BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig5331
         (532 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY085644_1570712 Arabidopsis thaliana clone 1650 mRNA, comple...   131   6e-30   
gb:AY093614_1575358 Zea mays BRICK1 mRNA, complete cds.               120   1e-26   
gb:AY224582_1590779 Oryza sativa (japonica cultivar-group) isola...   120   1e-26   
pir|A84615|A84615 hypothetical protein At2g22640 [imported] - Ar...    85   6e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AE013599_1133686 Drosophila melanogaster chromosome 2R, compl...    48   8e-05   
gb:BC071524_2556260 Danio rerio zgc:86903, mRNA (cDNA clone MGC:...    48   1e-04   
gb:BC061677_2553297 Xenopus laevis hypothetical protein MGC68812...    48   1e-04   
gb:AX399973_1467286 Sequence 144 from Patent WO0218424.>gb:AX972...    48   1e-04   
gb:AK020128_1160327 Mus musculus 12 days embryo male wolffian du...    48   1e-04   
gb:AF161418_1150311 Homo sapiens HSPC300 mRNA, partial cds.            48   1e-04   
gb:AY261866_1177659 Ciona intestinalis HSPC300-like mRNA, partia...    38   0.083   
gb:CR382400_1375063 Plasmodium falciparum chromosome 6, complete...    32   4.6     
pir|F58208|F58208 protamine II-5 - painted turtle                      32   6.0     Chrysemys picta
pir|C58208|C58208 protamine II-2 - painted turtle                      32   7.8     Chrysemys picta


>gb:AY085644_1570712 Arabidopsis thaliana clone 1650 mRNA, complete
           sequence.>gb:BT000017_1634295 Arabidopsis thaliana
           Unknown protein (At2g22640) mRNA, complete
           cds.>gb:AF370530_1792315 Arabidopsis thaliana Unknown
           protein (At2g22640; T9I22.8) mRNA, complete cds.
          Length = 85

 Score =  131 bits (330), Expect = 6e-30
 Identities = 69/85 (81%), Positives = 73/85 (85%)
 Frame = +3

Query: 75  MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD 254
           MA+AGGITNAVNVGIAVQADWENREFIS+ISLNVRRLF+FLVQFE TTKSKLASLNEKLD
Sbjct: 1   MAKAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLVQFESTTKSKLASLNEKLD 60

Query: 255 TXXXXXXXXXVQVSTATANPALFNT 329
                     VQVSTATANP+LF T
Sbjct: 61  LLERRLEMLEVQVSTATANPSLFAT 85



>gb:AY093614_1575358 Zea mays BRICK1 mRNA, complete cds.
          Length = 84

 Score =  120 bits (302), Expect = 1e-26
 Identities = 61/84 (72%), Positives = 67/84 (79%)
 Frame = +3

Query: 75  MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLD 254
           M R GG+ N VNVGIAVQADWENREFISNISLNVRRLFDFL++FE TTKSKLASLNEKLD
Sbjct: 1   MGRGGGMGNPVNVGIAVQADWENREFISNISLNVRRLFDFLLRFEATTKSKLASLNEKLD 60

Query: 255 TXXXXXXXXXVQVSTATANPALFN 326
                     VQV +AT NP++FN
Sbjct: 61  ILERKLEVLEVQVGSATTNPSVFN 84



>gb:AY224582_1590779 Oryza sativa (japonica cultivar-group) isolate
           30852 unknown mRNA.>gb:AP004043_1836787 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OJ1124_D06.
          Length = 86

 Score =  120 bits (301), Expect = 1e-26
 Identities = 64/86 (74%), Positives = 70/86 (81%), Gaps = 2/86 (2%)
 Frame = +3

Query: 75  MARAGG--ITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEK 248
           MARAGG  + N VNVGIAVQADWENREFISNISLNVRRLFDFL++FE TTKSKLASLNEK
Sbjct: 1   MARAGGHGMGNPVNVGIAVQADWENREFISNISLNVRRLFDFLLRFEATTKSKLASLNEK 60

Query: 249 LDTXXXXXXXXXVQVSTATANPALFN 326
           LD          VQVS+AT NP++FN
Sbjct: 61  LDILERKLEVLEVQVSSATTNPSVFN 86



>pir|A84615|A84615 hypothetical protein At2g22640 [imported] -
           Arabidopsis thaliana>gb:AC006340_1534068 Arabidopsis
           thaliana chromosome 2 clone T9I22 map CIC06C07, complete
           sequence.
          Length = 61

 Score = 85.1 bits (209), Expect = 6e-16
 Identities = 41/44 (93%), Positives = 44/44 (100%)
 Frame = +3

Query: 75  MARAGGITNAVNVGIAVQADWENREFISNISLNVRRLFDFLVQF 206
           MA+AGGITNAVNVGIAVQADWENREFIS+ISLNVRRLF+FLVQF
Sbjct: 1   MAKAGGITNAVNVGIAVQADWENREFISHISLNVRRLFEFLVQF 44



>gb:AE013599_1133686 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003462_1210985 Drosophila melanogaster
           chromosome 2R, section 70 of 74 of the complete
           sequence.
          Length = 76

 Score = 48.1 bits (113), Expect = 8e-05
 Identities = 20/43 (46%), Positives = 32/43 (74%)
 Frame = +3

Query: 123 VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL 251
           +  DW NRE+I  I+ +++R+ DFL  F+++ +S+LA LNEKL
Sbjct: 13  IHQDWANREYIEVITASIKRITDFLNSFDMSCRSRLAVLNEKL 55



>gb:BC071524_2556260 Danio rerio zgc:86903, mRNA (cDNA clone
           MGC:86903 IMAGE:6905320), complete cds.
          Length = 75

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 19/43 (44%), Positives = 33/43 (76%)
 Frame = +3

Query: 123 VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL 251
           +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct: 12  IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL 54



>gb:BC061677_2553297 Xenopus laevis hypothetical protein MGC68812,
           mRNA (cDNA clone MGC:68812 IMAGE:4633022), complete cds.
          Length = 75

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 19/43 (44%), Positives = 33/43 (76%)
 Frame = +3

Query: 123 VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL 251
           +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct: 12  IHQDWANREYIEVITSSIKKIADFLNSFDMSCRSRLATLNEKL 54



>gb:AX399973_1467286 Sequence 144 from Patent
           WO0218424.>gb:AX972559_1487868 Sequence 3362 from Patent
           EP1104808.>gb:AX972560_1487869 Sequence 3363 from Patent
           EP1104808.>gb:AX972561_1487870 Sequence 3364 from Patent
           EP1104808.>gb:AX972562_1487871 Sequence 3365 from Patent
           EP1104808.>gb:AX972563_1487872 Sequence 3366 from Patent
           EP1104808.>gb:AX972564_1487873 Sequence 3367 from Patent
           EP1104808.>gb:AY148219_1937134 Homo sapiens Brk1-like
           protein mRNA, complete cds.>gb:AY148220_1937135 Homo
           sapiens Brk1-like protein mRNA, complete cds;
           alternatively spliced.>gb:BC001067_1967260 Homo sapiens
           chromosome 3 open reading frame 10, mRNA (cDNA clone
           MGC:2529 IMAGE:2823162), complete
           cds.>gb:BC007929_1971102 Homo sapiens chromosome 3 open
           reading frame 10, mRNA (cDNA clone MGC:14130
           IMAGE:3688264), complete cds.>gb:BC019303_1976816 Homo
           sapiens chromosome 3 open reading frame 10, mRNA (cDNA
           clone MGC:4198 IMAGE:2823162), complete cds.
          Length = 75

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 19/43 (44%), Positives = 33/43 (76%)
 Frame = +3

Query: 123 VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL 251
           +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct: 12  IHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKL 54



>gb:AK020128_1160327 Mus musculus 12 days embryo male wolffian duct
           includes surrounding region cDNA, RIKEN full-length
           enriched library, clone:6720456B07 product:hypothetical
           protein, full insert sequence.>gb:BC010582_2091023 Mus
           musculus RIKEN cDNA 6720456B07 gene, mRNA (cDNA clone
           MGC:6981 IMAGE:3154777), complete cds.
          Length = 75

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 19/43 (44%), Positives = 33/43 (76%)
 Frame = +3

Query: 123 VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL 251
           +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct: 12  IHQDWANREYIEIITSSIKKISDFLNSFDMSCRSRLATLNEKL 54



>gb:AF161418_1150311 Homo sapiens HSPC300 mRNA, partial cds.
          Length = 110

 Score = 47.8 bits (112), Expect = 1e-04
 Identities = 19/43 (44%), Positives = 33/43 (76%)
 Frame = +3

Query: 123 VQADWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKL 251
           +  DW NRE+I  I+ +++++ DFL  F+++ +S+LA+LNEKL
Sbjct: 16  IHQDWANREYIEIITSSIKKIADFLNSFDMSCRSRLATLNEKL 58



>gb:AY261866_1177659 Ciona intestinalis HSPC300-like mRNA, partial
           cds.
          Length = 64

 Score = 38.1 bits (87), Expect = 0.083
 Identities = 18/62 (29%), Positives = 34/62 (54%)
 Frame = +3

Query: 132 DWENREFISNISLNVRRLFDFLVQFEVTTKSKLASLNEKLDTXXXXXXXXXVQVSTATAN 311
           DW NRE+I  ++  +R++  FL +F+ + + +LA L +KL++          +V  +   
Sbjct: 2   DWNNREYIELVTGCMRKIATFLNEFDSSCRYRLAVLKQKLESLENKINYIEARVDGSPTT 61

Query: 312 PA 317
           PA
Sbjct: 62  PA 63



>gb:CR382400_1375063 Plasmodium falciparum chromosome 6, complete
           sequence; segment 3/5.
          Length = 334

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 5/75 (6%)
 Frame = -3

Query: 452 SQKYS-----YIQYENEVARSLQITDKK*QHKSSLVRNENITDHESSIKQSWISRGRANL 288
           +Q YS     Y+Q ++E + S    DK  +H    + NE++ + ++ IK+    + ++++
Sbjct: 174 NQSYSSLFMRYMQSDDEKSNSTVENDKNEEHNEDTLSNESMMEIDNIIKKLKDKKDKSSM 233

Query: 287 NFEQF*STLQCIELL 243
              +F   LQCIE L
Sbjct: 234 QTARF--YLQCIEKL 246



>pir|F58208|F58208 protamine II-5 - painted turtle
          Length = 47

 Score = 32.0 bits (71), Expect = 6.0
 Identities = 15/33 (45%), Positives = 18/33 (54%)
 Frame = +2

Query: 50  RRGERSGKNGESRRDNERRKRGNSGAGRLGEPR 148
           RRG R G+ G  RR + RR+RG     R G  R
Sbjct: 6   RRGGRGGRRGRRRRRHGRRRRGRRSRERTGRRR 38



>pir|C58208|C58208 protamine II-2 - painted turtle
          Length = 45

 Score = 31.6 bits (70), Expect = 7.8
 Identities = 14/28 (50%), Positives = 18/28 (64%)
 Frame = +2

Query: 50  RRGERSGKNGESRRDNERRKRGNSGAGR 133
           RRG R G+ G  RR + RR+RG+ G  R
Sbjct: 6   RRGGRGGRRGRRRRRHGRRRRGHRGRER 33


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 405,000,536
Number of Sequences: 1806583
Number of extensions: 6396208
Number of successful extensions: 20612
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 20061
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20601
length of database: 581,917,975
effective HSP length: 116
effective length of database: 372,354,347
effective search space used: 22341260820
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)