I+  +++    HHHHH
Sbjct: 333 NNIETPKENENQNHHHHH 350



 Score = 21.2 bits (43), Expect(7) = 0.18
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = -3

Query: 164 RTYHHHHH 141
           + +HHHHH
Sbjct: 344 QNHHHHHH 351



 Score = 20.8 bits (42), Expect(7) = 0.18
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 351 HHHHHH 356



 Score = 20.8 bits (42), Expect(7) = 0.18
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 350 HHHHHH 355



 Score = 20.8 bits (42), Expect(7) = 0.18
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 349 HHHHHH 354



 Score = 20.8 bits (42), Expect(7) = 0.18
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 348 HHHHHH 353



 Score = 20.8 bits (42), Expect(7) = 0.18
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 347 HHHHHH 352



>gb:HSGATA6PR_2013389 H.sapiens mRNA for GATA-6 DNA-binding protein.
          Length = 449

 Score = 25.4 bits (54), Expect(6) = 0.19
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = -3

Query: 197 WNSIKLIRKDLRTYHHHHH 141
           ++S+   R    TYHHHHH
Sbjct: 164 YSSLSAARPLNGTYHHHHH 182



 Score = 20.8 bits (42), Expect(6) = 0.19
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 182 HHHHHH 187



 Score = 20.8 bits (42), Expect(6) = 0.19
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 181 HHHHHH 186



 Score = 20.8 bits (42), Expect(6) = 0.19
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 180 HHHHHH 185



 Score = 20.8 bits (42), Expect(6) = 0.19
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 179 HHHHHH 184



 Score = 20.8 bits (42), Expect(6) = 0.19
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 178 HHHHHH 183



>sp|Q92908|GAT6_HUMAN Transcription factor GATA-6 (GATA binding
           factor-6).>gb:D87811_1995375 Homo sapiens mRNA for
           GATA-6, complete cds.>gb:HSU66075_2025538 Human
           transcription factor hGATA-6 mRNA, complete cds.
          Length = 449

 Score = 25.4 bits (54), Expect(6) = 0.19
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = -3

Query: 197 WNSIKLIRKDLRTYHHHHH 141
           ++S+   R    TYHHHHH
Sbjct: 164 YSSLSAARPLNGTYHHHHH 182



 Score = 20.8 bits (42), Expect(6) = 0.19
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 182 HHHHHH 187



 Score = 20.8 bits (42), Expect(6) = 0.19
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 181 HHHHHH 186



 Score = 20.8 bits (42), Expect(6) = 0.19
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 180 HHHHHH 185



 Score = 20.8 bits (42), Expect(6) = 0.19
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 179 HHHHHH 184



 Score = 20.8 bits (42), Expect(6) = 0.19
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 178 HHHHHH 183



>sp|Q63934|PO42_MOUSE POU domain, class 4, transcription factor 2
           (Brain-specific homeobox/POU domain protein 3B) (Brn-3B)
           (Brn-3.2).>pir|I58156|I58156 Brn-3.2 -
           mouse>gb:AK087546_1174972 Mus musculus 0 day neonate
           eyeball cDNA, RIKEN full-length enriched library,
           clone:E130318E11 product:POU domain, class 4,
           transcription factor 2, full insert
           sequence.>gb:S68377_2138959 Brn-3.2=Brn-3-related POU
           transcription factor [mice, teratocarcinoma cell line
           F9, mRNA, 1915 nt].
          Length = 411

 Score = 22.7 bits (47), Expect(6) = 0.19
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 179 HHHHHHQ 185



 Score = 22.7 bits (47), Expect(6) = 0.19
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           T+HHHHH
Sbjct: 172 THHHHHH 178



 Score = 21.6 bits (44), Expect(6) = 0.19
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 177 HHHHHHHHQ 185



 Score = 20.8 bits (42), Expect(6) = 0.19
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 176 HHHHHH 181



 Score = 20.8 bits (42), Expect(6) = 0.19
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 175 HHHHHH 180



 Score = 20.8 bits (42), Expect(6) = 0.19
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 174 HHHHHH 179



>sp|Q12837|PO42_HUMAN POU domain, class 4, transcription factor 2
           (Brain-specific homeobox/POU domain protein 3B)
           (Brn-3B).>pir|I38502|I38502 gene Brn-3b protein -
           human>gb:HSU06233_2021626 Human POU domain protein
           (Brn-3b) mRNA, complete cds.
          Length = 410

 Score = 22.7 bits (47), Expect(6) = 0.19
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 178 HHHHHHQ 184



 Score = 22.7 bits (47), Expect(6) = 0.19
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           T+HHHHH
Sbjct: 171 THHHHHH 177



 Score = 21.6 bits (44), Expect(6) = 0.19
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 176 HHHHHHHHQ 184



 Score = 20.8 bits (42), Expect(6) = 0.19
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 175 HHHHHH 180



 Score = 20.8 bits (42), Expect(6) = 0.19
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 174 HHHHHH 179



 Score = 20.8 bits (42), Expect(6) = 0.19
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 173 HHHHHH 178



>gb:S69351_2139012 Mus musculus BRN-3b (Brn-3b) gene, complete cds.
          Length = 322

 Score = 22.7 bits (47), Expect(6) = 0.20
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 90  HHHHHHQ 96



 Score = 22.7 bits (47), Expect(6) = 0.20
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           T+HHHHH
Sbjct: 83  THHHHHH 89



 Score = 21.6 bits (44), Expect(6) = 0.20
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 88  HHHHHHHHQ 96



 Score = 20.8 bits (42), Expect(6) = 0.20
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 87  HHHHHH 92



 Score = 20.8 bits (42), Expect(6) = 0.20
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 86  HHHHHH 91



 Score = 20.8 bits (42), Expect(6) = 0.20
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 85  HHHHHH 90



>gb:AF526419_2499134 Gallus gallus class IV POU-domain transcription
           factor Brn-3.2 mRNA, partial cds.
          Length = 244

 Score = 22.7 bits (47), Expect(6) = 0.22
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 42  HHHHHHQ 48



 Score = 22.7 bits (47), Expect(6) = 0.22
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           T+HHHHH
Sbjct: 35  THHHHHH 41



 Score = 21.6 bits (44), Expect(6) = 0.22
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 40  HHHHHHHHQ 48



 Score = 20.8 bits (42), Expect(6) = 0.22
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 39  HHHHHH 44



 Score = 20.8 bits (42), Expect(6) = 0.22
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 38  HHHHHH 43



 Score = 20.8 bits (42), Expect(6) = 0.22
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 37  HHHHHH 42



>pir|H82172|H82172 heat shock protein HslJ VC1663 [imported] -
           Vibrio cholerae  (strain N16961 serogroup
           O1)>gb:AE004244_52043 Vibrio cholerae O1 biovar eltor
           str. N16961 chromosome I, section 152 of 251 of the
           complete chromosome.>gb:AE003852_1052817 Vibrio cholerae
           O1 biovar eltor str. N16961 chromosome I, complete
           chromosome.
          Length = 147

 Score = 37.4 bits (85), Expect = 0.22
 Identities = 17/54 (31%), Positives = 29/54 (53%)
 Frame = +1

Query: 319 TSVDGGEVPKGDYSGHPEGELGSKLKGPGSISDGNMAGKSPSKDMIFRADKIDL 480
           T +DG +V K ++   P  E+G ++   G+    N  GK+  KD  FR +K+ +
Sbjct: 43  TQIDGKDVVKSEHEQAPRLEIGEQMMASGNAGCNNFFGKAELKDNQFRIEKMGM 96



>gb:AF434665_2494272 Petromyzon marinus Hox1w (hox1w) mRNA, partial
           cds.
          Length = 404

 Score = 23.9 bits (50), Expect(6) = 0.25
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 82  HHHHHHQQQ 90



 Score = 21.9 bits (45), Expect(6) = 0.25
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 81  HHHHHHHQQ 89



 Score = 20.8 bits (42), Expect(6) = 0.25
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHH Q++
Sbjct: 83  HHHHHQQQQ 91



 Score = 20.8 bits (42), Expect(6) = 0.25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 74  HHHHHH 79



 Score = 20.8 bits (42), Expect(6) = 0.25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 73  HHHHHH 78



 Score = 20.8 bits (42), Expect(6) = 0.25
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 72  HHHHHH 77



>gb:BC065961_2554215 Danio rerio POU domain gene 12, mRNA (cDNA
           clone MGC:76858 IMAGE:6969114), complete cds.
          Length = 446

 Score = 23.9 bits (50), Expect(5) = 0.33
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 211 HHHHHHQQQ 219



 Score = 22.7 bits (47), Expect(5) = 0.33
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 222 HHHHHHQ 228



 Score = 21.9 bits (45), Expect(5) = 0.33
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 210 HHHHHHHQQ 218



 Score = 21.6 bits (44), Expect(5) = 0.33
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 209 HHHHHHHHQ 217



 Score = 20.4 bits (41), Expect(5) = 0.33
 Identities = 5/7 (71%), Positives = 6/7 (85%)
 Frame = -3

Query: 155 HHHHHQR 135
           HHHHH +
Sbjct: 222 HHHHHHQ 228



>gb:BC058318_2552289 Danio rerio POU domain gene 12, mRNA (cDNA
           clone MGC:65765 IMAGE:6801552), complete cds.
          Length = 438

 Score = 23.9 bits (50), Expect(5) = 0.33
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 211 HHHHHHQQQ 219



 Score = 22.7 bits (47), Expect(5) = 0.33
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 222 HHHHHHQ 228



 Score = 21.9 bits (45), Expect(5) = 0.33
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 210 HHHHHHHQQ 218



 Score = 21.6 bits (44), Expect(5) = 0.33
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 209 HHHHHHHHQ 217



 Score = 20.4 bits (41), Expect(5) = 0.33
 Identities = 5/7 (71%), Positives = 6/7 (85%)
 Frame = -3

Query: 155 HHHHHQR 135
           HHHHH +
Sbjct: 222 HHHHHHQ 228



>gb:BC056601_2551871 Danio rerio one cut domain, family member 1,
           like, mRNA (cDNA clone MGC:65904 IMAGE:6801714),
           complete cds.
          Length = 461

 Score = 21.6 bits (44), Expect(7) = 0.34
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -3

Query: 158 YHHHHHQREVI 126
           +HHHHH  + I
Sbjct: 122 HHHHHHPHQRI 132



 Score = 20.8 bits (42), Expect(7) = 0.34
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 121 HHHHHH 126



 Score = 20.8 bits (42), Expect(7) = 0.34
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 120 HHHHHH 125



 Score = 20.8 bits (42), Expect(7) = 0.34
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 119 HHHHHH 124



 Score = 20.8 bits (42), Expect(7) = 0.34
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 118 HHHHHH 123



 Score = 20.8 bits (42), Expect(7) = 0.34
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 117 HHHHHH 122



 Score = 20.8 bits (42), Expect(7) = 0.34
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 116 HHHHHH 121



>gb:AY835394_2546830 Danio rerio onecut-1 isoform b (oc1) mRNA,
           complete cds.
          Length = 461

 Score = 21.6 bits (44), Expect(7) = 0.34
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -3

Query: 158 YHHHHHQREVI 126
           +HHHHH  + I
Sbjct: 122 HHHHHHPHQRI 132



 Score = 20.8 bits (42), Expect(7) = 0.34
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 121 HHHHHH 126



 Score = 20.8 bits (42), Expect(7) = 0.34
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 120 HHHHHH 125



 Score = 20.8 bits (42), Expect(7) = 0.34
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 119 HHHHHH 124



 Score = 20.8 bits (42), Expect(7) = 0.34
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 118 HHHHHH 123



 Score = 20.8 bits (42), Expect(7) = 0.34
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 117 HHHHHH 122



 Score = 20.8 bits (42), Expect(7) = 0.34
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 116 HHHHHH 121



>gb:BC066466_2554355 Danio rerio one cut domain, family member 1,
           like, mRNA (cDNA clone MGC:77450 IMAGE:6971400),
           complete cds.
          Length = 456

 Score = 21.6 bits (44), Expect(7) = 0.34
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -3

Query: 158 YHHHHHQREVI 126
           +HHHHH  + I
Sbjct: 122 HHHHHHPHQRI 132



 Score = 20.8 bits (42), Expect(7) = 0.34
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 121 HHHHHH 126



 Score = 20.8 bits (42), Expect(7) = 0.34
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 120 HHHHHH 125



 Score = 20.8 bits (42), Expect(7) = 0.34
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 119 HHHHHH 124



 Score = 20.8 bits (42), Expect(7) = 0.34
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 118 HHHHHH 123



 Score = 20.8 bits (42), Expect(7) = 0.34
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 117 HHHHHH 122



 Score = 20.8 bits (42), Expect(7) = 0.34
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 116 HHHHHH 121



>gb:AY835393_2546829 Danio rerio onecut-1 isoform a (oc1) mRNA,
           complete cds.
          Length = 456

 Score = 21.6 bits (44), Expect(7) = 0.34
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -3

Query: 158 YHHHHHQREVI 126
           +HHHHH  + I
Sbjct: 122 HHHHHHPHQRI 132



 Score = 20.8 bits (42), Expect(7) = 0.34
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 121 HHHHHH 126



 Score = 20.8 bits (42), Expect(7) = 0.34
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 120 HHHHHH 125



 Score = 20.8 bits (42), Expect(7) = 0.34
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 119 HHHHHH 124



 Score = 20.8 bits (42), Expect(7) = 0.34
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 118 HHHHHH 123



 Score = 20.8 bits (42), Expect(7) = 0.34
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 117 HHHHHH 122



 Score = 20.8 bits (42), Expect(7) = 0.34
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 116 HHHHHH 121



>gb:AC115598_1205761 Dictyostelium discoideum chromosome 2 map
           581427-735498 strain AX4, complete sequence.
          Length = 1033

 Score = 22.7 bits (47), Expect(6) = 0.41
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           YHHHHH
Sbjct: 757 YHHHHH 762



 Score = 21.9 bits (45), Expect(6) = 0.41
 Identities = 7/18 (38%), Positives = 10/18 (55%)
 Frame = -3

Query: 194 NSIKLIRKDLRTYHHHHH 141
           NS+       + +HHHHH
Sbjct: 746 NSVNSNNTPSQYHHHHHH 763



 Score = 20.8 bits (42), Expect(6) = 0.41
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 762 HHHHHH 767



 Score = 20.8 bits (42), Expect(6) = 0.41
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 761 HHHHHH 766



 Score = 20.8 bits (42), Expect(6) = 0.41
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 760 HHHHHH 765



 Score = 20.8 bits (42), Expect(6) = 0.41
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 759 HHHHHH 764



>gb:AC117082_1207978 Dictyostelium discoideum chromosome 2 map
           complement(6807709-6776860) strain AX4, complete
           sequence.
          Length = 748

 Score = 23.9 bits (50), Expect(5) = 0.76
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 394 HHHHHHQQQ 402



 Score = 21.9 bits (45), Expect(5) = 0.76
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 393 HHHHHHHQQ 401



 Score = 21.6 bits (44), Expect(5) = 0.76
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 392 HHHHHHHHQ 400



 Score = 20.8 bits (42), Expect(5) = 0.76
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 391 HHHHHH 396



 Score = 20.8 bits (42), Expect(5) = 0.76
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 390 HHHHHH 395



>sp|P54842|MAFB_RAT Transcription factor MafB (V-maf
           musculoaponeurotic fibrosarcoma oncogene homolog B)
           (Transcription factor MAF1).>gb:RNU56241_2137468 Rattus
           norvegicus transcription factor Maf1 mRNA, complete cds.
          Length = 323

 Score = 22.7 bits (47), Expect(6) = 0.81
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 162 HHHHHHQ 168



 Score = 21.6 bits (44), Expect(6) = 0.81
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 164 RTYHHHHH 141
           R+ HHHHH
Sbjct: 128 RSAHHHHH 135



 Score = 20.8 bits (42), Expect(6) = 0.81
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 133 HHHHHH 138



 Score = 20.8 bits (42), Expect(6) = 0.81
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 132 HHHHHH 137



 Score = 20.8 bits (42), Expect(6) = 0.81
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 131 HHHHHH 136



 Score = 20.4 bits (41), Expect(6) = 0.81
 Identities = 5/7 (71%), Positives = 6/7 (85%)
 Frame = -3

Query: 155 HHHHHQR 135
           HHHHH +
Sbjct: 162 HHHHHHQ 168



>sp|P54841|MAFB_MOUSE Transcription factor MafB (V-maf
           musculoaponeurotic fibrosarcoma oncogene homolog B)
           (Transcription factor MAF1) (Segmentation protein KR)
           (Kreisler).>pir|I49529|I49529 transcription factor-kr -
           mouse>gb:AF180338_2058040 Mus musculus transcription
           factor MAFB (Mafb) gene, complete
           cds.>gb:BC016434_2092303 Mus musculus v-maf
           musculoaponeurotic fibrosarcoma oncogene family, protein
           B (avian), mRNA (cDNA clone MGC:25341 IMAGE:4485468),
           complete cds.>gb:BC038256_2098217 Mus musculus v-maf
           musculoaponeurotic fibrosarcoma oncogene family, protein
           B (avian), mRNA (cDNA clone MGC:47160 IMAGE:5097650),
           complete cds.>gb:MUSBDLZA_2125246 Mus Musculus basic
           domain/leucine zipper transcription factor mRNA,
           complete cds.
          Length = 323

 Score = 22.7 bits (47), Expect(6) = 0.81
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 162 HHHHHHQ 168



 Score = 21.6 bits (44), Expect(6) = 0.81
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 164 RTYHHHHH 141
           R+ HHHHH
Sbjct: 128 RSAHHHHH 135



 Score = 20.8 bits (42), Expect(6) = 0.81
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 133 HHHHHH 138



 Score = 20.8 bits (42), Expect(6) = 0.81
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 132 HHHHHH 137



 Score = 20.8 bits (42), Expect(6) = 0.81
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 131 HHHHHH 136



 Score = 20.4 bits (41), Expect(6) = 0.81
 Identities = 5/7 (71%), Positives = 6/7 (85%)
 Frame = -3

Query: 155 HHHHHQR 135
           HHHHH +
Sbjct: 162 HHHHHHQ 168



>gb:HSBRN3B_2011116 H.sapiens Brn3B mRNA.
          Length = 264

 Score = 22.7 bits (47), Expect(5) = 1.2
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 32  HHHHHHQ 38



 Score = 22.7 bits (47), Expect(5) = 1.2
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           T+HHHHH
Sbjct: 26  THHHHHH 32



 Score = 21.6 bits (44), Expect(5) = 1.2
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 30  HHHHHHHHQ 38



 Score = 20.8 bits (42), Expect(5) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 29  HHHHHH 34



 Score = 20.8 bits (42), Expect(5) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 28  HHHHHH 33



>gb:RNHNF6B_2135014 R.norvegicus mRNA for hepatocyte nuclear factor
           6 beta.
          Length = 491

 Score = 22.3 bits (46), Expect(6) = 1.2
 Identities = 9/28 (32%), Positives = 13/28 (46%)
 Frame = -3

Query: 158 YHHHHHQREVISMILNVQKIFKNKKPEK 75
           +HHHHH      +  NV   F   + E+
Sbjct: 129 HHHHHHPHHHQRLAGNVSGSFTLMRDER 156



 Score = 20.8 bits (42), Expect(6) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 128 HHHHHH 133



 Score = 20.8 bits (42), Expect(6) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 127 HHHHHH 132



 Score = 20.8 bits (42), Expect(6) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 126 HHHHHH 131



 Score = 20.8 bits (42), Expect(6) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 125 HHHHHH 130



 Score = 20.8 bits (42), Expect(6) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 124 HHHHHH 129



>sp|P70512|HNF6_RAT Hepatocyte nuclear factor 6 (HNF-6) (One cut
           domain family member 1).>gb:RNHNF6A_2135013 R.norvegicus
           mRNA for hepatocyte nuclear factor 6 alpha.
          Length = 465

 Score = 22.3 bits (46), Expect(6) = 1.2
 Identities = 9/28 (32%), Positives = 13/28 (46%)
 Frame = -3

Query: 158 YHHHHHQREVISMILNVQKIFKNKKPEK 75
           +HHHHH      +  NV   F   + E+
Sbjct: 129 HHHHHHPHHHQRLAGNVSGSFTLMRDER 156



 Score = 20.8 bits (42), Expect(6) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 128 HHHHHH 133



 Score = 20.8 bits (42), Expect(6) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 127 HHHHHH 132



 Score = 20.8 bits (42), Expect(6) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 126 HHHHHH 131



 Score = 20.8 bits (42), Expect(6) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 125 HHHHHH 130



 Score = 20.8 bits (42), Expect(6) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 124 HHHHHH 129



>sp|O08755|HNF6_MOUSE Hepatocyte nuclear factor 6 (HNF-6) (One cut
           domain family member 1).>gb:BC024053_2094351 Mus
           musculus one cut domain, family member 1, mRNA (cDNA
           clone MGC:36136 IMAGE:5101697), complete
           cds.>gb:MMU95945_2124148 Mus musculus hepatocyte nuclear
           factor 6 (HNF-6) mRNA, complete cds.
          Length = 465

 Score = 22.3 bits (46), Expect(6) = 1.2
 Identities = 9/28 (32%), Positives = 13/28 (46%)
 Frame = -3

Query: 158 YHHHHHQREVISMILNVQKIFKNKKPEK 75
           +HHHHH      +  NV   F   + E+
Sbjct: 129 HHHHHHPHHHQRLAGNVSGSFTLMRDER 156



 Score = 20.8 bits (42), Expect(6) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 128 HHHHHH 133



 Score = 20.8 bits (42), Expect(6) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 127 HHHHHH 132



 Score = 20.8 bits (42), Expect(6) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 126 HHHHHH 131



 Score = 20.8 bits (42), Expect(6) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 125 HHHHHH 130



 Score = 20.8 bits (42), Expect(6) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 124 HHHHHH 129



>sp|Q9UBC0|HNF6_HUMAN Hepatocyte nuclear factor 6 (HNF-6) (One cut
           domain family member 1).>gb:HSHNF6A2_2014159 Homo
           sapiens hepatocyte nuclear factor 6 (HNF6) gene, exon 2
           and complete cds.>gb:HSU96173_2027778 Human hepatocyte
           nuclear factor-6 alpha (HNF6) mRNA, complete cds.
          Length = 465

 Score = 22.3 bits (46), Expect(6) = 1.2
 Identities = 9/28 (32%), Positives = 13/28 (46%)
 Frame = -3

Query: 158 YHHHHHQREVISMILNVQKIFKNKKPEK 75
           +HHHHH      +  NV   F   + E+
Sbjct: 129 HHHHHHPHHHQRLAGNVSGSFTLMRDER 156



 Score = 20.8 bits (42), Expect(6) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 128 HHHHHH 133



 Score = 20.8 bits (42), Expect(6) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 127 HHHHHH 132



 Score = 20.8 bits (42), Expect(6) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 126 HHHHHH 131



 Score = 20.8 bits (42), Expect(6) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 125 HHHHHH 130



 Score = 20.8 bits (42), Expect(6) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 124 HHHHHH 129



>gb:HSA17739_2000436 Homo sapiens HNF-6 gene, partial.
          Length = 368

 Score = 22.3 bits (46), Expect(6) = 1.2
 Identities = 9/28 (32%), Positives = 13/28 (46%)
 Frame = -3

Query: 158 YHHHHHQREVISMILNVQKIFKNKKPEK 75
           +HHHHH      +  NV   F   + E+
Sbjct: 129 HHHHHHPHHHQRLAGNVSGSFTLMRDER 156



 Score = 20.8 bits (42), Expect(6) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 128 HHHHHH 133



 Score = 20.8 bits (42), Expect(6) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 127 HHHHHH 132



 Score = 20.8 bits (42), Expect(6) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 126 HHHHHH 131



 Score = 20.8 bits (42), Expect(6) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 125 HHHHHH 130



 Score = 20.8 bits (42), Expect(6) = 1.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 124 HHHHHH 129



>gb:AY436753_1326170 Ptychodera flava transcription factor Hox1
           mRNA, complete cds.
          Length = 334

 Score = 21.6 bits (44), Expect(6) = 1.3
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 152 HHHHHHHHD 160



 Score = 21.2 bits (43), Expect(6) = 1.3
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = -3

Query: 158 YHHHHHQR 135
           +HHHHH +
Sbjct: 154 HHHHHHDQ 161



 Score = 21.2 bits (43), Expect(6) = 1.3
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -3

Query: 161 TYHHHHH 141
           T HHHHH
Sbjct: 148 TNHHHHH 154



 Score = 20.8 bits (42), Expect(6) = 1.3
 Identities = 5/8 (62%), Positives = 7/8 (87%)
 Frame = -3

Query: 155 HHHHHQRE 132
           HHHHH ++
Sbjct: 162 HHHHHPQQ 169



 Score = 20.8 bits (42), Expect(6) = 1.3
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 151 HHHHHH 156



 Score = 20.8 bits (42), Expect(6) = 1.3
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 150 HHHHHH 155



>sp|P40349|URB1_USTMA Siderophore biosynthesis regulatory protein
           URBS1.>pir|S27473|S27473 URBS1 protein - smut fungus
           (Ustilago maydis)>gb:USMURBS1A_1726941 Ustilago maydis
           URBS1 protein (urbS1) gene, complete cds.
          Length = 950

 Score = 21.9 bits (45), Expect(6) = 1.3
 Identities = 6/12 (50%), Positives = 8/12 (66%)
 Frame = -3

Query: 158 YHHHHHQREVIS 123
           +HHHHH    +S
Sbjct: 774 HHHHHHHPVTVS 785



 Score = 20.8 bits (42), Expect(6) = 1.3
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 757 HHHHHH 762



 Score = 20.8 bits (42), Expect(6) = 1.3
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 756 HHHHHH 761



 Score = 20.8 bits (42), Expect(6) = 1.3
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 755 HHHHHH 760



 Score = 20.8 bits (42), Expect(6) = 1.3
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 754 HHHHHH 759



 Score = 20.8 bits (42), Expect(6) = 1.3
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 753 HHHHHH 758



>gb:AP004728_1843871 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0583E12.
          Length = 1590

 Score = 24.6 bits (52), Expect(5) = 1.4
 Identities = 7/7 (100%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           TYHHHHH
Sbjct: 24  TYHHHHH 30



 Score = 20.8 bits (42), Expect(5) = 1.4
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 29  HHHHHH 34



 Score = 20.8 bits (42), Expect(5) = 1.4
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 28  HHHHHH 33



 Score = 20.8 bits (42), Expect(5) = 1.4
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 27  HHHHHH 32



 Score = 20.8 bits (42), Expect(5) = 1.4
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 26  HHHHHH 31



>gb:AC125735_1208090 Leishmania major strain Friedlin chromosome 3,
           complete sequence.
          Length = 2087

 Score = 21.6 bits (44), Expect(6) = 1.4
 Identities = 6/10 (60%), Positives = 7/10 (70%)
 Frame = -3

Query: 170 DLRTYHHHHH 141
           D   +HHHHH
Sbjct: 722 DAAGWHHHHH 731



 Score = 20.8 bits (42), Expect(6) = 1.4
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 731 HHHHHH 736



 Score = 20.8 bits (42), Expect(6) = 1.4
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 730 HHHHHH 735



 Score = 20.8 bits (42), Expect(6) = 1.4
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 729 HHHHHH 734



 Score = 20.8 bits (42), Expect(6) = 1.4
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 728 HHHHHH 733



 Score = 20.8 bits (42), Expect(6) = 1.4
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 727 HHHHHH 732



>gb:CR382137_1669678 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 744

 Score = 22.7 bits (47), Expect(5) = 1.5
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  E
Sbjct: 485 HHHHHHDNE 493



 Score = 22.7 bits (47), Expect(5) = 1.5
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           T+HHHHH
Sbjct: 478 THHHHHH 484



 Score = 20.8 bits (42), Expect(5) = 1.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 482 HHHHHH 487



 Score = 20.8 bits (42), Expect(5) = 1.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 481 HHHHHH 486



 Score = 20.8 bits (42), Expect(5) = 1.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 480 HHHHHH 485



>gb:AF134157_1885604 Homo sapiens MAFB/Kreisler basic region/leucine
           zipper transcription factor (MAFB) mRNA, complete cds.
          Length = 323

 Score = 22.7 bits (47), Expect(6) = 1.6
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 162 HHHHHHQ 168



 Score = 20.8 bits (42), Expect(6) = 1.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 133 HHHHHH 138



 Score = 20.8 bits (42), Expect(6) = 1.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 132 HHHHHH 137



 Score = 20.8 bits (42), Expect(6) = 1.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 131 HHHHHH 136



 Score = 20.4 bits (41), Expect(6) = 1.6
 Identities = 5/7 (71%), Positives = 6/7 (85%)
 Frame = -3

Query: 155 HHHHHQR 135
           HHHHH +
Sbjct: 162 HHHHHHQ 168



 Score = 20.4 bits (41), Expect(6) = 1.6
 Identities = 6/8 (75%), Positives = 6/8 (75%)
 Frame = -3

Query: 164 RTYHHHHH 141
           R  HHHHH
Sbjct: 128 RGAHHHHH 135



>sp|Q9Y5Q3|MAFB_HUMAN Transcription factor MafB (V-maf
           musculoaponeurotic fibrosarcoma oncogene homolog
           B).>gb:AX881617_1478677 Sequence 16522 from Patent
           EP1074617.>gb:BC028098_1979108 Homo sapiens v-maf
           musculoaponeurotic fibrosarcoma oncogene homolog B
           (avian), mRNA (cDNA clone MGC:39981 IMAGE:5242606),
           complete cds.>gb:BC036689_1982005 Homo sapiens v-maf
           musculoaponeurotic fibrosarcoma oncogene homolog B
           (avian), mRNA (cDNA clone MGC:43127 IMAGE:5261053),
           complete cds.>gb:HS644L1_1999196 Human DNA sequence from
           clone RP4-644L1 on chromosome 20q12 Contains the MAFB
           gene for v-maf musculoaponeurotic fibrosarcoma oncogene
           homolog B (avian), a novel gene and two CpG islands,
           complete sequence.
          Length = 323

 Score = 22.7 bits (47), Expect(6) = 1.6
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 162 HHHHHHQ 168



 Score = 20.8 bits (42), Expect(6) = 1.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 133 HHHHHH 138



 Score = 20.8 bits (42), Expect(6) = 1.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 132 HHHHHH 137



 Score = 20.8 bits (42), Expect(6) = 1.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 131 HHHHHH 136



 Score = 20.4 bits (41), Expect(6) = 1.6
 Identities = 5/7 (71%), Positives = 6/7 (85%)
 Frame = -3

Query: 155 HHHHHQR 135
           HHHHH +
Sbjct: 162 HHHHHHQ 168



 Score = 20.4 bits (41), Expect(6) = 1.6
 Identities = 6/8 (75%), Positives = 6/8 (75%)
 Frame = -3

Query: 164 RTYHHHHH 141
           R  HHHHH
Sbjct: 128 RGAHHHHH 135



>sp|P32870|CYA1_DROME Ca(2+)/calmodulin-responsive adenylate cyclase
            (EC 4.6.1.1) (ATP pyrophosphate-lyase) (Rutabaga
            protein).>pir|D42088|D42088 adenylate cyclase (EC
            4.6.1.1), Ca2+/calmodulin-responsive - fruit fly
            (Drosophila melanogaster)>gb:DRORAC_1382609 Drosophila
            melanogaster rutabaga adenylyl cyclase mRNA, complete
            cds.
          Length = 2248

 Score = 25.0 bits (53), Expect(3) = 1.9
 Identities = 7/14 (50%), Positives = 12/14 (85%)
 Frame = -3

Query: 176  RKDLRTYHHHHHQR 135
            +++ R +HHHHHQ+
Sbjct: 1948 QRNQRYHHHHHHQQ 1961



 Score = 23.9 bits (50), Expect(3) = 1.9
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -3

Query: 158  YHHHHHQRE 132
            YHHHHH ++
Sbjct: 1953 YHHHHHHQQ 1961



 Score = 22.3 bits (46), Expect(3) = 1.9
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -3

Query: 158  YHHHHHQRE 132
            +HHHH QR+
Sbjct: 1955 HHHHHQQRQ 1963



>gb:AF196575_2479495 Xenopus laevis class IV POU-homeodomain protein
           (Brn3a) mRNA, partial cds.
          Length = 358

 Score = 22.7 bits (47), Expect(5) = 2.2
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 89  HHHHHHQ 95



 Score = 22.3 bits (46), Expect(5) = 2.2
 Identities = 5/11 (45%), Positives = 8/11 (72%)
 Frame = -3

Query: 158 YHHHHHQREVI 126
           +HHHHH  + +
Sbjct: 87  HHHHHHHHQAL 97



 Score = 20.8 bits (42), Expect(5) = 2.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 86  HHHHHH 91



 Score = 20.8 bits (42), Expect(5) = 2.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 85  HHHHHH 90



 Score = 20.8 bits (42), Expect(5) = 2.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 84  HHHHHH 89



>gb:AF039952_2470029 Danio rerio type III POU domain protein (zp-12)
           mRNA, complete cds.
          Length = 445

 Score = 23.9 bits (50), Expect(4) = 2.3
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 211 HHHHHHQQQ 219



 Score = 21.9 bits (45), Expect(4) = 2.3
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = -3

Query: 155 HHHHHQ 138
           HHHHHQ
Sbjct: 222 HHHHHQ 227



 Score = 21.9 bits (45), Expect(4) = 2.3
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 210 HHHHHHHQQ 218



 Score = 21.6 bits (44), Expect(4) = 2.3
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 209 HHHHHHHHQ 217



>sp|Q90436|PO33_BRARE Brain-specific homeobox/POU domain protein 1.1
           (Brn-1.1) (Fragment).>gb:DRU43898_2571299 Danio rerio
           alternatively spliced brn-1.1 protein variant (brn-1.1)
           mRNA, partial cds.
          Length = 441

 Score = 23.9 bits (50), Expect(4) = 2.3
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 207 HHHHHHQQQ 215



 Score = 21.9 bits (45), Expect(4) = 2.3
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = -3

Query: 155 HHHHHQ 138
           HHHHHQ
Sbjct: 218 HHHHHQ 223



 Score = 21.9 bits (45), Expect(4) = 2.3
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 206 HHHHHHHQQ 214



 Score = 21.6 bits (44), Expect(4) = 2.3
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 205 HHHHHHHHQ 213



>gb:BC070001_2555480 Danio rerio POU domain gene 12, mRNA (cDNA
           clone MGC:85606 IMAGE:6963958), complete cds.
          Length = 437

 Score = 23.9 bits (50), Expect(4) = 2.3
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 211 HHHHHHQQQ 219



 Score = 21.9 bits (45), Expect(4) = 2.3
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = -3

Query: 155 HHHHHQ 138
           HHHHHQ
Sbjct: 222 HHHHHQ 227



 Score = 21.9 bits (45), Expect(4) = 2.3
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 210 HHHHHHHQQ 218



 Score = 21.6 bits (44), Expect(4) = 2.3
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 209 HHHHHHHHQ 217



>sp|P56224|ZP12_BRARE POU domain protein ZP-12 (Class III POU domain
           protein TAICHI).>gb:DRZP12POU_2571412 D.rerio mRNA for
           zp-12 POU gene, splice variant (postsomitogenesis, 20-28
           hpf).
          Length = 437

 Score = 23.9 bits (50), Expect(4) = 2.3
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 211 HHHHHHQQQ 219



 Score = 21.9 bits (45), Expect(4) = 2.3
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = -3

Query: 155 HHHHHQ 138
           HHHHHQ
Sbjct: 222 HHHHHQ 227



 Score = 21.9 bits (45), Expect(4) = 2.3
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 210 HHHHHHHQQ 218



 Score = 21.6 bits (44), Expect(4) = 2.3
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 209 HHHHHHHHQ 217



>gb:BC044354_2548664 Danio rerio POU domain gene 12, mRNA (cDNA
           clone MGC:55267 IMAGE:3818319), complete cds.
          Length = 434

 Score = 23.9 bits (50), Expect(4) = 2.3
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 211 HHHHHHQQQ 219



 Score = 21.9 bits (45), Expect(4) = 2.3
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = -3

Query: 155 HHHHHQ 138
           HHHHHQ
Sbjct: 222 HHHHHQ 227



 Score = 21.9 bits (45), Expect(4) = 2.3
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 210 HHHHHHHQQ 218



 Score = 21.6 bits (44), Expect(4) = 2.3
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 209 HHHHHHHHQ 217



>gb:DRU77736_2571383 Danio rerio class III POU domain protein
           (taichi) gene, complete cds.>gb:DRZP12POU_2571413
           D.rerio mRNA for zp-12 POU gene, splice variant
           (postsomitogenesis, 20-28 hpf).
          Length = 428

 Score = 23.9 bits (50), Expect(4) = 2.3
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 211 HHHHHHQQQ 219



 Score = 21.9 bits (45), Expect(4) = 2.3
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = -3

Query: 155 HHHHHQ 138
           HHHHHQ
Sbjct: 222 HHHHHQ 227



 Score = 21.9 bits (45), Expect(4) = 2.3
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 210 HHHHHHHQQ 218



 Score = 21.6 bits (44), Expect(4) = 2.3
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 209 HHHHHHHHQ 217



>gb:AP003573_1831095 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0523F01.
          Length = 2068

 Score = 23.1 bits (48), Expect(4) = 2.3
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -3

Query: 158 YHHHHHQR 135
           +HHHHHQ+
Sbjct: 78  HHHHHHQQ 85



 Score = 22.3 bits (46), Expect(4) = 2.3
 Identities = 5/10 (50%), Positives = 9/10 (90%)
 Frame = -3

Query: 158 YHHHHHQREV 129
           +HHHHH +++
Sbjct: 77  HHHHHHHQQL 86



 Score = 22.3 bits (46), Expect(4) = 2.3
 Identities = 6/11 (54%), Positives = 7/11 (63%)
 Frame = -3

Query: 164 RTYHHHHHQRE 132
           R  HHHHH  +
Sbjct: 74  RVQHHHHHHHQ 84



 Score = 21.2 bits (43), Expect(4) = 2.3
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 167 LRTYHHHHH 141
           L  +HHHHH
Sbjct: 59  LPDHHHHHH 67



>gb:AC117075_1207764 Dictyostelium discoideum chromosome 2 map
           5201047-5455781 strain AX4, complete sequence.
          Length = 1461

 Score = 20.8 bits (42), Expect(6) = 2.4
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 826 HHHHHH 831



 Score = 20.8 bits (42), Expect(6) = 2.4
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 825 HHHHHH 830



 Score = 20.8 bits (42), Expect(6) = 2.4
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 824 HHHHHH 829



 Score = 20.8 bits (42), Expect(6) = 2.4
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 823 HHHHHH 828



 Score = 20.8 bits (42), Expect(6) = 2.4
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 822 HHHHHH 827



 Score = 20.8 bits (42), Expect(6) = 2.4
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 821 HHHHHH 826



>gb:AP003685_1832011 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0548E04.>gb:AP007231_1863384 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, PAC
           clone:P0535F09.
          Length = 564

 Score = 33.9 bits (76), Expect = 2.4
 Identities = 17/37 (45%), Positives = 25/37 (67%), Gaps = 3/37 (8%)
 Frame = +1

Query: 541 HQVQRPKE---DWEIDPLKLEIRYLIAQGTYGTVYRG 642
           + VQ PK+   +WEI+   L+I+  +A GTYG +YRG
Sbjct: 266 NHVQIPKDNTDEWEINFDVLDIQEKVASGTYGDLYRG 302



>gb:AE014297_1141245 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003749_1223238 Drosophila melanogaster
           chromosome 3R, section 87 of 118 of the complete
           sequence.>gb:AY119230_1300952 Drosophila melanogaster
           SD17695 full insert cDNA.
          Length = 640

 Score = 22.7 bits (47), Expect(5) = 2.5
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 192 HHHHHHQ 198



 Score = 21.9 bits (45), Expect(5) = 2.5
 Identities = 5/10 (50%), Positives = 8/10 (80%)
 Frame = -3

Query: 158 YHHHHHQREV 129
           +HHHHH  ++
Sbjct: 190 HHHHHHHHQL 199



 Score = 20.8 bits (42), Expect(5) = 2.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 189 HHHHHH 194



 Score = 20.8 bits (42), Expect(5) = 2.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 188 HHHHHH 193



 Score = 20.8 bits (42), Expect(5) = 2.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 187 HHHHHH 192



>gb:AB066609_2047131 Mus musculus Cacna1a mRNA for CaV2.1, complete
            cds, clone:MPII.
          Length = 2365

 Score = 22.3 bits (46), Expect(5) = 2.6
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 164  RTYHHHHH 141
            R +HHHHH
Sbjct: 2160 RPHHHHHH 2167



 Score = 21.9 bits (45), Expect(5) = 2.6
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 176  RKDLRTYHHHHH 141
            RK    +HHHHH
Sbjct: 2157 RKHRPHHHHHHH 2168



 Score = 20.8 bits (42), Expect(5) = 2.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 2166 HHHHHH 2171



 Score = 20.8 bits (42), Expect(5) = 2.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 2165 HHHHHH 2170



 Score = 20.8 bits (42), Expect(5) = 2.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 2164 HHHHHH 2169



>gb:AB066608_2047130 Mus musculus Cacna1a mRNA for CaV2.1, complete
            cds, clone:MPI.
          Length = 2327

 Score = 22.3 bits (46), Expect(5) = 2.6
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 164  RTYHHHHH 141
            R +HHHHH
Sbjct: 2160 RPHHHHHH 2167



 Score = 21.9 bits (45), Expect(5) = 2.6
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 176  RKDLRTYHHHHH 141
            RK    +HHHHH
Sbjct: 2157 RKHRPHHHHHHH 2168



 Score = 20.8 bits (42), Expect(5) = 2.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 2166 HHHHHH 2171



 Score = 20.8 bits (42), Expect(5) = 2.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 2165 HHHHHH 2170



 Score = 20.8 bits (42), Expect(5) = 2.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 2164 HHHHHH 2169



>sp|P54282|CCAA_RAT Voltage-dependent P/Q-type calcium channel
            alpha-1A subunit (Voltage- gated calcium channel alpha
            subunit Cav2.1) (Calcium channel, L type, alpha-1
            polypeptide, isoform 4) (Brain calcium channel I) (BI)
            (RAT brain class A) (RBA-I).>pir|A41098|A41098 calcium
            channel protein alpha-1 chain isoform A -
            rat>gb:RATBCCA1S_2131601 Rat calcium channel alpha-1
            subunit mRNA, complete cds.
          Length = 2212

 Score = 22.3 bits (46), Expect(5) = 2.6
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 164  RTYHHHHH 141
            R +HHHHH
Sbjct: 2160 RPHHHHHH 2167



 Score = 21.9 bits (45), Expect(5) = 2.6
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 176  RKDLRTYHHHHH 141
            RK    +HHHHH
Sbjct: 2157 RKHRPHHHHHHH 2168



 Score = 20.8 bits (42), Expect(5) = 2.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 2166 HHHHHH 2171



 Score = 20.8 bits (42), Expect(5) = 2.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 2165 HHHHHH 2170



 Score = 20.8 bits (42), Expect(5) = 2.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 2164 HHHHHH 2169



>sp|P97445|CCAA_MOUSE Voltage-dependent P/Q-type calcium channel
            alpha-1A subunit (Voltage- gated calcium channel alpha
            subunit Cav2.1) (Calcium channel, L type, alpha-1
            polypeptide isoform 4) (Brain calcium channel I)
            (BI).>gb:MMU76716_2123436 Mus musculus voltage-sensitive
            calcium channel alpha 1 A (Ccha1a) mRNA, complete cds.
          Length = 2164

 Score = 22.3 bits (46), Expect(5) = 2.6
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 164  RTYHHHHH 141
            R +HHHHH
Sbjct: 2112 RPHHHHHH 2119



 Score = 21.9 bits (45), Expect(5) = 2.6
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 176  RKDLRTYHHHHH 141
            RK    +HHHHH
Sbjct: 2109 RKHRPHHHHHHH 2120



 Score = 20.8 bits (42), Expect(5) = 2.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 2118 HHHHHH 2123



 Score = 20.8 bits (42), Expect(5) = 2.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 2117 HHHHHH 2122



 Score = 20.8 bits (42), Expect(5) = 2.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 2116 HHHHHH 2121



>gb:BX537168_2567604 Zebrafish DNA sequence from clone DKEY-105O6 in
           linkage group 4 Contains the 5' end of the gene for a
           novel protein (zgc:64223), the gene for a novel protein
           (zgc:73329), the 5' end of the gene for a novel protein
           similar to vertebrate semaphorin 3C (SEMA3C), the gene
           for a novel protein (sb:cb414) and a CpG island,
           complete sequence.
          Length = 613

 Score = 23.9 bits (50), Expect(4) = 2.8
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = -3

Query: 158 YHHHHHQREVIS 123
           +HHHHH R++ S
Sbjct: 497 HHHHHHSRKLPS 508



 Score = 22.3 bits (46), Expect(4) = 2.8
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 164 RTYHHHHH 141
           R +HHHHH
Sbjct: 485 RRHHHHHH 492



 Score = 21.9 bits (45), Expect(4) = 2.8
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 164 RTYHHHHH 141
           R +HHHHH
Sbjct: 486 RHHHHHHH 493



 Score = 20.8 bits (42), Expect(4) = 2.8
 Identities = 6/8 (75%), Positives = 6/8 (75%)
 Frame = -3

Query: 164 RTYHHHHH 141
           R  HHHHH
Sbjct: 484 RRRHHHHH 491



>gb:AY872029_2150193 Synthetic construct hypothetical protein
           (FTT1624) gene, complete cds.
          Length = 141

 Score = 21.6 bits (44), Expect(6) = 2.8
 Identities = 9/15 (60%), Positives = 11/15 (73%)
 Frame = -1

Query: 106 RKSSKTKNLRNKQRK 62
           R  SKTK++RNK  K
Sbjct: 33  RCKSKTKHMRNKANK 47



 Score = 20.8 bits (42), Expect(6) = 2.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 7   HHHHHH 12



 Score = 20.8 bits (42), Expect(6) = 2.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 6   HHHHHH 11



 Score = 20.8 bits (42), Expect(6) = 2.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 5   HHHHHH 10



 Score = 20.8 bits (42), Expect(6) = 2.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 4   HHHHHH 9



 Score = 20.8 bits (42), Expect(6) = 2.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 3   HHHHHH 8



>gb:CJMAFBPRT_2569770 C.japonica mRNA for MAFB protein.
          Length = 311

 Score = 23.9 bits (50), Expect(5) = 2.8
 Identities = 6/14 (42%), Positives = 9/14 (64%)
 Frame = -3

Query: 173 KDLRTYHHHHHQRE 132
           +  R +HHHHH  +
Sbjct: 125 ESFRAHHHHHHHHQ 138



 Score = 20.8 bits (42), Expect(5) = 2.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 162 HHHHHH 167



 Score = 20.8 bits (42), Expect(5) = 2.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 161 HHHHHH 166



 Score = 20.8 bits (42), Expect(5) = 2.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 160 HHHHHH 165



 Score = 20.8 bits (42), Expect(5) = 2.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 159 HHHHHH 164



>pir|T13804|T13804 shs protein - fruit fly (Drosophila
           melanogaster)>gb:DROSHSA_1382935 Drosophila melanogaster
           shortsighted class 2 (shs) mRNA, complete cds.
          Length = 1212

 Score = 22.7 bits (47), Expect(5) = 2.8
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 311 HHHHHHQ 317



 Score = 21.6 bits (44), Expect(5) = 2.8
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 309 HHHHHHHHQ 317



 Score = 20.8 bits (42), Expect(5) = 2.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 308 HHHHHH 313



 Score = 20.8 bits (42), Expect(5) = 2.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 307 HHHHHH 312



 Score = 20.8 bits (42), Expect(5) = 2.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 306 HHHHHH 311



>sp|Q24523|BUN2_DROME Bunched protein, class 2 isoform (Shortsighted
           protein).>gb:AE014134_1128914 Drosophila melanogaster
           chromosome 2L, complete sequence.>gb:AE003636_1219021
           Drosophila melanogaster chromosome 2L, section 45 of 83
           of the complete sequence.
          Length = 1206

 Score = 22.7 bits (47), Expect(5) = 2.8
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 311 HHHHHHQ 317



 Score = 21.6 bits (44), Expect(5) = 2.8
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 309 HHHHHHHHQ 317



 Score = 20.8 bits (42), Expect(5) = 2.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 308 HHHHHH 313



 Score = 20.8 bits (42), Expect(5) = 2.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 307 HHHHHH 312



 Score = 20.8 bits (42), Expect(5) = 2.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 306 HHHHHH 311



>sp|Q28555|HAN1_SHEEP Heart- and neural crest derivatives-expressed
           protein 1 (Extraembryonic tissues, heart, autonomic
           nervous sytem and neural crest derivatives-expressed
           protein 1) (eHAND).>gb:OAU43716_1441924 Ovis aries
           helix-loop-helix transcription factor (Hxt) mRNA,
           complete cds.
          Length = 204

 Score = 21.2 bits (43), Expect(6) = 2.9
 Identities = 6/14 (42%), Positives = 8/14 (57%)
 Frame = -3

Query: 158 YHHHHHQREVISMI 117
           +HHHHH      M+
Sbjct: 14  HHHHHHPHPAHPML 27



 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 13  HHHHHH 18



 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 12  HHHHHH 17



 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 11  HHHHHH 16



 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 10  HHHHHH 15



 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 9   HHHHHH 14



>gb:BC050072_1984257 Homo sapiens forkhead box G1B, mRNA (cDNA clone
           MGC:48322 IMAGE:5284335), complete cds.
          Length = 489

 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 52  HHHHHH 57



 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 51  HHHHHH 56



 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 50  HHHHHH 55



 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 49  HHHHHH 54



 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 48  HHHHHH 53



 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 47  HHHHHH 52



>pir|A54743|A54743 transcription factor HFK1 - human
          Length = 476

 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 52  HHHHHH 57



 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 51  HHHHHH 56



 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 50  HHHHHH 55



 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 49  HHHHHH 54



 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 48  HHHHHH 53



 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 47  HHHHHH 52



>sp|P55315|FXGB_HUMAN Forkhead box protein G1B (Forkhead-related
           protein FKHL1) (Transcription factor BF-1) (Brain factor
           1) (BF1) (HFK1).>gb:HSHBF1A_2013701 H.sapiens HBF-1 mRNA
           for transcription factor.
          Length = 477

 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 52  HHHHHH 57



 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 51  HHHHHH 56



 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 50  HHHHHH 55



 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 49  HHHHHH 54



 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 48  HHHHHH 53



 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 47  HHHHHH 52



>sp|P55316|FXGA_HUMAN Forkhead box protein G1A (Forkhead-related
           protein FKHL2) (Transcription factor BF-2) (Brain factor
           2) (BF2) (HFK2).>pir|I37451|I37451 HBF-G2 (HFK-2)
           protein - human>gb:HSHBF2A_2013702 H.sapiens HBF-2 mRNA
           for transcription factor.>gb:HSHBFG2_2013705 H.sapiens
           HBF-G2 gene.
          Length = 469

 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 52  HHHHHH 57



 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 51  HHHHHH 56



 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 50  HHHHHH 55



 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 49  HHHHHH 54



 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 48  HHHHHH 53



 Score = 20.8 bits (42), Expect(6) = 2.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 47  HHHHHH 52



>sp|Q64733|FXB2_MOUSE Forkhead box protein B2 (Transcription factor
           FKH-4).>gb:MMFKH4_2114933 M.musculus mRNA for fkh-4
           protein.
          Length = 428

 Score = 20.8 bits (42), Expect(6) = 3.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 157 HHHHHH 162



 Score = 20.8 bits (42), Expect(6) = 3.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 156 HHHHHH 161



 Score = 20.8 bits (42), Expect(6) = 3.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 148 HHHHHH 153



 Score = 20.8 bits (42), Expect(6) = 3.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 147 HHHHHH 152



 Score = 20.8 bits (42), Expect(6) = 3.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 146 HHHHHH 151



 Score = 20.8 bits (42), Expect(6) = 3.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 145 HHHHHH 150



>gb:AF480496_1803744 Oryza sativa clone BAC 49D11, complete
           sequence.>gb:AP005323_1850642 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0680A05.>gb:AP005844_1858934 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBb0060O16.
          Length = 427

 Score = 20.8 bits (42), Expect(6) = 3.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 408 HHHHHH 413



 Score = 20.8 bits (42), Expect(6) = 3.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 407 HHHHHH 412



 Score = 20.8 bits (42), Expect(6) = 3.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 406 HHHHHH 411



 Score = 20.8 bits (42), Expect(6) = 3.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 405 HHHHHH 410



 Score = 20.8 bits (42), Expect(6) = 3.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 404 HHHHHH 409



 Score = 20.8 bits (42), Expect(6) = 3.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 403 HHHHHH 408



>gb:AF051526_2052504 Rattus norvegicus class A calcium channel
           variant riA-I (BCCA1) mRNA, partial cds.
          Length = 791

 Score = 22.3 bits (46), Expect(5) = 3.0
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 164 RTYHHHHH 141
           R +HHHHH
Sbjct: 583 RPHHHHHH 590



 Score = 21.9 bits (45), Expect(5) = 3.0
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 176 RKDLRTYHHHHH 141
           RK    +HHHHH
Sbjct: 580 RKHRPHHHHHHH 591



 Score = 20.8 bits (42), Expect(5) = 3.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 589 HHHHHH 594



 Score = 20.8 bits (42), Expect(5) = 3.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 588 HHHHHH 593



 Score = 20.8 bits (42), Expect(5) = 3.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 587 HHHHHH 592



>gb:AE014298_1125653 Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE003497_1212662 Drosophila melanogaster
            chromosome X, section 49 of 74 of the complete sequence.
          Length = 2248

 Score = 24.3 bits (51), Expect(3) = 3.1
 Identities = 7/10 (70%), Positives = 9/10 (90%)
 Frame = -3

Query: 164  RTYHHHHHQR 135
            R +HHHHHQ+
Sbjct: 1952 RYHHHHHHQQ 1961



 Score = 23.9 bits (50), Expect(3) = 3.1
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -3

Query: 158  YHHHHHQRE 132
            YHHHHH ++
Sbjct: 1953 YHHHHHHQQ 1961



 Score = 22.3 bits (46), Expect(3) = 3.1
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -3

Query: 158  YHHHHHQRE 132
            +HHHH QR+
Sbjct: 1955 HHHHHQQRQ 1963



>gb:AE014187_938894 Plasmodium falciparum 3D7 chromosome 14 complete
           sequence.>gb:AE014823_1227970 Plasmodium falciparum 3D7
           chromosome 14 section 8 of 13 of the complete sequence.
          Length = 1132

 Score = 33.5 bits (75), Expect = 3.2
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 1/45 (2%)
 Frame = -1

Query: 313 NPYLLNQSNNPHKGSIFKEFF*E-DQNRNKINEKQANLFAGTLSN 182
           N  + N +NN +  S+ KE+  E DQN  K N K+ N+F   L+N
Sbjct: 60  NDEIRNNNNNNYDNSVKKEYIVEKDQNDEKCNNKKTNVFDIKLNN 104



>pir|T10671|T10671 protein kinase homolog F6E21.90 - Arabidopsis
           thaliana>gb:ATCHRIV74_1547038 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           74.>gb:AY085535_1570604 Arabidopsis thaliana clone
           156374 mRNA, complete sequence.>gb:AY125513_1580321
           Arabidopsis thaliana AT4g31170/F6E21_90 mRNA, complete
           cds.>gb:BT000587_1634865 Arabidopsis thaliana protein
           kinase - like protein (At4g31170/F6E21_90) mRNA,
           complete cds.
          Length = 412

 Score = 33.5 bits (75), Expect = 3.2
 Identities = 35/111 (31%), Positives = 49/111 (44%), Gaps = 4/111 (3%)
 Frame = +1

Query: 322 SVDGGEVPKGD-YSGHPEGELGSK-LKGPGSISDGNMAGKSPSKDMIFRADKIDLKSLDV 495
           SVD   V   D   GHP    G K ++ P S+SDG           +FR  K+     D 
Sbjct: 56  SVDNSSVGSSDALIGHP----GLKPMRHPYSLSDGQS---------VFRPGKVTHALNDD 102

Query: 496 QLEKHL--SRVWSRSVEHQVQRPKEDWEIDPLKLEIRYLIAQGTYGTVYRG 642
            L + L  S+  +  + +      E+W ID  KL +    AQG +G +YRG
Sbjct: 103 ALAQALMDSKYPTEGLVNY-----EEWTIDLRKLHMGPAFAQGAFGKLYRG 148



>sp|P34908|BRAF_COTJA B-Raf proto-oncogene serine/threonine-protein
           kinase (EC 2.7.1.37) (RMIL serine/threonine-protein
           kinase) (c-RMIL).>pir|I51153|I51153 protein kinase B-raf
           (EC 2.7.1.-), long splice form -
           quail>gb:QULCRMILA_2578663 Coturnix coturnix
           (alternatively spliced) serine/threonine protein kinase
           (c-Rmil) mRNA, complete cds.
          Length = 807

 Score = 33.5 bits (75), Expect = 3.2
 Identities = 23/88 (26%), Positives = 38/88 (43%), Gaps = 7/88 (7%)
 Frame = +1

Query: 400 PGSISDGNMAGKSPSKDMIFRADKIDLKSLDVQLEKHLSRVWSRSVEHQVQRP------- 558
           PG +  G+ AG S +          ++K+L         R  S S E + +         
Sbjct: 427 PGPVFRGSTAGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDS 486

Query: 559 KEDWEIDPLKLEIRYLIAQGTYGTVYRG 642
            +DWEI   ++ +   I  G++GTVY+G
Sbjct: 487 SDDWEIPDGQITVGQRIGSGSFGTVYKG 514



>sp|Q04982|BRAF_CHICK B-Raf proto-oncogene serine/threonine-protein
           kinase (EC 2.7.1.37) (RMIL serine/threonine-protein
           kinase) (c-RMIL).>pir|JN0612|JN0612 protein kinase B-raf
           (EC 2.7.1.-), long form - chicken>gb:GGCRMIL_2573068
           G.gallus c-Rmil proto-oncogene.
          Length = 806

 Score = 33.5 bits (75), Expect = 3.2
 Identities = 23/88 (26%), Positives = 38/88 (43%), Gaps = 7/88 (7%)
 Frame = +1

Query: 400 PGSISDGNMAGKSPSKDMIFRADKIDLKSLDVQLEKHLSRVWSRSVEHQVQRP------- 558
           PG +  G+ AG S +          ++K+L         R  S S E + +         
Sbjct: 427 PGPVFRGSTAGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDS 486

Query: 559 KEDWEIDPLKLEIRYLIAQGTYGTVYRG 642
            +DWEI   ++ +   I  G++GTVY+G
Sbjct: 487 SDDWEIPDGQITVGQRIGSGSFGTVYKG 514



>gb:AK083575_1174007 Mus musculus 9 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:D030047C07
           product:homeo box A1, full insert sequence.
          Length = 336

 Score = 20.8 bits (42), Expect(6) = 3.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 70  HHHHHH 75



 Score = 20.8 bits (42), Expect(6) = 3.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 69  HHHHHH 74



 Score = 20.8 bits (42), Expect(6) = 3.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 68  HHHHHH 73



 Score = 20.8 bits (42), Expect(6) = 3.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 67  HHHHHH 72



 Score = 20.8 bits (42), Expect(6) = 3.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 66  HHHHHH 71



 Score = 20.8 bits (42), Expect(6) = 3.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 65  HHHHHH 70



>sp|P09022|HXA1_MOUSE Homeobox protein Hox-A1 (Hox-1.6) (Homeotic
           protein ERA-1-993) (Early retinoic acid 1) (Homeoboxless
           protein ERA-1-399).>pir|A30242|A30242 homeotic protein
           ERA-1-993, retinoic acid-induced -
           mouse>gb:MUSERA1A_2125754 Mouse ERA-1-993 mRNA, complete
           cds, and alternate ERA-1-339 mRNA, complete cds.
          Length = 331

 Score = 20.8 bits (42), Expect(6) = 3.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 65  HHHHHH 70



 Score = 20.8 bits (42), Expect(6) = 3.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 64  HHHHHH 69



 Score = 20.8 bits (42), Expect(6) = 3.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 63  HHHHHH 68



 Score = 20.8 bits (42), Expect(6) = 3.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 62  HHHHHH 67



 Score = 20.8 bits (42), Expect(6) = 3.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 61  HHHHHH 66



 Score = 20.8 bits (42), Expect(6) = 3.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 60  HHHHHH 65



>gb:AF051527_2052505 Rattus norvegicus class A calcium channel
           variant riA-II (BCCA1) mRNA, partial cds.
          Length = 550

 Score = 22.3 bits (46), Expect(5) = 3.2
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 164 RTYHHHHH 141
           R +HHHHH
Sbjct: 498 RPHHHHHH 505



 Score = 21.9 bits (45), Expect(5) = 3.2
 Identities = 7/12 (58%), Positives = 8/12 (66%)
 Frame = -3

Query: 176 RKDLRTYHHHHH 141
           RK    +HHHHH
Sbjct: 495 RKHRPHHHHHHH 506



 Score = 20.8 bits (42), Expect(5) = 3.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 504 HHHHHH 509



 Score = 20.8 bits (42), Expect(5) = 3.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 503 HHHHHH 508



 Score = 20.8 bits (42), Expect(5) = 3.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 502 HHHHHH 507



>gb:AF424700_2065475 Mus musculus Otx1 (Otx1) gene, complete cds.
          Length = 355

 Score = 22.7 bits (47), Expect(5) = 3.5
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 297 HHHHHHQ 303



 Score = 21.6 bits (44), Expect(5) = 3.5
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 295 HHHHHHHHQ 303



 Score = 20.8 bits (42), Expect(5) = 3.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 294 HHHHHH 299



 Score = 20.8 bits (42), Expect(5) = 3.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 293 HHHHHH 298



 Score = 20.8 bits (42), Expect(5) = 3.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 292 HHHHHH 297



>sp|Q63410|OTX1_RAT Homeobox protein OTX1.>pir|I56547|I56547
           homeodomain protein otx1 - rat>gb:RATOTX1X_2133263
           Rattus norvegicus OTX1 mRNA, complete cds.
          Length = 355

 Score = 22.7 bits (47), Expect(5) = 3.5
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 297 HHHHHHQ 303



 Score = 21.6 bits (44), Expect(5) = 3.5
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 295 HHHHHHHHQ 303



 Score = 20.8 bits (42), Expect(5) = 3.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 294 HHHHHH 299



 Score = 20.8 bits (42), Expect(5) = 3.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 293 HHHHHH 298



 Score = 20.8 bits (42), Expect(5) = 3.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 292 HHHHHH 297



>sp|P80205|OTX1_MOUSE Homeobox protein OTX1.>pir|S35345|S35345 otx1
           protein - mouse>gb:AK042975_1166471 Mus musculus 7 days
           neonate cerebellum cDNA, RIKEN full-length enriched
           library, clone:A730044F23 product:orthodenticle homolog
           1 (Drosophila), full insert
           sequence.>gb:AL669858_2072508 Mouse DNA sequence from
           clone RP23-51G7 on chromosome 11 Contains a ribosomal
           protein L15 (Rpl15) pseudogene, the Otx1 gene for
           orthodenticle homolog 1, the 3' end of a novel gene and
           two CpG islands, complete sequence.>gb:BC057105_2102597
           Mus musculus orthodenticle homolog 1 (Drosophila), mRNA
           (cDNA clone MGC:73430 IMAGE:6416436), complete
           cds.>gb:BC058354_2103168 Mus musculus orthodenticle
           homolog 1 (Drosophila), mRNA (cDNA clone MGC:66640
           IMAGE:6816961), complete cds.
          Length = 355

 Score = 22.7 bits (47), Expect(5) = 3.5
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 297 HHHHHHQ 303



 Score = 21.6 bits (44), Expect(5) = 3.5
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 295 HHHHHHHHQ 303



 Score = 20.8 bits (42), Expect(5) = 3.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 294 HHHHHH 299



 Score = 20.8 bits (42), Expect(5) = 3.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 293 HHHHHH 298



 Score = 20.8 bits (42), Expect(5) = 3.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 292 HHHHHH 297



>gb:AF189709_2058435 Rattus norvegicus collagen XVIII mRNA, partial
           cds.
          Length = 226

 Score = 20.8 bits (42), Expect(6) = 3.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 21  HHHHHH 26



 Score = 20.8 bits (42), Expect(6) = 3.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 20  HHHHHH 25



 Score = 20.8 bits (42), Expect(6) = 3.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 19  HHHHHH 24



 Score = 20.8 bits (42), Expect(6) = 3.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 18  HHHHHH 23



 Score = 20.8 bits (42), Expect(6) = 3.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 17  HHHHHH 22



 Score = 20.8 bits (42), Expect(6) = 3.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 16  HHHHHH 21



>gb:AE014298_1125167 Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE003485_1212176 Drosophila melanogaster
            chromosome X, section 37 of 74 of the complete sequence.
          Length = 3539

 Score = 23.9 bits (50), Expect(3) = 3.7
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158  YHHHHHQRE 132
            +HHHHHQ++
Sbjct: 3017 HHHHHHQQQ 3025



 Score = 23.5 bits (49), Expect(3) = 3.7
 Identities = 5/15 (33%), Positives = 12/15 (80%)
 Frame = -3

Query: 176  RKDLRTYHHHHHQRE 132
            ++ ++ +HHHHH ++
Sbjct: 3010 QQQMQPHHHHHHHQQ 3024



 Score = 22.7 bits (47), Expect(3) = 3.7
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 155  HHHHHQRE 132
            HHHHHQ E
Sbjct: 3036 HHHHHQVE 3043



>gb:AY650364_1958311 Macaca fascicularis orthodenticle 1 mRNA,
           partial cds.
          Length = 217

 Score = 22.7 bits (47), Expect(5) = 3.9
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 178 HHHHHHQ 184



 Score = 21.6 bits (44), Expect(5) = 3.9
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 176 HHHHHHHHQ 184



 Score = 20.8 bits (42), Expect(5) = 3.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 175 HHHHHH 180



 Score = 20.8 bits (42), Expect(5) = 3.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 174 HHHHHH 179



 Score = 20.8 bits (42), Expect(5) = 3.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 173 HHHHHH 178



>gb:AE006466_1875651 Homo sapiens 16p13.3 sequence section 5 of 8.
          Length = 2373

 Score = 22.7 bits (47), Expect(5) = 4.0
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           YHHHHH
Sbjct: 539 YHHHHH 544



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 543 HHHHHH 548



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 542 HHHHHH 547



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 541 HHHHHH 546



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 540 HHHHHH 545



>sp|O88427|CCAH_MOUSE Voltage-dependent T-type calcium channel
           alpha-1H subunit (Voltage- gated calcium channel alpha
           subunit Cav3.2).>gb:AY026385S2_2073990 Mus musculus
           low-voltage-activated calcium channel alpha13.2 subunit
           (Cacna1h) gene, exons 3 through 36 and complete cds;
           tryptase gamma 1 (Tpsg1) gene, exon 5 and partial cds.
          Length = 2365

 Score = 22.7 bits (47), Expect(5) = 4.0
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           YHHHHH
Sbjct: 520 YHHHHH 525



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 524 HHHHHH 529



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 523 HHHHHH 528



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 522 HHHHHH 527



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 521 HHHHHH 526



>sp|Q9EQ60|CCAH_RAT Voltage-dependent T-type calcium channel
           alpha-1H subunit (Voltage- gated calcium channel alpha
           subunit Cav3.2).>gb:AF290213_2061701 Rattus norvegicus
           calcium channel alpha-1-H subunit mRNA, complete cds.
          Length = 2359

 Score = 22.7 bits (47), Expect(5) = 4.0
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           YHHHHH
Sbjct: 520 YHHHHH 525



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 524 HHHHHH 529



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 523 HHHHHH 528



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 522 HHHHHH 527



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 521 HHHHHH 526



>gb:AF073931_1880955 Homo sapiens low-voltage activated calcium
           channel alpha 1H mRNA, complete cds.
          Length = 2353

 Score = 22.7 bits (47), Expect(5) = 4.0
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           YHHHHH
Sbjct: 519 YHHHHH 524



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 523 HHHHHH 528



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 522 HHHHHH 527



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 521 HHHHHH 526



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 520 HHHHHH 525



>gb:AF051946_1879195 Homo sapiens T-type calcium channel alpha 1H
           subunit (CACNA1H) mRNA, complete cds.
          Length = 2353

 Score = 22.7 bits (47), Expect(5) = 4.0
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           YHHHHH
Sbjct: 519 YHHHHH 524



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 523 HHHHHH 528



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 522 HHHHHH 527



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 521 HHHHHH 526



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 520 HHHHHH 525



>sp|O95180|CCAH_HUMAN Voltage-dependent T-type calcium channel
           alpha-1H subunit (Voltage- gated calcium channel alpha
           subunit Cav3.2) (Low-voltage-activated calcium channel
           alpha1 3.2 subunit).
          Length = 2353

 Score = 22.7 bits (47), Expect(5) = 4.0
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           YHHHHH
Sbjct: 519 YHHHHH 524



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 523 HHHHHH 528



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 522 HHHHHH 527



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 521 HHHHHH 526



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 520 HHHHHH 525



>gb:HSA420779_2006800 Homo sapiens mRNA for calcium channel,
           voltage-dependent, T type, alpha 1Hb subunit (CACNA1HB
           gene).
          Length = 2347

 Score = 22.7 bits (47), Expect(5) = 4.0
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           YHHHHH
Sbjct: 519 YHHHHH 524



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 523 HHHHHH 528



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 522 HHHHHH 527



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 521 HHHHHH 526



 Score = 20.8 bits (42), Expect(5) = 4.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 520 HHHHHH 525



>gb:AF448777_2495296 Brookesia peyrierasi NADH dehydrogenase subunit
           1 (ND1) gene, partial cds; tRNA-Gln, tRNA-Ile, and
           tRNA-Met genes, complete sequence; NADH dehydrogenase
           subunit 2 (ND2) gene, complete cds; tRNA-Trp, tRNA-Ala,
           tRNA-Asn, tRNA-Cys, and tRNA-Tyr genes, complete
           sequence; and cytochrome c oxidase subunit I (COI) gene,
           partial cds; mitochondrial genes for mitochondrial
           products.
          Length = 347

 Score = 33.1 bits (74), Expect = 4.1
 Identities = 16/63 (25%), Positives = 30/63 (47%)
 Frame = -2

Query: 561 LGPLDLMFYTPRPNPTQMLLQLNIQAFEINLISPKNHIFARALPCHISITNTPWPLQLRP 382
           + PL ++F T    P +M++ + + +  I  +   N    R L  + S+ N  W + + P
Sbjct: 137 IAPLTILFMTFNKMPPKMMITMGMMSVIIGGLGGINQTQLRKLMAYSSLANLGWTMMIFP 196

Query: 381 *FP 373
            FP
Sbjct: 197 MFP 199



>pir|AD3126|AD3126 ATP-dependent DNA ligase Atu4632 [imported] -
           Agrobacterium tumefaciens (strain C58,
           Dupont)>pir|E98161|E98161 probable ATP-dependent DNA
           ligase PA2138 [imported] - Agrobacterium tumefaciens
           (strain C58, Cereon)>gb:AE008224_234756 Agrobacterium
           tumefaciens str. C58 linear chromosome, section 28 of
           187 of the complete sequence.>gb:AE009391_251453
           Agrobacterium tumefaciens str. C58 linear chromosome,
           section 161 of 187 of the complete
           sequence.>gb:AE007870_1079869 Agrobacterium tumefaciens
           str. C58 linear chromosome, complete
           sequence.>gb:AE008689_1089296 Agrobacterium tumefaciens
           str. C58 linear chromosome, complete sequence.
          Length = 771

 Score = 33.1 bits (74), Expect = 4.1
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 5/89 (5%)
 Frame = +1

Query: 334 GEVPKGDYSGHPEGEL-GSKLKGPGS-ISDGNMAGKSPSKDMIFRADKIDLK---SLDVQ 498
           G+  KG   GH E EL G KLKG    +      G+S    ++ + D  + +     D+ 
Sbjct: 110 GDAGKGYRKGHLEFELEGEKLKGRWHLVRMHGKPGESRENWLLIKGDDEEARHKGGADIL 169

Query: 499 LEKHLSRVWSRSVEHQVQRPKEDWEIDPL 585
            E+  S    RSVE   ++P++ W   P+
Sbjct: 170 EERPESVKTGRSVEEVAKKPEDTWNSKPV 198



>gb:AY119556_1301125 Drosophila melanogaster GH28840 full insert
           cDNA.
          Length = 1272

 Score = 23.9 bits (50), Expect(3) = 4.1
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 750 HHHHHHQQQ 758



 Score = 23.5 bits (49), Expect(3) = 4.1
 Identities = 5/15 (33%), Positives = 12/15 (80%)
 Frame = -3

Query: 176 RKDLRTYHHHHHQRE 132
           ++ ++ +HHHHH ++
Sbjct: 743 QQQMQPHHHHHHHQQ 757



 Score = 22.7 bits (47), Expect(3) = 4.1
 Identities = 7/8 (87%), Positives = 7/8 (87%)
 Frame = -3

Query: 155 HHHHHQRE 132
           HHHHHQ E
Sbjct: 769 HHHHHQVE 776



>gb:S81924_2139750 Otx1=homeobox [rats, telencephalon, mRNA Partial,
           444 nt].
          Length = 148

 Score = 22.7 bits (47), Expect(5) = 4.6
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 122 HHHHHHQ 128



 Score = 21.6 bits (44), Expect(5) = 4.6
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 120 HHHHHHHHQ 128



 Score = 20.8 bits (42), Expect(5) = 4.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 119 HHHHHH 124



 Score = 20.8 bits (42), Expect(5) = 4.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 118 HHHHHH 123



 Score = 20.8 bits (42), Expect(5) = 4.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 117 HHHHHH 122



>gb:HS302G6_1997974 Human DNA sequence from clone LA16c-302G6 on
           chromosome 16 Contains part of the CACNA1H (calcium
           channel, voltage-dependent, alpha 1H subunit) gene,
           ESTs, GSSs and CpG islands, complete sequence.
          Length = 808

 Score = 22.7 bits (47), Expect(5) = 4.8
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           YHHHHH
Sbjct: 510 YHHHHH 515



 Score = 20.8 bits (42), Expect(5) = 4.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 514 HHHHHH 519



 Score = 20.8 bits (42), Expect(5) = 4.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 513 HHHHHH 518



 Score = 20.8 bits (42), Expect(5) = 4.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 512 HHHHHH 517



 Score = 20.8 bits (42), Expect(5) = 4.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 511 HHHHHH 516



>pir|B30242|B30242 stem cell protein ERA-1-399, retinoic
           acid-induced - mouse>gb:MUSERA1A_2125755 Mouse ERA-1-993
           mRNA, complete cds, and alternate ERA-1-339 mRNA,
           complete cds.
          Length = 133

 Score = 20.8 bits (42), Expect(6) = 4.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 65  HHHHHH 70



 Score = 20.8 bits (42), Expect(6) = 4.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 64  HHHHHH 69



 Score = 20.8 bits (42), Expect(6) = 4.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 63  HHHHHH 68



 Score = 20.8 bits (42), Expect(6) = 4.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 62  HHHHHH 67



 Score = 20.8 bits (42), Expect(6) = 4.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 61  HHHHHH 66



 Score = 20.8 bits (42), Expect(6) = 4.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 60  HHHHHH 65



>gb:AB009614_2156692 Leucania separata nuclear polyhedrosis virus
           gene for P24, EL25, GP37, 39K and LEF11, complete cds.
          Length = 219

 Score = 24.6 bits (52), Expect(3) = 5.2
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           YHHHHH  E
Sbjct: 162 YHHHHHHHE 170



 Score = 23.1 bits (48), Expect(3) = 5.2
 Identities = 7/16 (43%), Positives = 10/16 (62%)
 Frame = -3

Query: 188 IKLIRKDLRTYHHHHH 141
           ++  RK    +HHHHH
Sbjct: 153 VRECRKKKHYHHHHHH 168



 Score = 22.3 bits (46), Expect(3) = 5.2
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH+ +
Sbjct: 164 HHHHHHEHD 172



>gb:BC056760_2102461 Mus musculus cDNA clone MGC:59433
           IMAGE:6331997, complete cds.
          Length = 1002

 Score = 23.5 bits (49), Expect(4) = 5.2
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -3

Query: 173 KDLRTYHHHHH 141
           +D   YHHHHH
Sbjct: 914 EDHHHYHHHHH 924



 Score = 22.7 bits (47), Expect(4) = 5.2
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 158 YHHHHHQR 135
           +HHHHH R
Sbjct: 922 HHHHHHHR 929



 Score = 20.8 bits (42), Expect(4) = 5.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 921 HHHHHH 926



 Score = 20.8 bits (42), Expect(4) = 5.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 920 HHHHHH 925



>gb:AY356530_2084033 Mus musculus CAST1/ERC2 splicing variant-1
           mRNA, complete cds, alternatively spliced.
          Length = 969

 Score = 23.5 bits (49), Expect(4) = 5.2
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -3

Query: 173 KDLRTYHHHHH 141
           +D   YHHHHH
Sbjct: 930 EDHHHYHHHHH 940



 Score = 22.7 bits (47), Expect(4) = 5.2
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 158 YHHHHHQR 135
           +HHHHH R
Sbjct: 938 HHHHHHHR 945



 Score = 20.8 bits (42), Expect(4) = 5.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 937 HHHHHH 942



 Score = 20.8 bits (42), Expect(4) = 5.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 936 HHHHHH 941



>gb:AY356531_2084034 Mus musculus CAST1/ERC2 splicing variant-2
           mRNA, complete cds, alternatively spliced.
          Length = 960

 Score = 23.5 bits (49), Expect(4) = 5.2
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -3

Query: 173 KDLRTYHHHHH 141
           +D   YHHHHH
Sbjct: 921 EDHHHYHHHHH 931



 Score = 22.7 bits (47), Expect(4) = 5.2
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 158 YHHHHHQR 135
           +HHHHH R
Sbjct: 929 HHHHHHHR 936



 Score = 20.8 bits (42), Expect(4) = 5.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 928 HHHHHH 933



 Score = 20.8 bits (42), Expect(4) = 5.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 927 HHHHHH 932



>gb:AY356532_2084035 Mus musculus CAST1/ERC2 splicing variant-3
           mRNA, complete cds, alternatively spliced.
          Length = 957

 Score = 23.5 bits (49), Expect(4) = 5.2
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -3

Query: 173 KDLRTYHHHHH 141
           +D   YHHHHH
Sbjct: 918 EDHHHYHHHHH 928



 Score = 22.7 bits (47), Expect(4) = 5.2
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 158 YHHHHHQR 135
           +HHHHH R
Sbjct: 926 HHHHHHHR 933



 Score = 20.8 bits (42), Expect(4) = 5.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 925 HHHHHH 930



 Score = 20.8 bits (42), Expect(4) = 5.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 924 HHHHHH 929



>gb:AY356533_2084036 Mus musculus CAST1/ERC2 splicing variant-4
           mRNA, complete cds, alternatively spliced.
          Length = 953

 Score = 23.5 bits (49), Expect(4) = 5.2
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -3

Query: 173 KDLRTYHHHHH 141
           +D   YHHHHH
Sbjct: 914 EDHHHYHHHHH 924



 Score = 22.7 bits (47), Expect(4) = 5.2
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 158 YHHHHHQR 135
           +HHHHH R
Sbjct: 922 HHHHHHHR 929



 Score = 20.8 bits (42), Expect(4) = 5.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 921 HHHHHH 926



 Score = 20.8 bits (42), Expect(4) = 5.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 920 HHHHHH 925



>gb:QULCRMIL_2578662 Coturnix coturnix serine/threonine protein
           kinase (c-Rmil) mRNA, complete cds.
          Length = 767

 Score = 32.7 bits (73), Expect = 5.4
 Identities = 24/81 (29%), Positives = 35/81 (43%)
 Frame = +1

Query: 400 PGSISDGNMAGKSPSKDMIFRADKIDLKSLDVQLEKHLSRVWSRSVEHQVQRPKEDWEID 579
           PGS+++     KSP      R  K    S D    K L R          +   +DWEI 
Sbjct: 407 PGSLTNVKALQKSPGPQ---RERKSSSSSEDRNRMKTLGR----------RDSSDDWEIP 453

Query: 580 PLKLEIRYLIAQGTYGTVYRG 642
             ++ +   I  G++GTVY+G
Sbjct: 454 DGQITVGQRIGSGSFGTVYKG 474



>gb:AF449458_2495513 Gallus gallus serine/threonine kinase (RMIL)
           mRNA, partial cds; alternatively spliced.
          Length = 712

 Score = 32.7 bits (73), Expect = 5.4
 Identities = 24/81 (29%), Positives = 35/81 (43%)
 Frame = +1

Query: 400 PGSISDGNMAGKSPSKDMIFRADKIDLKSLDVQLEKHLSRVWSRSVEHQVQRPKEDWEID 579
           PGS+++     KSP      R  K    S D    K L R          +   +DWEI 
Sbjct: 353 PGSLTNVKALQKSPGPQ---RERKSSSSSEDRNRMKTLGR----------RDSSDDWEIP 399

Query: 580 PLKLEIRYLIAQGTYGTVYRG 642
             ++ +   I  G++GTVY+G
Sbjct: 400 DGQITVGQRIGSGSFGTVYKG 420



>gb:REIC1MIL_2448653 Avian retrovirus IC10 proviral DNA with v-Rmil
           oncogene.
          Length = 567

 Score = 32.7 bits (73), Expect = 5.4
 Identities = 24/81 (29%), Positives = 35/81 (43%)
 Frame = +1

Query: 400 PGSISDGNMAGKSPSKDMIFRADKIDLKSLDVQLEKHLSRVWSRSVEHQVQRPKEDWEID 579
           PGS+++     KSP      R  K    S D    K L R          +   +DWEI 
Sbjct: 150 PGSLTNVKALQKSPGPQ---RERKSSSSSEDRNRMKTLGR----------RDSSDDWEIP 196

Query: 580 PLKLEIRYLIAQGTYGTVYRG 642
             ++ +   I  G++GTVY+G
Sbjct: 197 DGQITVGQRIGSGSFGTVYKG 217



>gb:HUMBRAF_2029656 Homo sapiens B-raf protein (BRAF) mRNA, complete
           cds.
          Length = 766

 Score = 32.7 bits (73), Expect = 5.4
 Identities = 24/81 (29%), Positives = 35/81 (43%)
 Frame = +1

Query: 400 PGSISDGNMAGKSPSKDMIFRADKIDLKSLDVQLEKHLSRVWSRSVEHQVQRPKEDWEID 579
           PGS+++     KSP      R  K    S D    K L R          +   +DWEI 
Sbjct: 407 PGSLTNVKALQKSPGPQ---RERKSSSSSEDRNRMKTLGR----------RDSSDDWEIP 453

Query: 580 PLKLEIRYLIAQGTYGTVYRG 642
             ++ +   I  G++GTVY+G
Sbjct: 454 DGQITVGQRIGSGSFGTVYKG 474



>gb:AY803272_1964892 Homo sapiens AKAP9-BRAF fusion protein mRNA,
            complete cds.
          Length = 1492

 Score = 32.7 bits (73), Expect = 5.4
 Identities = 24/81 (29%), Positives = 35/81 (43%)
 Frame = +1

Query: 400  PGSISDGNMAGKSPSKDMIFRADKIDLKSLDVQLEKHLSRVWSRSVEHQVQRPKEDWEID 579
            PGS+++     KSP      R  K    S D    K L R          +   +DWEI 
Sbjct: 1133 PGSLTNVKALQKSPGPQ---RERKSSSSSEDRNRMKTLGR----------RDSSDDWEIP 1179

Query: 580  PLKLEIRYLIAQGTYGTVYRG 642
              ++ +   I  G++GTVY+G
Sbjct: 1180 DGQITVGQRIGSGSFGTVYKG 1200



>gb:AK130475_1917619 Homo sapiens cDNA FLJ26965 fis, clone SLV01057.
          Length = 193

 Score = 32.7 bits (73), Expect = 5.4
 Identities = 22/49 (44%), Positives = 27/49 (55%), Gaps = 3/49 (6%)
 Frame = -3

Query: 413 LILPGPFNLDPNS---PSGCPE*SPLGTSPPSTLVLKSIFIKSVQQPPQ 276
           L+LP P  L+P+S   PS  P   PL  SPPSTL L  + +     PPQ
Sbjct: 138 LLLPPPSPLEPHSFFPPSLSPSSLPLQPSPPSTLQLWGLCV----TPPQ 182



>gb:AC006344_1875134 Homo sapiens PAC clone RP4-726N20 from
           7q32-q34, complete sequence.
          Length = 651

 Score = 32.7 bits (73), Expect = 5.4
 Identities = 24/81 (29%), Positives = 35/81 (43%)
 Frame = +1

Query: 400 PGSISDGNMAGKSPSKDMIFRADKIDLKSLDVQLEKHLSRVWSRSVEHQVQRPKEDWEID 579
           PGS+++     KSP      R  K    S D    K L R          +   +DWEI 
Sbjct: 292 PGSLTNVKALQKSPGPQ---RERKSSSSSEDRNRMKTLGR----------RDSSDDWEIP 338

Query: 580 PLKLEIRYLIAQGTYGTVYRG 642
             ++ +   I  G++GTVY+G
Sbjct: 339 DGQITVGQRIGSGSFGTVYKG 359



>gb:AY156512_1585392 Oryza sativa (japonica cultivar-group)
           serine/threonine protein kinase (DPK3) mRNA, complete
           cds.>gb:AP005772_1857600 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0073A21.
          Length = 421

 Score = 32.7 bits (73), Expect = 5.4
 Identities = 27/85 (31%), Positives = 43/85 (50%), Gaps = 1/85 (1%)
 Frame = +1

Query: 391 LKGPGSISDGNMAGKSPSKDMIFRADKIDLKSLDVQLEKHLSRV-WSRSVEHQVQRPKED 567
           LK PG + D   A  S     +FR +++   +L+   E  L+RV    S   ++    E+
Sbjct: 78  LKHPG-LRDAPTASYSVGNS-VFRPNRVAAHTLN---EDALARVLMDPSHPTEILSNYEE 132

Query: 568 WEIDPLKLEIRYLIAQGTYGTVYRG 642
           W ID  +L++    AQG +G +YRG
Sbjct: 133 WAIDLGRLDMGVPFAQGAFGKLYRG 157



>gb:AY545218_1431298 Canis familiaris B-raf protein isoform 1 (BRAF)
           mRNA, partial cds, alternatively spliced.
          Length = 749

 Score = 32.7 bits (73), Expect = 5.4
 Identities = 24/81 (29%), Positives = 35/81 (43%)
 Frame = +1

Query: 400 PGSISDGNMAGKSPSKDMIFRADKIDLKSLDVQLEKHLSRVWSRSVEHQVQRPKEDWEID 579
           PGS+++     KSP      R  K    S D    K L R          +   +DWEI 
Sbjct: 390 PGSLTNVKALQKSPGPQ---RERKSSSSSEDRNRMKTLGR----------RDSSDDWEIP 436

Query: 580 PLKLEIRYLIAQGTYGTVYRG 642
             ++ +   I  G++GTVY+G
Sbjct: 437 DGQITVGQRIGSGSFGTVYKG 457



>gb:U13646_1401860 Caenorhabditis elegans cosmid ZK783, complete
            sequence.
          Length = 2585

 Score = 32.7 bits (73), Expect = 5.4
 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 3/44 (6%)
 Frame = +1

Query: 310  DLRTSVDGGEV-PKGDYSGHPEGELGSKLKGPGSISD--GNMAG 432
            D  +   GGE  PKG   G P G+ GS++K P S  D  GN++G
Sbjct: 1036 DSTSETSGGEQGPKGKSKGQPPGDKGSEVKKPTSEVDGPGNLSG 1079



>pir|T08864|T08864 hypothetical protein A_TM017A05.2 - Arabidopsis
           thaliana
          Length = 346

 Score = 32.7 bits (73), Expect = 5.4
 Identities = 12/27 (44%), Positives = 20/27 (74%)
 Frame = +1

Query: 562 EDWEIDPLKLEIRYLIAQGTYGTVYRG 642
           ++WEID  +L+I   +A G+YG ++RG
Sbjct: 106 DEWEIDVTQLKIEKKVASGSYGDLHRG 132



>pir|T34513|T34513 hypothetical protein ZK783.1 - Caenorhabditis
            elegans
          Length = 3507

 Score = 32.7 bits (73), Expect = 5.4
 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 3/44 (6%)
 Frame = +1

Query: 310  DLRTSVDGGEV-PKGDYSGHPEGELGSKLKGPGSISD--GNMAG 432
            D  +   GGE  PKG   G P G+ GS++K P S  D  GN++G
Sbjct: 1036 DSTSETSGGEQGPKGKSKGQPPGDKGSEVKKPTSEVDGPGNLSG 1079



>pir|D84555|D84555 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AY070086_1566728 Arabidopsis thaliana
           putative protein kinase (At2g17700) mRNA, complete
           cds.>gb:AY096470_1576014 Arabidopsis thaliana putative
           protein kinase (At2g17700) mRNA, complete cds.
          Length = 546

 Score = 32.7 bits (73), Expect = 5.4
 Identities = 12/27 (44%), Positives = 20/27 (74%)
 Frame = +1

Query: 562 EDWEIDPLKLEIRYLIAQGTYGTVYRG 642
           ++WEID  +L+I   +A G+YG ++RG
Sbjct: 277 DEWEIDVTQLKIEKKVASGSYGDLHRG 303



>pir|A43095|TVFVMI gag-Rmil-env polyprotein - avian retrovirus
           IC10>gb:REIC10_2448652 Avian Retrovirus IC10 proviral
           genome.
          Length = 1079

 Score = 32.7 bits (73), Expect = 5.4
 Identities = 24/81 (29%), Positives = 35/81 (43%)
 Frame = +1

Query: 400 PGSISDGNMAGKSPSKDMIFRADKIDLKSLDVQLEKHLSRVWSRSVEHQVQRPKEDWEID 579
           PGS+++     KSP      R  K    S D    K L R          +   +DWEI 
Sbjct: 662 PGSLTNVKALQKSPGPQ---RERKSSSSSEDRNRMKTLGR----------RDSSDDWEIP 708

Query: 580 PLKLEIRYLIAQGTYGTVYRG 642
             ++ +   I  G++GTVY+G
Sbjct: 709 DGQITVGQRIGSGSFGTVYKG 729



>sp|P10533|RMIL_AVII1 Serine/threonine-protein kinase transforming
           protein Rmil (EC 2.7.1.37).
          Length = 367

 Score = 32.7 bits (73), Expect = 5.4
 Identities = 24/81 (29%), Positives = 35/81 (43%)
 Frame = +1

Query: 400 PGSISDGNMAGKSPSKDMIFRADKIDLKSLDVQLEKHLSRVWSRSVEHQVQRPKEDWEID 579
           PGS+++     KSP      R  K    S D    K L R          +   +DWEI 
Sbjct: 17  PGSLTNVKALQKSPGPQ---RERKSSSSSEDRNRMKTLGR----------RDSSDDWEIP 63

Query: 580 PLKLEIRYLIAQGTYGTVYRG 642
             ++ +   I  G++GTVY+G
Sbjct: 64  DGQITVGQRIGSGSFGTVYKG 84



>sp|P27966|RMIL_AVEVR Serine/threonine-protein kinase transforming
           protein Rmil (EC 2.7.1.37).>pir|A40341|TVFVMR protein
           kinase (EC 2.7.1.37) R-mil - Rous-associated virus
           (type 1)>gb:ALERMILAA_2280318 Rous associated virus type
           1 Rmil gene, complete cds.
          Length = 450

 Score = 32.7 bits (73), Expect = 5.4
 Identities = 24/81 (29%), Positives = 35/81 (43%)
 Frame = +1

Query: 400 PGSISDGNMAGKSPSKDMIFRADKIDLKSLDVQLEKHLSRVWSRSVEHQVQRPKEDWEID 579
           PGS+++     KSP      R  K    S D    K L R          +   +DWEI 
Sbjct: 33  PGSLTNVKALQKSPGPQ---RERKSSSSSEDRNRMKTLGR----------RDSSDDWEIP 79

Query: 580 PLKLEIRYLIAQGTYGTVYRG 642
             ++ +   I  G++GTVY+G
Sbjct: 80  DGQITVGQRIGSGSFGTVYKG 100



>sp|P15056|BRAF_HUMAN B-Raf proto-oncogene serine/threonine-protein
           kinase (EC 2.7.1.37) (p94) (v-Raf murine sarcoma viral
           oncogene homolog B1).>pir|A57977|TVHUBF protein kinase
           B-raf (EC 2.7.1.-) - human>gb:AX696360_1473225 Sequence
           3 from Patent WO0226246.
          Length = 765

 Score = 32.7 bits (73), Expect = 5.4
 Identities = 24/81 (29%), Positives = 35/81 (43%)
 Frame = +1

Query: 400 PGSISDGNMAGKSPSKDMIFRADKIDLKSLDVQLEKHLSRVWSRSVEHQVQRPKEDWEID 579
           PGS+++     KSP      R  K    S D    K L R          +   +DWEI 
Sbjct: 406 PGSLTNVKALQKSPGPQ---RERKSSSSSEDRNRMKTLGR----------RDSSDDWEIP 452

Query: 580 PLKLEIRYLIAQGTYGTVYRG 642
             ++ +   I  G++GTVY+G
Sbjct: 453 DGQITVGQRIGSGSFGTVYKG 473



>gb:AK122265_2068930 Mus musculus mRNA for mKIAA0378 protein.
          Length = 632

 Score = 23.5 bits (49), Expect(4) = 5.6
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -3

Query: 173 KDLRTYHHHHH 141
           +D   YHHHHH
Sbjct: 593 EDHHHYHHHHH 603



 Score = 22.7 bits (47), Expect(4) = 5.6
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 158 YHHHHHQR 135
           +HHHHH R
Sbjct: 601 HHHHHHHR 608



 Score = 20.8 bits (42), Expect(4) = 5.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 600 HHHHHH 605



 Score = 20.8 bits (42), Expect(4) = 5.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 599 HHHHHH 604



>gb:AB037742_1866533 Homo sapiens mRNA for KIAA1321 protein, partial
           cds.
          Length = 714

 Score = 24.6 bits (52), Expect(3) = 5.6
 Identities = 10/21 (47%), Positives = 11/21 (52%)
 Frame = -1

Query: 340 PHHHQHLFSNPYLLNQSNNPH 278
           PHHH H     Y  N S+N H
Sbjct: 49  PHHHHHY----YFYNHSHNHH 65



 Score = 23.1 bits (48), Expect(3) = 5.6
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -3

Query: 158 YHHHHHQR 135
           +HHHHHQ+
Sbjct: 65  HHHHHHQQ 72



 Score = 21.9 bits (45), Expect(3) = 5.6
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 64  HHHHHHHQQ 72



>gb:AY232289_1939894 Homo sapiens proliferation-inducing gene 1
           mRNA, complete cds.>gb:HSA493465_2007570 Homo sapiens
           mRNA for FMRP interacting protein (82-FIP gene).
          Length = 695

 Score = 24.6 bits (52), Expect(3) = 5.6
 Identities = 10/21 (47%), Positives = 11/21 (52%)
 Frame = -1

Query: 340 PHHHQHLFSNPYLLNQSNNPH 278
           PHHH H     Y  N S+N H
Sbjct: 30  PHHHHHY----YFYNHSHNHH 46



 Score = 23.1 bits (48), Expect(3) = 5.6
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -3

Query: 158 YHHHHHQR 135
           +HHHHHQ+
Sbjct: 46  HHHHHHQQ 53



 Score = 21.9 bits (45), Expect(3) = 5.6
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 45  HHHHHHHQQ 53



>gb:AX405794_1467722 Sequence 209 from Patent WO0222660.
          Length = 695

 Score = 24.6 bits (52), Expect(3) = 5.6
 Identities = 10/21 (47%), Positives = 11/21 (52%)
 Frame = -1

Query: 340 PHHHQHLFSNPYLLNQSNNPH 278
           PHHH H     Y  N S+N H
Sbjct: 30  PHHHHHY----YFYNHSHNHH 46



 Score = 23.1 bits (48), Expect(3) = 5.6
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -3

Query: 158 YHHHHHQR 135
           +HHHHHQ+
Sbjct: 46  HHHHHHQQ 53



 Score = 21.9 bits (45), Expect(3) = 5.6
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 45  HHHHHHHQQ 53



>gb:AF012911_468734 Plasmid pETHIS-1, complete sequence.
          Length = 53

 Score = 21.2 bits (43), Expect(6) = 5.7
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           ++HHHHH
Sbjct: 43  SHHHHHH 49



 Score = 20.8 bits (42), Expect(6) = 5.7
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 48  HHHHHH 53



 Score = 20.8 bits (42), Expect(6) = 5.7
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 47  HHHHHH 52



 Score = 20.8 bits (42), Expect(6) = 5.7
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 46  HHHHHH 51



 Score = 20.8 bits (42), Expect(6) = 5.7
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 45  HHHHHH 50



 Score = 20.4 bits (41), Expect(6) = 5.7
 Identities = 6/8 (75%), Positives = 6/8 (75%)
 Frame = -3

Query: 164 RTYHHHHH 141
           R  HHHHH
Sbjct: 41  RGSHHHHH 48



>gb:AY313149_1318637 Saccoglossus kowalevskii iroquois (iro) mRNA,
           complete cds.
          Length = 500

 Score = 23.1 bits (48), Expect(4) = 5.8
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -3

Query: 158 YHHHHHQR 135
           +HHHHHQ+
Sbjct: 385 HHHHHHQQ 392



 Score = 21.9 bits (45), Expect(4) = 5.8
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 384 HHHHHHHQQ 392



 Score = 21.6 bits (44), Expect(4) = 5.8
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 383 HHHHHHHHQ 391



 Score = 21.2 bits (43), Expect(4) = 5.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 382 FHHHHH 387



>gb:AF051768_2470747 Xenopus laevis methyl-CpG-binding protein 2
           mRNA, complete cds.>gb:AF106951_2473965 Xenopus laevis
           methyl-CpG-binding protein MeCP2 (MECP2) mRNA, complete
           cds.
          Length = 467

 Score = 26.2 bits (56), Expect(3) = 5.9
 Identities = 8/14 (57%), Positives = 12/14 (85%)
 Frame = -3

Query: 182 LIRKDLRTYHHHHH 141
           L +K+L+ +HHHHH
Sbjct: 356 LPKKELQQHHHHHH 369



 Score = 22.3 bits (46), Expect(3) = 5.9
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  E
Sbjct: 370 HHHHHHHSE 378



 Score = 21.2 bits (43), Expect(3) = 5.9
 Identities = 6/12 (50%), Positives = 7/12 (58%)
 Frame = -3

Query: 158 YHHHHHQREVIS 123
           +HHHHH     S
Sbjct: 371 HHHHHHSESKAS 382



>gb:AH009202S3_1906680 Homo sapiens low-voltage-activated calcium
           channel alpha13.2 subunit (CACNA1H) gene, exon 9 and
           partial cds.
          Length = 238

 Score = 22.7 bits (47), Expect(5) = 6.0
 Identities = 6/6 (100%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           YHHHHH
Sbjct: 96  YHHHHH 101



 Score = 20.8 bits (42), Expect(5) = 6.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 100 HHHHHH 105



 Score = 20.8 bits (42), Expect(5) = 6.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 99  HHHHHH 104



 Score = 20.8 bits (42), Expect(5) = 6.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 98  HHHHHH 103



 Score = 20.8 bits (42), Expect(5) = 6.0
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 97  HHHHHH 102



>gb:AE014298_1124519 Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE003437_1209701 Drosophila melanogaster
            chromosome X, section 21 of 74 of the complete sequence.
          Length = 1543

 Score = 23.1 bits (48), Expect(4) = 6.2
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -3

Query: 158  YHHHHHQR 135
            +HHHHHQ+
Sbjct: 1412 HHHHHHQQ 1419



 Score = 21.9 bits (45), Expect(4) = 6.2
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158  YHHHHHQRE 132
            +HHHHH ++
Sbjct: 1411 HHHHHHHQQ 1419



 Score = 21.6 bits (44), Expect(4) = 6.2
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158  YHHHHHQRE 132
            +HHHHH  +
Sbjct: 1410 HHHHHHHHQ 1418



 Score = 20.8 bits (42), Expect(4) = 6.2
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 1409 HHHHHH 1414



>pir|A56235|A56235 transcription activator MafB -
           chicken>gb:CHKMAFBBZI_2569311 Chicken gene for bZip
           nuclear protein MafB, complete cds.
          Length = 311

 Score = 23.1 bits (48), Expect(4) = 6.3
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -3

Query: 173 KDLRTYHHHHH 141
           +  R +HHHHH
Sbjct: 125 ESFRAHHHHHH 135



 Score = 22.7 bits (47), Expect(4) = 6.3
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 161 HHHHHHQ 167



 Score = 21.6 bits (44), Expect(4) = 6.3
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 159 HHHHHHHHQ 167



 Score = 20.4 bits (41), Expect(4) = 6.3
 Identities = 6/11 (54%), Positives = 6/11 (54%)
 Frame = -3

Query: 155 HHHHHQREVIS 123
           HHHHH     S
Sbjct: 159 HHHHHHHHQAS 169



>gb:AY528224_2536339 Danio rerio L-type calcium channel pore subunit
            isoform 1.3a (cav1.3a) mRNA, complete cds.
          Length = 2082

 Score = 21.9 bits (45), Expect(5) = 6.5
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 164  RTYHHHHH 141
            R +HHHHH
Sbjct: 1672 RHHHHHHH 1679



 Score = 20.8 bits (42), Expect(5) = 6.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 1678 HHHHHH 1683



 Score = 20.8 bits (42), Expect(5) = 6.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 1677 HHHHHH 1682



 Score = 20.8 bits (42), Expect(5) = 6.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 1676 HHHHHH 1681



 Score = 20.8 bits (42), Expect(5) = 6.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 1675 HHHHHH 1680



>gb:AB002376_1863683 Human mRNA for KIAA0378 gene, partial cds.
          Length = 970

 Score = 23.1 bits (48), Expect(4) = 6.6
 Identities = 7/10 (70%), Positives = 7/10 (70%)
 Frame = -3

Query: 170 DLRTYHHHHH 141
           D   YHHHHH
Sbjct: 932 DHHHYHHHHH 941



 Score = 22.7 bits (47), Expect(4) = 6.6
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 158 YHHHHHQR 135
           +HHHHH R
Sbjct: 939 HHHHHHHR 946



 Score = 20.8 bits (42), Expect(4) = 6.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 938 HHHHHH 943



 Score = 20.8 bits (42), Expect(4) = 6.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 937 HHHHHH 942



>gb:AY049038_2074540 Rattus norvegicus CAST1 mRNA, complete cds.
          Length = 957

 Score = 23.1 bits (48), Expect(4) = 6.6
 Identities = 7/10 (70%), Positives = 7/10 (70%)
 Frame = -3

Query: 170 DLRTYHHHHH 141
           D   YHHHHH
Sbjct: 919 DHHHYHHHHH 928



 Score = 22.7 bits (47), Expect(4) = 6.6
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 158 YHHHHHQR 135
           +HHHHH R
Sbjct: 926 HHHHHHHR 933



 Score = 20.8 bits (42), Expect(4) = 6.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 925 HHHHHH 930



 Score = 20.8 bits (42), Expect(4) = 6.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 924 HHHHHH 929



>gb:AF541925_2067913 Rattus norvegicus ERC2 mRNA, complete cds;
           alternatively spliced.
          Length = 921

 Score = 23.1 bits (48), Expect(4) = 6.7
 Identities = 7/10 (70%), Positives = 7/10 (70%)
 Frame = -3

Query: 170 DLRTYHHHHH 141
           D   YHHHHH
Sbjct: 883 DHHHYHHHHH 892



 Score = 22.7 bits (47), Expect(4) = 6.7
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 158 YHHHHHQR 135
           +HHHHH R
Sbjct: 890 HHHHHHHR 897



 Score = 20.8 bits (42), Expect(4) = 6.7
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 889 HHHHHH 894



 Score = 20.8 bits (42), Expect(4) = 6.7
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 888 HHHHHH 893



>gb:AY070889_1294974 Drosophila melanogaster LD46223 full length
           cDNA.
          Length = 706

 Score = 23.1 bits (48), Expect(4) = 6.9
 Identities = 6/14 (42%), Positives = 9/14 (64%)
 Frame = -3

Query: 158 YHHHHHQREVISMI 117
           +HHHHH+  +   I
Sbjct: 484 HHHHHHENHITPSI 497



 Score = 22.7 bits (47), Expect(4) = 6.9
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  E
Sbjct: 482 HHHHHHHHE 490



 Score = 20.8 bits (42), Expect(4) = 6.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 481 HHHHHH 486



 Score = 20.8 bits (42), Expect(4) = 6.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 480 HHHHHH 485



>gb:AE013599_1130572 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003838_1227074 Drosophila melanogaster
           chromosome 2R, section 12 of 74 of the complete
           sequence.
          Length = 706

 Score = 23.1 bits (48), Expect(4) = 6.9
 Identities = 6/14 (42%), Positives = 9/14 (64%)
 Frame = -3

Query: 158 YHHHHHQREVISMI 117
           +HHHHH+  +   I
Sbjct: 484 HHHHHHENHITPSI 497



 Score = 22.7 bits (47), Expect(4) = 6.9
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  E
Sbjct: 482 HHHHHHHHE 490



 Score = 20.8 bits (42), Expect(4) = 6.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 481 HHHHHH 486



 Score = 20.8 bits (42), Expect(4) = 6.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 480 HHHHHH 485



>gb:AE013599_1130573 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003838_1227075 Drosophila melanogaster
           chromosome 2R, section 12 of 74 of the complete
           sequence.
          Length = 702

 Score = 23.1 bits (48), Expect(4) = 6.9
 Identities = 6/14 (42%), Positives = 9/14 (64%)
 Frame = -3

Query: 158 YHHHHHQREVISMI 117
           +HHHHH+  +   I
Sbjct: 480 HHHHHHENHITPSI 493



 Score = 22.7 bits (47), Expect(4) = 6.9
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  E
Sbjct: 478 HHHHHHHHE 486



 Score = 20.8 bits (42), Expect(4) = 6.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 477 HHHHHH 482



 Score = 20.8 bits (42), Expect(4) = 6.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 476 HHHHHH 481



>gb:AL714030_2504395 Zebrafish DNA sequence from clone BUSM1-223C6 in
            linkage group 11 Contains part of a novel gene similar to
            CACNA1D (voltage-dependent calcium channel L type, alpha
            1D subunit) and a CpG island, complete sequence.
          Length = 1374

 Score = 21.9 bits (45), Expect(5) = 6.9
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 164  RTYHHHHH 141
            R +HHHHH
Sbjct: 1306 RHHHHHHH 1313



 Score = 20.8 bits (42), Expect(5) = 6.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 1312 HHHHHH 1317



 Score = 20.8 bits (42), Expect(5) = 6.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 1311 HHHHHH 1316



 Score = 20.8 bits (42), Expect(5) = 6.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 1310 HHHHHH 1315



 Score = 20.8 bits (42), Expect(5) = 6.9
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158  YHHHHH 141
            +HHHHH
Sbjct: 1309 HHHHHH 1314



>gb:MUSBRAF_2125295 Mouse B-raf oncogene mRNA, complete cds.
          Length = 659

 Score = 32.3 bits (72), Expect = 7.0
 Identities = 19/54 (35%), Positives = 28/54 (51%)
 Frame = +1

Query: 481 KSLDVQLEKHLSRVWSRSVEHQVQRPKEDWEIDPLKLEIRYLIAQGTYGTVYRG 642
           K+L  QLEK L R          +   +DWEI   ++ +   I  G++GTVY+G
Sbjct: 324 KALLHQLEKTLGR----------RDSSDDWEIPDGQITVGQRIGSGSFGTVYKG 367



>gb:AF515706_1278683 Schistosoma mansoni Fes-like tyrosine kinase
            protein mRNA, complete cds.
          Length = 1259

 Score = 32.3 bits (72), Expect = 7.0
 Identities = 14/32 (43%), Positives = 20/32 (62%)
 Frame = +1

Query: 547  VQRPKEDWEIDPLKLEIRYLIAQGTYGTVYRG 642
            + RP  DWE+D   +++   I QG +G VYRG
Sbjct: 949  ISRP--DWELDNRDVQLLQKIGQGNFGDVYRG 978



>gb:AE014298_1124676 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003441_1209858 Drosophila melanogaster
           chromosome X, section 25 of 74 of the complete
           sequence.>gb:AY069838_1294568 Drosophila melanogaster
           SD08447 full length cDNA.
          Length = 555

 Score = 23.5 bits (49), Expect(4) = 7.2
 Identities = 7/18 (38%), Positives = 12/18 (66%)
 Frame = -3

Query: 158 YHHHHHQREVISMILNVQ 105
           +HHHHHQ +    I +++
Sbjct: 235 HHHHHHQSQHDGSISSIE 252



 Score = 21.6 bits (44), Expect(4) = 7.2
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 233 HHHHHHHHQ 241



 Score = 21.2 bits (43), Expect(4) = 7.2
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HH HHQ+E
Sbjct: 218 HHHGHHQQE 226



 Score = 21.2 bits (43), Expect(4) = 7.2
 Identities = 6/13 (46%), Positives = 8/13 (61%)
 Frame = -3

Query: 179 IRKDLRTYHHHHH 141
           +  D  + HHHHH
Sbjct: 206 VSDDTVSQHHHHH 218



>sp|P06719|KNOB_PLAFN Knob-associated histidine-rich protein
           precursor (KAHRP).>pir|A29454|A29454 knob-associated
           histidine-rich protein precursor - malaria parasite
           (Plasmodium falciparum) (strain
           NF7/Ghana)>gb:PFKAHRP_1394235 P. falciparum SD17 gene
           for knob-associated histidine-rich protein.
          Length = 657

 Score = 23.5 bits (49), Expect(3) = 7.2
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ +
Sbjct: 68  HHHHHHQHQ 76



 Score = 23.1 bits (48), Expect(3) = 7.2
 Identities = 8/18 (44%), Positives = 10/18 (55%)
 Frame = -3

Query: 194 NSIKLIRKDLRTYHHHHH 141
           N   L +K    +HHHHH
Sbjct: 52  NKRTLAQKQHEHHHHHHH 69



 Score = 22.7 bits (47), Expect(3) = 7.2
 Identities = 7/9 (77%), Positives = 7/9 (77%)
 Frame = -3

Query: 155 HHHHHQREV 129
           HHHHH  EV
Sbjct: 86  HHHHHHGEV 94



>sp|P35405|A2AC_DIDMA Alpha-2C adrenergic receptor (Alpha-2C
           adrenoceptor) (Alpha-2C
           adrenoreceptor).>gb:DVU04310_1439602 Didelphis
           virginiana alpha-2c adrenergic receptor mRNA, complete
           cds.
          Length = 469

 Score = 22.7 bits (47), Expect(4) = 7.4
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 288 HHHHHHQ 294



 Score = 21.9 bits (45), Expect(4) = 7.4
 Identities = 5/10 (50%), Positives = 8/10 (80%)
 Frame = -3

Query: 158 YHHHHHQREV 129
           +HHHHH  ++
Sbjct: 286 HHHHHHHHQL 295



 Score = 21.9 bits (45), Expect(4) = 7.4
 Identities = 6/11 (54%), Positives = 8/11 (72%)
 Frame = -3

Query: 167 LRTYHHHHHQR 135
           L  +HHHHH +
Sbjct: 284 LHHHHHHHHHQ 294



 Score = 20.8 bits (42), Expect(4) = 7.4
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 278 HHHHHH 283



>gb:CEW04A8_1368883 Caenorhabditis elegans cosmid W04A8, complete
           sequence.>gb:CEY71A12B_1371016 Caenorhabditis elegans
           YAC Y71A12B, complete sequence.
          Length = 1792

 Score = 23.1 bits (48), Expect(4) = 7.6
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH R+
Sbjct: 441 HHHHHHHRK 449



 Score = 22.7 bits (47), Expect(4) = 7.6
 Identities = 5/9 (55%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH+++
Sbjct: 442 HHHHHHRKD 450



 Score = 20.8 bits (42), Expect(4) = 7.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 440 HHHHHH 445



 Score = 20.4 bits (41), Expect(4) = 7.6
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 176 RKDLRTYHHHHH 141
           R D    HHHHH
Sbjct: 433 RHDEGPDHHHHH 444



>gb:AE017349_1758732 Cryptococcus neoformans var. neoformans JEC21
           chromosome 9, complete sequence.
          Length = 757

 Score = 21.9 bits (45), Expect(5) = 7.6
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 164 RTYHHHHH 141
           R +HHHHH
Sbjct: 706 RHHHHHHH 713



 Score = 20.8 bits (42), Expect(5) = 7.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 712 HHHHHH 717



 Score = 20.8 bits (42), Expect(5) = 7.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 711 HHHHHH 716



 Score = 20.8 bits (42), Expect(5) = 7.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 710 HHHHHH 715



 Score = 20.8 bits (42), Expect(5) = 7.6
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 709 HHHHHH 714



>gb:AY029294_2508637 Xenopus laevis transcription factor Otx1 (Otx1)
           mRNA, complete cds.
          Length = 339

 Score = 22.7 bits (47), Expect(4) = 7.8
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 284 HHHHHHQ 290



 Score = 21.9 bits (45), Expect(4) = 7.8
 Identities = 7/15 (46%), Positives = 9/15 (60%)
 Frame = -3

Query: 158 YHHHHHQREVISMIL 114
           +HHHHH +   S  L
Sbjct: 283 HHHHHHHQGYTSSAL 297



 Score = 21.9 bits (45), Expect(4) = 7.8
 Identities = 5/10 (50%), Positives = 8/10 (80%)
 Frame = -3

Query: 161 TYHHHHHQRE 132
           ++HHHHH  +
Sbjct: 281 SHHHHHHHHQ 290



 Score = 20.8 bits (42), Expect(4) = 7.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 269 HHHHHH 274



>gb:AF160197_1773276 Glycine max Ni-binding urease accessory protein
           UreG (Eu3) mRNA, complete cds.
          Length = 274

 Score = 22.7 bits (47), Expect(4) = 8.1
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 9   HHHHHHQ 15



 Score = 21.9 bits (45), Expect(4) = 8.1
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 8   HHHHHHHQD 16



 Score = 21.6 bits (44), Expect(4) = 8.1
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 7   HHHHHHHHQ 15



 Score = 21.2 bits (43), Expect(4) = 8.1
 Identities = 6/8 (75%), Positives = 6/8 (75%)
 Frame = -3

Query: 155 HHHHHQRE 132
           HHHHH  E
Sbjct: 26  HHHHHDGE 33



>gb:AF052857_1764394 Dicentra eximia PISTILLATA homolog DePI-1 mRNA,
           partial cds.
          Length = 229

 Score = 23.5 bits (49), Expect(4) = 8.5
 Identities = 6/8 (75%), Positives = 8/8 (100%)
 Frame = -3

Query: 158 YHHHHHQR 135
           +HHHHHQ+
Sbjct: 176 HHHHHHQK 183



 Score = 21.6 bits (44), Expect(4) = 8.5
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH ++
Sbjct: 175 HHHHHHHQK 183



 Score = 21.6 bits (44), Expect(4) = 8.5
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 174 HHHHHHHHQ 182



 Score = 20.8 bits (42), Expect(4) = 8.5
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 173 HHHHHH 178



>pir|T26141|T26141 hypothetical protein W04A8.7 - Caenorhabditis
           elegans
          Length = 559

 Score = 23.1 bits (48), Expect(4) = 9.1
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH R+
Sbjct: 441 HHHHHHHRK 449



 Score = 22.7 bits (47), Expect(4) = 9.1
 Identities = 5/9 (55%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH+++
Sbjct: 442 HHHHHHRKD 450



 Score = 20.8 bits (42), Expect(4) = 9.1
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 440 HHHHHH 445



 Score = 20.4 bits (41), Expect(4) = 9.1
 Identities = 7/12 (58%), Positives = 7/12 (58%)
 Frame = -3

Query: 176 RKDLRTYHHHHH 141
           R D    HHHHH
Sbjct: 433 RHDEGPDHHHHH 444



>gb:AB115749_2465846 Seriola quinqueradiata BRAF mRNA for
           serine/threonine protein kinase BRAF, partial cds.
          Length = 697

 Score = 32.0 bits (71), Expect = 9.2
 Identities = 23/81 (28%), Positives = 37/81 (45%)
 Frame = +1

Query: 400 PGSISDGNMAGKSPSKDMIFRADKIDLKSLDVQLEKHLSRVWSRSVEHQVQRPKEDWEID 579
           PGS+++  +  KSP +    R  K    S D    K L R          +   +DWEI 
Sbjct: 337 PGSLTNVKVPQKSPCQQ---RERKSSSSSEDRNKMKTLGR----------RDSSDDWEIP 383

Query: 580 PLKLEIRYLIAQGTYGTVYRG 642
             ++ +   I  G++GTV++G
Sbjct: 384 EGQITLGQRIGSGSFGTVFKG 404



>gb:BT003433_1356835 Drosophila melanogaster SD04308 full insert
           cDNA.
          Length = 634

 Score = 24.3 bits (51), Expect(3) = 9.2
 Identities = 6/15 (40%), Positives = 11/15 (73%)
 Frame = -3

Query: 176 RKDLRTYHHHHHQRE 132
           R ++  +HHHHH ++
Sbjct: 213 RSNIHHHHHHHHHQQ 227



 Score = 23.9 bits (50), Expect(3) = 9.2
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHHQ++
Sbjct: 220 HHHHHHQQQ 228



 Score = 20.8 bits (42), Expect(3) = 9.2
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHH Q++
Sbjct: 221 HHHHHQQQQ 229



>gb:AB122025_2466109 Danio rerio mRNA for Pou4f2/Brn-3b, complete
           cds.>gb:AY196176_2518328 Danio rerio POU domain
           transcription factor Brn3b-l (brn3b-l) mRNA, complete
           cds.
          Length = 384

 Score = 22.7 bits (47), Expect(4) = 9.6
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 151 HHHHHHQ 157



 Score = 22.3 bits (46), Expect(4) = 9.6
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -3

Query: 167 LRTYHHHHH 141
           L ++HHHHH
Sbjct: 144 LASHHHHHH 152



 Score = 21.6 bits (44), Expect(4) = 9.6
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 149 HHHHHHHHQ 157



 Score = 20.4 bits (41), Expect(4) = 9.6
 Identities = 6/18 (33%), Positives = 9/18 (50%)
 Frame = -3

Query: 194 NSIKLIRKDLRTYHHHHH 141
           +S+ +        HHHHH
Sbjct: 134 SSVPISHPSALASHHHHH 151



>gb:BC056326_2551766 Danio rerio POU domain, class 4, transcription
           factor 1, mRNA (cDNA clone MGC:65880 IMAGE:6800913),
           complete cds.>gb:BC065954_2554208 Danio rerio POU
           domain, class 4, transcription factor 1, mRNA (cDNA
           clone MGC:77341 IMAGE:6967996), complete cds.
          Length = 366

 Score = 22.7 bits (47), Expect(4) = 9.7
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 105 HHHHHHQ 111



 Score = 21.6 bits (44), Expect(4) = 9.7
 Identities = 5/10 (50%), Positives = 8/10 (80%)
 Frame = -3

Query: 158 YHHHHHQREV 129
           +HHHHH + +
Sbjct: 104 HHHHHHHQNL 113



 Score = 21.6 bits (44), Expect(4) = 9.7
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 103 HHHHHHHHQ 111



 Score = 21.2 bits (43), Expect(4) = 9.7
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 167 LRTYHHHHH 141
           L  +HHHHH
Sbjct: 98  LAHHHHHHH 106



>gb:AB188114_2467191 Danio rerio brn3a mRNA for brain-specific
           homeobox/POU domain protein 3a, complete cds.
          Length = 366

 Score = 22.7 bits (47), Expect(4) = 9.7
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 105 HHHHHHQ 111



 Score = 21.6 bits (44), Expect(4) = 9.7
 Identities = 5/10 (50%), Positives = 8/10 (80%)
 Frame = -3

Query: 158 YHHHHHQREV 129
           +HHHHH + +
Sbjct: 104 HHHHHHHQNL 113



 Score = 21.6 bits (44), Expect(4) = 9.7
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 103 HHHHHHHHQ 111



 Score = 21.2 bits (43), Expect(4) = 9.7
 Identities = 6/9 (66%), Positives = 7/9 (77%)
 Frame = -3

Query: 167 LRTYHHHHH 141
           L  +HHHHH
Sbjct: 98  LAHHHHHHH 106



>gb:SCU52347_1397355 Stomoxys calcitrans putative tachykinin-like
           receptor mRNA, complete cds.
          Length = 678

 Score = 21.6 bits (44), Expect(5) = 9.8
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -3

Query: 161 TYHHHHH 141
           ++HHHHH
Sbjct: 557 SFHHHHH 563



 Score = 20.8 bits (42), Expect(5) = 9.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 573 HHHHHH 578



 Score = 20.8 bits (42), Expect(5) = 9.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 572 HHHHHH 577



 Score = 20.8 bits (42), Expect(5) = 9.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 560 HHHHHH 565



 Score = 20.8 bits (42), Expect(5) = 9.8
 Identities = 5/6 (83%), Positives = 6/6 (100%)
 Frame = -3

Query: 158 YHHHHH 141
           +HHHHH
Sbjct: 559 HHHHHH 564



>gb:AY196177_2518329 Danio rerio POU domain transcription factor
           Brn3b-s (brn3b-s) mRNA, complete cds.
          Length = 319

 Score = 22.7 bits (47), Expect(4) = 10.0
 Identities = 6/7 (85%), Positives = 7/7 (100%)
 Frame = -3

Query: 158 YHHHHHQ 138
           +HHHHHQ
Sbjct: 86  HHHHHHQ 92



 Score = 22.3 bits (46), Expect(4) = 10.0
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = -3

Query: 167 LRTYHHHHH 141
           L ++HHHHH
Sbjct: 79  LASHHHHHH 87



 Score = 21.6 bits (44), Expect(4) = 10.0
 Identities = 5/9 (55%), Positives = 7/9 (77%)
 Frame = -3

Query: 158 YHHHHHQRE 132
           +HHHHH  +
Sbjct: 84  HHHHHHHHQ 92



 Score = 20.4 bits (41), Expect(4) = 10.0
 Identities = 6/18 (33%), Positives = 9/18 (50%)
 Frame = -3

Query: 194 NSIKLIRKDLRTYHHHHH 141
           +S+ +        HHHHH
Sbjct: 69  SSVPISHPSALASHHHHH 86



>gb:AF169823_2207369 Spodoptera exigua nucleopolyhedrovirus complete
           genome.
          Length = 335

 Score = 24.6 bits (52), Expect(3) = 10.0
 Identities = 7/14 (50%), Positives = 10/14 (71%)
 Frame = -3

Query: 158 YHHHHHQREVISMI 117
           +HHHHH  E++  I
Sbjct: 162 HHHHHHHTELLERI 175



 Score = 22.3 bits (46), Expect(3) = 10.0
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 164 RTYHHHHH 141
           R +HHHHH
Sbjct: 158 RRHHHHHH 165



 Score = 21.9 bits (45), Expect(3) = 10.0
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = -3

Query: 164 RTYHHHHH 141
           R +HHHHH
Sbjct: 159 RHHHHHHH 166


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 670,599,543
Number of Sequences: 1806583
Number of extensions: 13999482
Number of successful extensions: 52544
Number of sequences better than 10.0: 240
Number of HSP's better than 10.0 without gapping: 43849
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 51298
length of database: 581,917,975
effective HSP length: 119
effective length of database: 366,934,598
effective search space used: 34491852212
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)