BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig5283
         (627 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AC084766_1733769 Oryza sativa chromosome 3 BAC OSJNBb0048D20 ...    77   2e-13   
pir|T04255|T04255 hypothetical protein F20B18.110 - Arabidopsis ...    76   4e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1023238 Oryza sativa (japonica cultivar-group) chrom...    74   2e-12   
gb:BT006443_1639330 Arabidopsis thaliana At1g14170 gene, complet...    73   3e-12   
pir|C86275|C86275 hypothetical protein [imported] - Arabidopsis ...    73   3e-12   Arabidopsis thaliana [mouse-ear cress]
gb:ATAC011437_1543273 Arabidopsis thaliana chromosome III BAC F7...    73   4e-12   
gb:BT001108_1635363 Arabidopsis thaliana clone C103247 (E) putat...    71   1e-11   
pir|T49962|T49962 hypothetical protein F8M21.160 - Arabidopsis t...    71   1e-11   Arabidopsis thaliana [mouse-ear cress]
pir|T04533|T04533 hypothetical protein F28J12.30 - Arabidopsis t...    71   1e-11   Arabidopsis thaliana [mouse-ear cress]
sp|P58223|Y475_ARATH|Y475_ARATH Putative nucleic acid binding protein At4g1...    71   1e-11   Arabidopsis thaliana [mouse-ear cress]
gb:AC092390_1735383 Oryza sativa chromosome 3 BAC OSJNBb0013K08 ...    70   3e-11   
gb:AC154033_1745263 Solanum demissum chromosome 5 clone PGEC132D...    68   1e-10   
gb:AC151803_1745123 Solanum demissum chromosome 5 BAC PGEC979H09...    68   1e-10   
gb:AE016959_1023856 Oryza sativa (japonica cultivar-group) chrom...    67   2e-10   
gb:AF361620_1791366 Arabidopsis thaliana AT5g46190/MCL19_25 gene...    65   7e-10   
gb:AY085782_1570848 Arabidopsis thaliana clone 18140 mRNA, compl...    65   7e-10   
gb:AB006698_1509875 Arabidopsis thaliana genomic DNA, chromosome...    65   7e-10   
pir|D96554|D96554 hypothetical protein F19C24.19 [imported] - Ar...    64   2e-09   Arabidopsis thaliana [mouse-ear cress]
gb:AE014296_1137452 Drosophila melanogaster chromosome 3L, compl...    64   2e-09   
gb:AE014296_1137450 Drosophila melanogaster chromosome 3L, compl...    64   2e-09   
sp|P57723|PCB4_HUMAN|PCB4_HUMAN Poly(rC)-binding protein 4 (Alpha-CP4).>gb:...    63   5e-09   Homo sapiens [man]
gb:AF092441_1882633 Homo sapiens CBP mRNA, complete cds.               62   6e-09   
gb:XLA243591_2582458 Xenopus laevis mRNA for hnRNP-E2 protein.         61   1e-08   
gb:BC084195_2563585 Xenopus laevis hnRNP-E2 protein, mRNA (cDNA ...    61   1e-08   
gb:BC074565_2558060 Xenopus tropicalis poly(rC) binding protein ...    61   1e-08   
gb:BC041241_2547876 Xenopus laevis poly(rC) binding protein 2, m...    61   1e-08   
gb:BC010694_2091058 Mus musculus poly(rC) binding protein 4, mRN...    61   1e-08   
gb:AK077632_1171966 Mus musculus 8 days embryo whole body cDNA, ...    61   1e-08   
gb:AK005383_1152981 Mus musculus adult male cerebellum cDNA, RIK...    61   1e-08   
sp|P57724|PCB4_MOUSE|PCB4_MOUSE Poly(rC)-binding protein 4 (Alpha-CP4).>gb:...    61   1e-08   Mus musculus [mouse]
gb:BC083972_2563385 Xenopus laevis hypothetical LOC494905, mRNA ...    60   2e-08   
gb:AY398394_2531924 Danio rerio clone RK075A2E10 poly(rC) bindin...    60   2e-08   
gb:MMPCBPSVE_2116898 M.musculus mRNA for poly(C)-binding protein...    60   2e-08   
gb:MMCBPRNA_2114434 M.musculus mCBP mRNA.                              60   2e-08   
gb:BC071942_1988896 Homo sapiens poly(rC) binding protein 2, tra...    60   2e-08   
gb:AB188306_1874309 Homo sapiens PCBP2 mRNA for poly(rC) binding...    60   2e-08   
gb:AX711240_1473664 Sequence 7 from Patent WO03016343.                 60   2e-08   
gb:AX711238_1473663 Sequence 5 from Patent WO03016343.                 60   2e-08   
gb:AF275629_1257877 Drosophila melanogaster bancal protein mRNA,...    60   2e-08   
sp|Q61990|PCB2_MOUSE|PCB2_MOUSE Poly(rC)-binding protein 2 (Alpha-CP2) (Put...    60   2e-08   Mus musculus [mouse]
sp|Q15366|PCB2_HUMAN|PCB2_HUMAN Poly(rC)-binding protein 2 (Alpha-CP2) (hnR...    60   2e-08   Homo sapiens [man]
gb:BC074333_2557844 Xenopus laevis MGC84166 protein, mRNA (cDNA ...    60   3e-08   
gb:BC079196_2107323 Rattus norvegicus poly(rC) binding protein 3...    60   3e-08   
gb:BC042440_2098614 Mus musculus poly(rC) binding protein 3, mRN...    60   3e-08   
gb:AF176327_2057827 Mus musculus alphaCP-3 (Pcbp3) mRNA, complet...    60   3e-08   
gb:BC012061_1973407 Homo sapiens poly(rC) binding protein 3, mRN...    60   3e-08   
gb:AY780793_1964717 Homo sapiens poly(rC) binding protein 3 (PCB...    60   3e-08   
gb:AK094301_1914139 Homo sapiens cDNA FLJ36982 fis, clone BRACE2...    60   3e-08   
gb:AK079564_1172737 Mus musculus adult male hypothalamus cDNA, R...    60   3e-08   
gb:AK034811_1163883 Mus musculus 12 days embryo embryonic body b...    60   3e-08   
sp|P57722|PCB3_MOUSE|PCB3_MOUSE Poly(rC)-binding protein 3 (Alpha-CP3).           60   3e-08   Mus musculus [mouse]
sp|P57721|PCB3_HUMAN|PCB3_HUMAN Poly(rC)-binding protein 3 (Alpha-CP3).>gb:...    60   3e-08   Homo sapiens [man]
gb:BC056323_2551763 Danio rerio zgc:65870, mRNA (cDNA clone MGC:...    60   4e-08   
gb:HSRNPE1_2020121 H.sapiens hnRNP-E1 mRNA.                            60   4e-08   
gb:HSNUACBIP_2019231 H.sapiens mRNA for nucleic acid binding pro...    60   4e-08   
gb:AX711234_1473661 Sequence 1 from Patent WO03016343.                 60   4e-08   
sp|Q15365|PCB1_HUMAN|PCB1_HUMAN Poly(rC)-binding protein 1 (Alpha-CP1) (hnR...    60   4e-08   Homo sapiens [man]
gb:BC017098_1975906 Homo sapiens poly(rC) binding protein 4, mRN...    59   5e-08   
gb:DME238947_1378938 Drosophila melanogaster mRNA for Hrb57A rib...    59   5e-08   
gb:AF142631_1244390 Drosophila melanogaster hnRNP K protein homo...    59   5e-08   
gb:AE013599_1132956 Drosophila melanogaster chromosome 2R, compl...    59   5e-08   
gb:AE013599_1132955 Drosophila melanogaster chromosome 2R, compl...    59   5e-08   
gb:AP001539_1821279 Oryza sativa (japonica cultivar-group) genom...    59   7e-08   
gb:AC006714_1203839 Caenorhabditis elegans cosmid Y119D3B, compl...    59   9e-08   
gb:AF525701_1808321 Arabidopsis thaliana HEN4 isoform 2 (HEN4) m...    58   1e-07   
gb:AF525700_1808320 Arabidopsis thaliana HEN4 (HEN4) mRNA, compl...    58   1e-07   
gb:AY062686_1565342 Arabidopsis thaliana RNA-binding protein-lik...    58   1e-07   
gb:AB018116_1513841 Arabidopsis thaliana genomic DNA, chromosome...    58   1e-07   
gb:AB008268_1510468 Arabidopsis thaliana genomic DNA, chromosome...    57   3e-07   
gb:AE016959_1022570 Oryza sativa (japonica cultivar-group) chrom...    55   7e-07   
gb:BC054653_2551062 Danio rerio heterogeneous nuclear ribonucleo...    54   3e-06   
gb:AJ720731_2502918 Gallus gallus mRNA for hypothetical protein,...    54   3e-06   
gb:AL354733_1923325 Human DNA sequence from clone RP11-575L7 on ...    52   8e-06   
gb:AE017350_1758965 Cryptococcus neoformans var. neoformans JEC2...    52   8e-06   
gb:AK051313_1169649 Mus musculus 12 days embryo spinal ganglion ...    52   8e-06   
gb:BC064170_2553723 Xenopus tropicalis hypothetical protein MGC7...    52   1e-05   
sp|Q80WA4|NOA1_RAT|NOA1_RAT RNA-binding protein Nova-1 (Neuro-oncological...    52   1e-05   Rattus norvegicus [brown rat]
gb:BC044711_2548907 Xenopus laevis heterogeneous nuclear ribonuc...    50   2e-05   
gb:AP005311_1850362 Oryza sativa (japonica cultivar-group) genom...    50   2e-05   
pir|S41224|S41224 hnRNP protein - African clawed frog                  50   2e-05   Xenopus laevis [clawed frog]
gb:BC074252_2557767 Xenopus laevis MGC84002 protein, mRNA (cDNA ...    50   4e-05   
gb:CR382134_1667264 Debaryomyces hansenii chromosome B of strain...    50   4e-05   
gb:CR382137_1670416 Debaryomyces hansenii chromosome E of strain...    49   5e-05   
gb:HSU70477_2025805 Human putative astrocytic NOVA-like RNA-bind...    49   9e-05   
sp|Q9UNW9|NOA2_HUMAN|NOA2_HUMAN RNA-binding protein Nova-2 (Neuro-oncologic...    49   9e-05   Homo sapiens [man]
gb:AP003572_1831069 Oryza sativa (japonica cultivar-group) genom...    48   2e-04   
gb:BC059161_2103677 Rattus norvegicus cDNA clone MGC:72982 IMAGE...    47   2e-04   
gb:BC057030_2102548 Mus musculus tudor and KH domain containing ...    47   2e-04   
sp|Q80VL1|TDRH_MOUSE|TDRH_MOUSE Tudor and KH domain containing protein.>gb:...    47   2e-04   Mus musculus [mouse]
gb:AB072788_1871306 Macaca fascicularis testis cDNA clone:QtsA-2...    47   3e-04   
gb:BC072959_2556878 Xenopus laevis cDNA clone MGC:82481 IMAGE:49...    47   3e-04   
gb:BC032690_1980619 Homo sapiens tudor and KH domain containing ...    47   3e-04   
gb:AL589765_1929175 Human DNA sequence from clone RP11-98D18 on ...    47   3e-04   
gb:AF227192_1891523 Homo sapiens tudor and KH domain-containing ...    47   3e-04   
gb:AC006540_1875178 Homo sapiens chromosome 19, cosmid F23842, c...    47   3e-04   
gb:AX711236_1473662 Sequence 3 from Patent WO03016343.                 47   3e-04   
sp|Q9Y2W6|TDRH_HUMAN|TDRH_HUMAN Tudor and KH domain containing protein.>gb:...    47   3e-04   Homo sapiens [man]
sp|Q9JKN6|NOA1_MOUSE|NOA1_MOUSE RNA-binding protein Nova-1 (Neuro-oncologic...    47   3e-04   Mus musculus [mouse]
gb:MUSPHOSPHO_2129634 Mus cookii phosphoprotein mRNA, complete cds.    46   4e-04   
gb:AC024089_1204191 Caenorhabditis elegans cosmid C36E6, complet...    46   4e-04   
pir|T41600|T41600 probable pre-mRNA splicing factor - fission ye...    46   4e-04   Schizosaccharomyces pombe
gb:BC075038_1989537 Homo sapiens neuro-oncological ventral antig...    46   6e-04   
gb:AE017344_1756264 Cryptococcus neoformans var. neoformans JEC2...    46   6e-04   
gb:U00047_1401485 Caenorhabditis elegans cosmid ZK418, complete ...    45   8e-04   
gb:U00047_1401484 Caenorhabditis elegans cosmid ZK418, complete ...    45   8e-04   
pir|T27855|T27855 hypothetical protein ZK418.9 - Caenorhabditis ...    45   8e-04   Caenorhabditis elegans [roundworm]
gb:AJ719686_2501873 Gallus gallus mRNA for hypothetical protein,...    45   0.001   
gb:AF257771_1893222 Homo sapiens RNA binding protein MCG10 mRNA,...    45   0.001   
gb:BX842627_1643867 Neurospora crassa DNA linkage group I BAC cl...    45   0.001   
pir|T04011|T04011 hypothetical protein T5L19.200 - Arabidopsis t...    45   0.001   Arabidopsis thaliana [mouse-ear cress]
gb:BT001739_1356512 Drosophila melanogaster RE72930 full insert ...    45   0.001   
gb:AE014298_1125119 Drosophila melanogaster chromosome X, comple...    45   0.001   
gb:AE014298_1125114 Drosophila melanogaster chromosome X, comple...    45   0.001   
sp|P51513|NOA1_HUMAN|NOA1_HUMAN RNA-binding protein Nova-1 (Neuro-oncologic...    45   0.001   Homo sapiens [man]
gb:AF161270_2477760 Danio rerio Vg1 RNA binding protein mRNA, co...    44   0.002   
gb:CR382126_1658831 Kluyveromyces lactis strain NRRL Y-1140 chro...    44   0.002   
pir|C86460|C86460 F14M2.18 protein - Arabidopsis thaliana>gb:AE0...    44   0.002   Arabidopsis thaliana [mouse-ear cress]
gb:HSTUNPB_2021343 H.sapiens tunp mRNA for transformation upregu...    44   0.003   
gb:AY911506_1966107 Homo sapiens heterogeneous nuclear ribonucle...    44   0.003   
gb:AL354733_1923322 Human DNA sequence from clone RP11-575L7 on ...    44   0.003   
pir|S43363|S43363 transformation upregulated nuclear protein - h...    44   0.003   Homo sapiens [man]
pir|A54143|A54143 kappa-B motif-binding phosphoprotein - mouse         44   0.003   Mus sp. [mice]
sp|O19049|ROK_RABIT|ROK_RABIT Heterogeneous nuclear ribonucleoprotein K (h...    44   0.003   Oryctolagus cuniculus [domestic rabbit]
sp|P61978|ROK_HUMAN|ROK_HUMAN Heterogeneous nuclear ribonucleoprotein K (h...    44   0.003   Homo sapiens [man]
gb:AY223387_1176847 Schistosoma japonicum clone ZZZ282 mRNA sequ...    43   0.004   
gb:AY223294_1176755 Schistosoma japonicum clone ZZD545 mRNA sequ...    43   0.004   
gb:XLA421448_2582574 Xenopus laevis mRNA for hnRNP-E2 protein co...    43   0.005   
gb:AF042353_2470351 Xenopus laevis KH domain-containing transcri...    43   0.005   
pir|E84614|E84614 probable RNA-binding protein [imported] - Arab...    43   0.005   Arabidopsis thaliana [mouse-ear cress]
gb:BC054552_2101757 Mus musculus RIKEN cDNA C330012H03 gene, mRN...    42   0.006   
gb:AY531659_2086245 Mus musculus insulin-like growth factor 2 mR...    42   0.006   
gb:AF117107_1884607 Homo sapiens IGF-II mRNA-binding protein 2 (...    42   0.006   
gb:AF057352_1879624 Homo sapiens hepatocellular carcinoma autoan...    42   0.006   
gb:CR858786_1182937 Pongo pygmaeus mRNA; cDNA DKFZp468I2113 (fro...    42   0.006   
sp|P38151|PBP2_YEAST|PBP2_YEAST PAB1-binding protein 2.>pir|S46109|S46109 h...    42   0.006   Saccharomyces cerevisiae [brewer's yeast]
gb:AP004020_1836484 Oryza sativa (japonica cultivar-group) genom...    42   0.008   
gb:CR380957_1652820 Candida glabrata strain CBS138 chromosome K ...    42   0.008   
gb:AK088465_1175421 Mus musculus 2 days neonate thymus thymic ce...    42   0.008   
gb:AK011689_1156543 Mus musculus 10 days embryo whole body cDNA,...    42   0.008   
gb:AF055923_2470970 Xenopus laevis RNA binding protein Vera mRNA...    42   0.011   
gb:AF026527_2469215 Gallus gallus zipcode-binding protein (ZBP1)...    41   0.014   
gb:HSU69127_2025685 Human FUSE binding protein 3 (FBP3) mRNA, pa...    41   0.014   
gb:AL353695_1922945 Human DNA sequence from clone RP11-17L7 on c...    41   0.014   
gb:AF117108_1884608 Homo sapiens IGF-II mRNA-binding protein 3 (...    41   0.014   
gb:AX397963_1467054 Sequence 1 from Patent WO0220036.>gb:HSU7670...    41   0.014   
sp|Q96I24|FUB3_HUMAN|FUB3_HUMAN Far upstream element binding protein 3 (FUS...    41   0.014   Homo sapiens [man]
gb:AF541940_2067917 Rattus norvegicus b-actin zipcode binding pr...    41   0.019   
gb:AF117106_1884606 Homo sapiens IGF-II mRNA-binding protein 1 (...    41   0.019   
gb:AK044850_1167165 Mus musculus 9.5 days embryo parthenogenote ...    41   0.019   
gb:AK013940_1157708 Mus musculus 13 days embryo head cDNA, RIKEN...    41   0.019   
gb:AP004589_1841981 Oryza sativa (japonica cultivar-group) genom...    40   0.024   
gb:BT015219_1358296 Drosophila melanogaster RE39088 full insert ...    40   0.024   
gb:BT001623_1356396 Drosophila melanogaster RE36563 full insert ...    40   0.024   
gb:AY089247_1296903 Drosophila melanogaster AT03366 full insert ...    40   0.024   
gb:AE014297_1138659 Drosophila melanogaster chromosome 3R, compl...    40   0.024   
gb:AE014297_1138658 Drosophila melanogaster chromosome 3R, compl...    40   0.024   
gb:AE014297_1138657 Drosophila melanogaster chromosome 3R, compl...    40   0.024   
gb:AE014297_1138656 Drosophila melanogaster chromosome 3R, compl...    40   0.024   
pir|T48439|T48439 probable RNA-binding protein - Arabidopsis tha...    40   0.024   Arabidopsis thaliana [mouse-ear cress]
gb:BC085379_2564330 Danio rerio zgc:101598, mRNA (cDNA clone MGC...    40   0.032   
gb:BC051679_2100822 Mus musculus insulin-like growth factor 2, b...    40   0.032   
gb:AF198254_1889669 Homo sapiens mRNA-binding protein CRDBP mRNA...    40   0.032   
gb:AE016819_1748818 Ashbya gossypii (= Eremothecium gossypii) AT...    40   0.032   
gb:CEY59A8B_1370764 Caenorhabditis elegans YAC Y59A8B, complete ...    40   0.032   
gb:AB014597_1864626 Homo sapiens mRNA for KIAA0697 protein, part...    40   0.042   
pir|T00353|T00353 hypothetical protein KIAA0697 - human (fragment)     40   0.042   Homo sapiens [man]
gb:AF533513_2499788 Xenopus laevis RNA-binding protein VgRBP71 m...    39   0.055   
gb:AK129193_2069424 Mus musculus mRNA for mKIAA0697 protein.           39   0.055   
gb:AX886111_1481564 Sequence 1974 from Patent EP1033401.               39   0.055   
gb:CQ783746_1452609 Sequence 3886 from Patent EP1396543.               39   0.055   
gb:BT001672_1356445 Drosophila melanogaster RE50346 full insert ...    39   0.055   
gb:AY069684_1294414 Drosophila melanogaster LD45549 full length ...    39   0.055   
gb:AE013599_1132959 Drosophila melanogaster chromosome 2R, compl...    39   0.055   
gb:AE013599_1132958 Drosophila melanogaster chromosome 2R, compl...    39   0.055   
gb:AJ719508_2501695 Gallus gallus mRNA for hypothetical protein,...    39   0.093   
gb:HSM808636_1188017 Homo sapiens mRNA; cDNA DKFZp686F1078 (from...    39   0.093   
gb:BC044277_2548610 Xenopus laevis far upstream element (FUSE) b...    38   0.12    
gb:AY505473_1609843 Chlamydomonas reinhardtii circadian RNA-bind...    38   0.12    
pir|T19217|T19217 hypothetical protein C12D8.1b - Caenorhabditis...    38   0.12    Caenorhabditis elegans [roundworm]
pir|T19216|T19216 hypothetical protein C12D8.1a - Caenorhabditis...    38   0.12    Caenorhabditis elegans [roundworm]
pir|T49942|T49942 hypothetical protein F17I14.250 - Arabidopsis ...    38   0.12    Arabidopsis thaliana [mouse-ear cress]
gb:BT012113_1641320 Arabidopsis thaliana At2g03110 gene, complet...    38   0.16    
gb:AL589765_1929173 Human DNA sequence from clone RP11-98D18 on ...    37   0.21    
gb:AE016818_1748331 Ashbya gossypii (= Eremothecium gossypii) AT...    37   0.21    
gb:OSJN00087_1694663 Oryza sativa genomic DNA, chromosome 4, BAC...    37   0.21    
pir|T02715|T02715 probable RNA-binding protein [imported] - Arab...    37   0.21    Arabidopsis thaliana [mouse-ear cress]
gb:HSM806899_1187767 Homo sapiens mRNA; cDNA DKFZp686K2175 (from...    37   0.27    
gb:BC060400_2552868 Xenopus laevis hypothetical protein MGC68532...    37   0.35    
gb:AL354733_1923326 Human DNA sequence from clone RP11-575L7 on ...    37   0.35    
gb:AX880689_1478378 Sequence 15594 from Patent EP1074617.              37   0.35    
gb:SSHNRNP_1445413 S.scrofa mRNA for heterogeneous nuclear ribon...    37   0.35    
gb:AE012920_287116 Chlorobium tepidum TLS section 141 of 194 of ...    37   0.35    
pir|T25832|T25832 hypothetical protein M01A10.1 - Caenorhabditis...    37   0.35    Caenorhabditis elegans [roundworm]
gb:BC070981_2555855 Xenopus laevis cDNA clone MGC:78835 IMAGE:34...    36   0.46    
gb:AE017349_1758721 Cryptococcus neoformans var. neoformans JEC2...    36   0.46    
gb:AE014187_938616 Plasmodium falciparum 3D7 chromosome 14 compl...    36   0.46    
gb:U80444_1406263 Caenorhabditis elegans cosmid F26B1, complete ...    36   0.60    
gb:CR861335_1185338 Pongo pygmaeus mRNA; cDNA DKFZp459K2011 (fro...    36   0.60    
pir|T30168|T30168 hypothetical protein F26B1.2 - Caenorhabditis ...    36   0.60    Caenorhabditis elegans [roundworm]
gb:BC063902_2553605 Xenopus tropicalis hypothetical protein MGC7...    35   0.79    
gb:AX876322_1476475 Sequence 11227 from Patent EP1074617.              35   0.79    
sp|Q58928|YF33_METJA|YF33_METJA Hypothetical protein MJ1533.>pir|D64491|D64...    35   1.0     Methanocaldococcus jannaschii
gb:AF257770_1893221 Homo sapiens RNA binding protein MCG10 mRNA,...    35   1.3     
gb:AF141340_1885886 Homo sapiens LYST-interacting protein LIP4 m...    35   1.3     
gb:AF305618_2062275 Rattus norvegicus nuclear RNA binding protei...    34   1.8     
gb:AF098796_2054420 Mus musculus SLM-1 (Slm1) mRNA, complete cds.      34   1.8     
gb:U05040_2042606 Homo sapiens FUSE binding protein mRNA, comple...    34   1.8     
gb:BC034043_1981185 Homo sapiens KH domain containing, RNA bindi...    34   1.8     
gb:BC017247_1975988 Homo sapiens far upstream element (FUSE) bin...    34   1.8     
gb:BC001325_1967489 Homo sapiens, clone IMAGE:3456579, mRNA, par...    34   1.8     
gb:AL138882_1920053 Human DNA sequence from clone RP1-195K21 on ...    34   1.8     
gb:CR382129_1661401 Yarrowia lipolytica chromosome C of strain C...    34   1.8     
gb:CEM88_1366349 Caenorhabditis elegans cosmid M88, complete seq...    34   1.8     
gb:CEM88_1366348 Caenorhabditis elegans cosmid M88, complete seq...    34   1.8     
pir|T23837|T23837 hypothetical protein M88.5 - Caenorhabditis el...    34   1.8     Caenorhabditis elegans [roundworm]
pir|A53184|A53184 myc far upstream element-binding protein - human     34   1.8     Homo sapiens [man]
sp|Q96AE4|FUB1_HUMAN|FUB1_HUMAN Far upstream element binding protein 1 (FUS...    34   1.8     Homo sapiens [man]
gb:BC067711_2554878 Danio rerio zgc:85948, mRNA (cDNA clone MGC:...    34   2.3     
gb:BC046731_2549720 Xenopus laevis similar to neuro-oncological ...    34   2.3     
gb:AF440570_2255861 Shrimp white spot syndrome virus, complete g...    34   2.3     
gb:AF332093_2236699 White spot syndrome virus, complete genome.        34   2.3     
gb:BC014305_1974524 Homo sapiens high density lipoprotein bindin...    34   2.3     
gb:AK131375_1917915 Homo sapiens cDNA FLJ16432 fis, clone BRACE3...    34   2.3     
gb:AK127833_1916921 Homo sapiens cDNA FLJ45936 fis, clone PLACE7...    34   2.3     
gb:CR382127_1660195 Yarrowia lipolytica chromosome A of strain C...    34   2.3     
gb:CR380958_1653342 Candida glabrata strain CBS138 chromosome L ...    34   2.3     
gb:CR861421_1185416 Pongo pygmaeus mRNA; cDNA DKFZp459P222 (from...    34   2.3     
gb:CR859426_1183543 Pongo pygmaeus mRNA; cDNA DKFZp469M026 (from...    34   2.3     
gb:CR858804_1182954 Pongo pygmaeus mRNA; cDNA DKFZp459O137 (from...    34   2.3     
gb:AP006840_568272 Symbiobacterium thermophilum DNA, complete ge...    34   2.3     
pir|T41389|T41389 rna binding protein - fission yeast (Schizosac...    34   2.3     Schizosaccharomyces pombe
pir|S42933|S42933 hypothetical protein 1087 - maize>gb:ZMTS1087_...    34   2.3     Zea mays [maize]
sp|Q8VDJ3|VGLN_MOUSE|VGLN_MOUSE Vigilin (High density lipoprotein-binding p...    34   2.3     Mus musculus [mouse]
sp|Q00341|VGLN_HUMAN|VGLN_HUMAN Vigilin (High density lipoprotein-binding p...    34   2.3     Homo sapiens [man]
gb:AF533514_2499789 Xenopus laevis FUSE binding protein-like pro...    33   3.0     
gb:DME238847_1378935 Drosophila melanogaster mRNA for drosophila...    33   3.0     
gb:AF132167_1243579 Drosophila melanogaster clone LD21383 unknow...    33   3.0     
gb:AE013599_1132624 Drosophila melanogaster chromosome 2R, compl...    33   3.0     
gb:BA000021_686968 Wigglesworthia glossinidia endosymbiont of Gl...    33   3.0     
sp|Q9Z1A6|VGLN_RAT|VGLN_RAT Vigilin (High density lipoprotein-binding pro...    33   3.0     Rattus norvegicus [brown rat]
sp|P51115|FXR1_XENLA|FXR1_XENLA Fragile X mental retardation syndrome relat...    33   3.0     Xenopus laevis [clawed frog]
gb:BC044314_2548627 Xenopus laevis high density lipoprotein bind...    33   3.9     
gb:AY057837_2510221 Gallus gallus Maxi-KH type RNA binding prote...    33   3.9     
gb:AF305619_2062276 Rattus norvegicus nuclear RNA binding protei...    33   3.9     
gb:BC010132_1972506 Homo sapiens KH domain containing, RNA bindi...    33   3.9     
gb:AK091346_1913459 Homo sapiens cDNA FLJ34027 fis, clone FCBBF2...    33   3.9     
gb:AK050520_1169351 Mus musculus adult pancreas islet cells cDNA...    33   3.9     
pir|I49140|I49140 p62 ras-GAP associated phosphoprotein - mouse>...    33   3.9     Mus musculus [mouse]
pir|A38219|A38219 GAP-associated tyrosine phosphoprotein p62 - h...    33   3.9     Homo sapiens [man]
sp|Q91WJ8|FUB1_MOUSE|FUB1_MOUSE Far upstream element binding protein 1 (FUS...    33   3.9     Mus musculus [mouse]
gb:AF389403_2491105 Takifugu rubripes pericentriolar material 1 ...    33   5.1     
gb:AF042797_2470357 Takifugu rubripes FRG1 (FRG1), N-acylsphingo...    33   5.1     
gb:AF532627_1809429 Glycine max syntaxin mRNA, complete cds.           33   5.1     
gb:CR382125_1657766 Kluyveromyces lactis strain NRRL Y-1140 chro...    33   5.1     
gb:AY051900_1290494 Drosophila melanogaster LD38872 full length ...    33   5.1     
gb:AE013599_1132304 Drosophila melanogaster chromosome 2R, compl...    33   5.1     
gb:AE013599_1132303 Drosophila melanogaster chromosome 2R, compl...    33   5.1     
gb:AE013599_1132302 Drosophila melanogaster chromosome 2R, compl...    33   5.1     
gb:AE014295_312208 Bifidobacterium longum NCC2705, complete genome.    33   5.1     
gb:CR522870_100060 Desulfotalea psychrophila LSv54 chromosome.         33   5.1     
gb:CP000027_79954 Dehalococcoides ethenogenes 195, complete genome.    33   5.1     
sp|Q824W6|Y022_CHLCV|Y022_CHLCV Hypothetical UPF0109 protein CCA00022.>gb:A...    33   5.1     Chlamydia caviae
gb:BC051153_2550406 Danio rerio high density lipoprotein-binding...    32   6.7     
gb:AF152547_2056764 Rattus norvegicus Sam68-like protein SLM-2 (...    32   6.7     
gb:AY077838_1935967 Homo sapiens Sam68-like mammalian protein 1 ...    32   6.7     
gb:AY035162_1559929 Arabidopsis thaliana unknown protein (At1g30...    32   6.7     
gb:BX248358_762741 Corynebacterium diphtheriae gravis NCTC13129,...    32   6.7     
pir|D86432|D86432 hypothetical protein T5I8.14 - Arabidopsis tha...    32   6.7     Arabidopsis thaliana [mouse-ear cress]
pir|E86580|E86580 CT659 hypothetical protein [imported] - Chlamy...    32   6.7     Chlamydia pneumoniae
sp|Q09848|YAE8_SCHPO|YAE8_SCHPO Hypothetical protein C23D3.08 in chromosome...    32   6.7     Schizosaccharomyces pombe
sp|Q9Z7I5|Y720_CHLPN|Y720_CHLPN UPF0109 protein CPn0720/CP0026/CPj0720/CpB0...    32   6.7     Chlamydia pneumoniae
sp|O84666|Y659_CHLTR|Y659_CHLTR UPF0109 protein CT659.>pir|E71487|E71487 hy...    32   6.7     Chlamydia trachomatis
sp|Q9PLR5|Y030_CHLMU|Y030_CHLMU Hypothetical UPF0109 protein TC0030.>pir|B8...    32   6.7     Chlamydia muridarum [agent of mouse pneumonitis]
gb:BC066814_2105837 Mus musculus cDNA clone IMAGE:30102004, part...    32   8.7     
gb:U80444_1406262 Caenorhabditis elegans cosmid F26B1, complete ...    32   8.7     
gb:AK051807_1169823 Mus musculus 12 days embryo eyeball cDNA, RI...    32   8.7     
gb:AP008231_581361 Synechococcus elongatus PCC 6301 DNA, complet...    32   8.7     
gb:AP006841_574841 Bacteroides fragilis YCH46 DNA, complete genome.    32   8.7     
gb:CR378677_97620 Photobacterium profundum SS9 chromosome 2; seg...    32   8.7     
pir|T44900|T44900 probable polyribonucleotide nucleotidyltransfe...    32   8.7     
pir|H87015|H87015 hypothetical protein gpsI [imported] - Mycobac...    32   8.7     


>gb:AC084766_1733769 Oryza sativa chromosome 3 BAC OSJNBb0048D20
           genomic sequence, complete sequence.
          Length = 542

 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 47/140 (33%), Positives = 76/140 (54%), Gaps = 8/140 (5%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSK------ 389
           D VYR + PS++IG +IG+ G   +++R +T+A I+I +++S  +ERVI I S       
Sbjct: 39  DTVYRYLCPSRKIGSIIGRGGEIAKQMRADTQAKIRIGESVSGCDERVITIFSSSRETNT 98

Query: 390 --DNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGV 563
             D +   C A+ AL ++   +  DD+   E    G   V   +VR L+   Q G +IG 
Sbjct: 99  LVDAEDKVCPAQDALFRVHEKLSIDDDIGNEESDEGLAQV---TVRLLVPSDQIGCIIGK 155

Query: 564 SGQNIENLRISSGATVTVLA 623
            G  I+ +R  +GA + VL+
Sbjct: 156 GGHIIQGIRSDTGAHIRVLS 175



 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 41/156 (26%), Positives = 79/156 (50%), Gaps = 2/156 (1%)
 Frame = +3

Query: 165 DEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIAD 344
           D AG    +  P ++    +++   R++  +  +G VIGK G  I++IR+E+ A IK+ D
Sbjct: 259 DVAGDWPSIYQP-RREESSAKEFSLRLLCAASNVGGVIGKGGGIIKQIRQESGAFIKV-D 316

Query: 345 AISRHEERVIIISSKD--NDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSV 518
           + +  ++ +I +S+K+   D       +A+H       K D  +          +P+ + 
Sbjct: 317 SSNTEDDCIITVSAKEFFEDPVSPTINAAVHLQPRCSEKTDPESA---------IPSYTT 367

Query: 519 RFLIAGSQAGGLIGVSGQNIENLRISSGATVTVLAQ 626
           R L++ S+ G LIG  G  I  +R +S A + +L++
Sbjct: 368 RLLVSTSRIGCLIGKGGSIITEIRRTSRANIRILSK 403



>pir|T04255|T04255 hypothetical protein F20B18.110 - Arabidopsis
           thaliana>gb:ATCHRIV64_1546481 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           64.>gb:ATF20B18_1549448 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F20B18 (ESSA
           project).>gb:AY056288_1563601 Arabidopsis thaliana
           putative nucleic acid binding protein (At4g26000) mRNA,
           complete cds.>gb:AY099659_1576684 Arabidopsis thaliana
           putative nucleic acid binding protein (At4g26000) mRNA,
           complete cds.>gb:AY114064_1578475 Arabidopsis thaliana
           putative nucleic acid binding protein (At4g26000) mRNA,
           complete cds.
          Length = 495

 Score = 76.3 bits (186), Expect = 4e-13
 Identities = 48/137 (35%), Positives = 83/137 (60%), Gaps = 4/137 (2%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTF 407
           D V+R+IVP  ++G +IG+ G  I+K+ EETRA IK+ D      +R+++IS K+    +
Sbjct: 73  DCVFRMIVPVTKVGAIIGRKGDFIKKMCEETRARIKVLDGPVNTPDRIVLISGKEEPEAY 132

Query: 408 ----CDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQN 575
                DA   + + V+ +  +D+ +++     AG V  +SVR L+A +QA  LIG  G  
Sbjct: 133 MSPAMDAVLRVFRRVSGLPDNDDDDVQ----NAGSV-FSSVRLLVASTQAINLIGKQGSL 187

Query: 576 IENLRISSGATVTVLAQ 626
           I+++  +SGA+V +L++
Sbjct: 188 IKSIVENSGASVRILSE 204



>gb:AE016959_1023238 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC068950_1540554
           Oryza sativa chromosome 10 BAC OSJNBa0041P03 genomic
           sequence, complete sequence.>gb:AE017108_1753057 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           62 of 77 of the complete sequence.
          Length = 762

 Score = 73.9 bits (180), Expect = 2e-12
 Identities = 48/147 (32%), Positives = 79/147 (53%), Gaps = 16/147 (10%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIII---SSKDND 398
           + +YRI+ P K+IG V+G+ G  ++ +R+ T+A I++AD+I   +ERVIII   SS+  +
Sbjct: 45  ETIYRILCPVKKIGSVLGRGGDIVKALRDTTKAKIRVADSIPGADERVIIIFNYSSQTEE 104

Query: 399 GT-------------FCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGS 539
                           C A+ AL +I   I  D++ +   +   + +V     R L+ G+
Sbjct: 105 AAQNISTDGFEDMKPHCFAQDALLKIHDKIAADEDLHAGIVHEKSENVDDVIARILVPGN 164

Query: 540 QAGGLIGVSGQNIENLRISSGATVTVL 620
           Q G L+G  G  I+ LR  +GA + VL
Sbjct: 165 QVGCLLGKGGSIIQQLRNDTGAGIRVL 191



 Score = 48.9 bits (115), Expect = 7e-05
 Identities = 34/148 (22%), Positives = 74/148 (50%), Gaps = 5/148 (3%)
 Frame = +3

Query: 198 PLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIAD-AISRHEERVI 374
           PL+     +++   +I+  S+ IG+VIGK G  ++++ ++T A +++ +   +  EER+I
Sbjct: 284 PLQYHSAEAEEFSIKILCASEHIGQVIGKSGGNVRQVEQQTGACVQVKEVGKNASEERLI 343

Query: 375 IISSK----DNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQ 542
           ++SS+    D      +A   LH  V+ + ++                  + R ++  ++
Sbjct: 344 VVSSQEIPDDPVSPTIEALILLHSKVSTLAENHHL---------------TTRLVVPSNK 388

Query: 543 AGGLIGVSGQNIENLRISSGATVTVLAQ 626
            G +IG  G+ I  +R  +GA + V ++
Sbjct: 389 VGCIIGEGGKVITEMRRRTGAEIRVYSK 416



>gb:BT006443_1639330 Arabidopsis thaliana At1g14170 gene, complete
           cds.
          Length = 454

 Score = 73.2 bits (178), Expect = 3e-12
 Identities = 47/147 (31%), Positives = 77/147 (52%), Gaps = 9/147 (6%)
 Frame = +3

Query: 207 KRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISS 386
           + V  S+D VYR + P K+ G +IGK G   ++IR ET++ ++I +A+   EERV+ + S
Sbjct: 11  QNVIASEDTVYRYLCPVKKTGSIIGKGGEIAKQIRSETKSNMRINEALPGCEERVVTMYS 70

Query: 387 K--------DNDGTFCDAESALHQIVTLILKD-DESNIEAMKAGAGHVPANSVRFLIAGS 539
                    D+    C A  AL ++  +++ D D+ +        G     +VR L+   
Sbjct: 71  TNEELNHFGDDGELVCPALDALFKVHDMVVADADQDDGTDDDNDLGEKQTVTVRMLVPSD 130

Query: 540 QAGGLIGVSGQNIENLRISSGATVTVL 620
           Q G +IG  GQ I+NLR  + A + V+
Sbjct: 131 QIGCVIGKGGQVIQNLRNDTNAQIRVI 157



 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 42/141 (29%), Positives = 74/141 (52%), Gaps = 1/141 (0%)
 Frame = +3

Query: 201 LKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIII 380
           +++ +  +++     I P++ +G VIGK G  I +IR+ET ATI++  + +  ++ +I I
Sbjct: 234 VRRDIADAREFCVCFICPAENVGGVIGKGGGFINQIRQETGATIRVNTSETDDDDCIIFI 293

Query: 381 SSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGA-GHVPANSVRFLIAGSQAGGLI 557
           SSK+    + D   A++  + L  +  E      K G   +  A S R L++ SQ G LI
Sbjct: 294 SSKE---FYEDQSPAVNAAIRLQQRCSE------KVGKDANDLAISTRLLVSSSQIGCLI 344

Query: 558 GVSGQNIENLRISSGATVTVL 620
           G  G  I  +R  + A + +L
Sbjct: 345 GKGGAVISEMRSVTRANIRIL 365



>pir|C86275|C86275 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_890407 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC007576_1535954 Arabidopsis thaliana
           chromosome I BAC F7A19 genomic sequence, complete
           sequence.
          Length = 479

 Score = 73.2 bits (178), Expect = 3e-12
 Identities = 47/147 (31%), Positives = 77/147 (52%), Gaps = 9/147 (6%)
 Frame = +3

Query: 207 KRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISS 386
           + V  S+D VYR + P K+ G +IGK G   ++IR ET++ ++I +A+   EERV+ + S
Sbjct: 36  QNVIASEDTVYRYLCPVKKTGSIIGKGGEIAKQIRSETKSNMRINEALPGCEERVVTMYS 95

Query: 387 K--------DNDGTFCDAESALHQIVTLILKD-DESNIEAMKAGAGHVPANSVRFLIAGS 539
                    D+    C A  AL ++  +++ D D+ +        G     +VR L+   
Sbjct: 96  TNEELNHFGDDGELVCPALDALFKVHDMVVADADQDDGTDDDNDLGEKQTVTVRMLVPSD 155

Query: 540 QAGGLIGVSGQNIENLRISSGATVTVL 620
           Q G +IG  GQ I+NLR  + A + V+
Sbjct: 156 QIGCVIGKGGQVIQNLRNDTNAQIRVI 182



 Score = 55.8 bits (133), Expect = 6e-07
 Identities = 42/141 (29%), Positives = 74/141 (52%), Gaps = 1/141 (0%)
 Frame = +3

Query: 201 LKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIII 380
           +++ +  +++     I P++ +G VIGK G  I +IR+ET ATI++  + +  ++ +I I
Sbjct: 259 VRRDIADAREFCVCFICPAENVGGVIGKGGGFINQIRQETGATIRVNTSETDDDDCIIFI 318

Query: 381 SSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGA-GHVPANSVRFLIAGSQAGGLI 557
           SSK+    + D   A++  + L  +  E      K G   +  A S R L++ SQ G LI
Sbjct: 319 SSKE---FYEDQSPAVNAAIRLQQRCSE------KVGKDANDLAISTRLLVSSSQIGCLI 369

Query: 558 GVSGQNIENLRISSGATVTVL 620
           G  G  I  +R  + A + +L
Sbjct: 370 GKGGAVISEMRSVTRANIRIL 390



>gb:ATAC011437_1543273 Arabidopsis thaliana chromosome III BAC F7O18
           genomic sequence, complete sequence.>gb:AY070475_1566858
           Arabidopsis thaliana AT3g04610/F7O18_9 mRNA, complete
           cds.
          Length = 577

 Score = 72.8 bits (177), Expect = 4e-12
 Identities = 45/134 (33%), Positives = 74/134 (55%), Gaps = 3/134 (2%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTF 407
           + V+R++VP++++G +IG+ G  I+KI EETRA IKI D      ER +++S K+     
Sbjct: 186 ETVFRMLVPAQKVGSIIGRKGDVIKKIVEETRARIKILDGPPGTTERAVMVSGKE----- 240

Query: 408 CDAESALHQIVTLILKDDESNIEAMKAGAGHVPAN---SVRFLIAGSQAGGLIGVSGQNI 578
            + ES+L   +  +L+     ++ +   A   P     S R L+  SQAG LIG  G  +
Sbjct: 241 -EPESSLPPSMDGLLRVHMRIVDGLDGEASQAPPPSKVSTRLLVPASQAGSLIGKQGGTV 299

Query: 579 ENLRISSGATVTVL 620
           + ++ +S   V VL
Sbjct: 300 KAIQEASACIVRVL 313



>gb:BT001108_1635363 Arabidopsis thaliana clone C103247 (E) putative
           KH domain protein (At4g18375) mRNA, complete cds.
          Length = 532

 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 51/158 (32%), Positives = 80/158 (50%), Gaps = 17/158 (10%)
 Frame = +3

Query: 204 KKRV---KVSQD--IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEER 368
           K+R+   K+++D  +VYRI+ P   +G VIGK G  I  IR  T+A IK+ D +    +R
Sbjct: 22  KRRISHDKINRDELVVYRILCPIDVVGGVIGKSGKVINAIRHNTKAKIKVFDQLHGCSQR 81

Query: 369 VIII------------SSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPAN 512
           VI I             +K  +   C A+ AL ++   I+  DE N    K         
Sbjct: 82  VITIYCSVKEKQEEIGFTKSENEPLCCAQDALLKVYDAIVASDEEN--NTKTNVDRDDNK 139

Query: 513 SVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTVLAQ 626
             R L+  SQ+  LIG +G+NI+ +R  + A+V V+++
Sbjct: 140 ECRLLVPFSQSSSLIGKAGENIKRIRRRTRASVKVVSK 177



 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 40/161 (24%), Positives = 79/161 (49%), Gaps = 12/161 (7%)
 Frame = +3

Query: 171 AGTSAEVVPPLKKRVKV---------SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETR 323
           A T+A  VP     + V         S+++V++++ P   I +VIGK G  I++IRE + 
Sbjct: 283 AETAANPVPVFASSLPVTHGFGGSSRSEELVFKVLCPLCNIMRVIGKGGSTIKRIREASG 342

Query: 324 ATIKIADAISR--HEERVIIISSKDN-DGTFCDAESALHQIVTLILKDDESNIEAMKAGA 494
           + I++ D+ ++   +E VII+++ ++ D     A  A+  +   I  +D  N++      
Sbjct: 343 SCIEVNDSRTKCGDDECVIIVTATESPDDMKSMAVEAVLLLQEYINDEDAENVK------ 396

Query: 495 GHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
                  ++ L++    G +IG SG  I  +R  + A + +
Sbjct: 397 -------MQLLVSSKVIGCVIGKSGSVINEIRKRTNANICI 430



>pir|T49962|T49962 hypothetical protein F8M21.160 - Arabidopsis
           thaliana>gb:ATF8M21_1551265 Arabidopsis thaliana DNA
           chromosome 5, BAC clone F8M21 (ESSA project).
          Length = 568

 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 47/139 (33%), Positives = 76/139 (54%), Gaps = 8/139 (5%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVI-IISSKDNDGT 404
           D V+R + P K+IG VIG+ G  ++++R +TR+ I+I +AI   +ERVI I S  D    
Sbjct: 49  DTVFRYLCPVKKIGSVIGRGGDIVKQLRNDTRSKIRIGEAIPGCDERVITIYSPSDETNA 108

Query: 405 FCD-------AESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGV 563
           F D       A+ AL +I   ++ DD +  E    G   V A   + L+   Q G ++G 
Sbjct: 109 FGDGEKVLSPAQDALFRIHDRVVADD-ARSEDSPEGEKQVTA---KLLVPSDQIGCILGR 164

Query: 564 SGQNIENLRISSGATVTVL 620
            GQ ++N+R  +GA + ++
Sbjct: 165 GGQIVQNIRSETGAQIRIV 183



 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 36/129 (27%), Positives = 65/129 (50%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAE 419
           R++ P + I  VIGK G  I ++R+ETRATIK+  + +   + +I IS+++    F DA 
Sbjct: 287 RLVSPVENIASVIGKGGALINQLRQETRATIKVDSSRTEGNDCLITISARE---VFEDAY 343

Query: 420 SALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISS 599
           S   + V  +       +E        + + + R L+  S+ G ++G  G  I  +R  +
Sbjct: 344 SPTIEAVMRLQPKCSDKVERDSG----LVSFTTRLLVPSSRIGCILGKGGAIITEMRRMT 399

Query: 600 GATVTVLAQ 626
            A + +L +
Sbjct: 400 KANIRILGK 408



 Score = 43.1 bits (100), Expect = 0.004
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 5/120 (4%)
 Frame = +3

Query: 225 QDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-----DAISRHEERVIIISSK 389
           + +  +++VPS QIG ++G+ G  +Q IR ET A I+I         + + + +I IS  
Sbjct: 145 KQVTAKLLVPSDQIGCILGRGGQIVQNIRSETGAQIRIVKDRNMPLCALNSDELIQIS-- 202

Query: 390 DNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSG 569
              G     + AL QI +  L ++ S  + + + +G  PA S+     G +  GL  + G
Sbjct: 203 ---GEVLIVKKALLQIASR-LHENPSRSQNLLSSSGGYPAGSLMSHAGGPRLVGLAPLMG 258



>pir|T04533|T04533 hypothetical protein F28J12.30 - Arabidopsis
           thaliana>gb:ATCHRIV48_1545638 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           48.>gb:ATF28J12_1550309 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F28J12 (ESSAII project).
          Length = 846

 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 51/158 (32%), Positives = 80/158 (50%), Gaps = 17/158 (10%)
 Frame = +3

Query: 204 KKRV---KVSQD--IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEER 368
           K+R+   K+++D  +VYRI+ P   +G VIGK G  I  IR  T+A IK+ D +    +R
Sbjct: 330 KRRISHDKINRDELVVYRILCPIDVVGGVIGKSGKVINAIRHNTKAKIKVFDQLHGCSQR 389

Query: 369 VIII------------SSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPAN 512
           VI I             +K  +   C A+ AL ++   I+  DE N    K         
Sbjct: 390 VITIYCSVKEKQEEIGFTKSENEPLCCAQDALLKVYDAIVASDEEN--NTKTNVDRDDNK 447

Query: 513 SVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTVLAQ 626
             R L+  SQ+  LIG +G+NI+ +R  + A+V V+++
Sbjct: 448 ECRLLVPFSQSSSLIGKAGENIKRIRRRTRASVKVVSK 485



 Score = 42.4 bits (98), Expect = 0.006
 Identities = 42/177 (23%), Positives = 82/177 (46%), Gaps = 28/177 (15%)
 Frame = +3

Query: 171  AGTSAEVVPPLKKRVKV---------SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETR 323
            A T+A  VP     + V         S+++V++++ P   I +VIGK G  I++IRE + 
Sbjct: 591  AETAANPVPVFASSLPVTHGFGGSSRSEELVFKVLCPLCNIMRVIGKGGSTIKRIREASG 650

Query: 324  ATIKIADAISR--HEERVIIISSKDNDGTFC-------------DAESALHQIVTLILK- 455
            + I++ D+ ++   +E VII+++   +  FC             D +S   + V L+ + 
Sbjct: 651  SCIEVNDSRTKCGDDECVIIVTA--TEILFCCLSTPFVFMQSPDDMKSMAVEAVLLLQEY 708

Query: 456  ---DDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
               +D  N++             ++ L++    G +IG SG  I  +R  + A + +
Sbjct: 709  INDEDAENVK-------------MQLLVSSKVIGCVIGKSGSVINEIRKRTNANICI 752



>sp|P58223|Y475_ARATH Putative nucleic acid binding protein
           At4g18375.>gb:AY133701_1581521 Arabidopsis thaliana
           clone C103247 (A) unknown protein (At4g18375) mRNA,
           complete cds.
          Length = 606

 Score = 71.2 bits (173), Expect = 1e-11
 Identities = 51/158 (32%), Positives = 80/158 (50%), Gaps = 17/158 (10%)
 Frame = +3

Query: 204 KKRV---KVSQD--IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEER 368
           K+R+   K+++D  +VYRI+ P   +G VIGK G  I  IR  T+A IK+ D +    +R
Sbjct: 22  KRRISHDKINRDELVVYRILCPIDVVGGVIGKSGKVINAIRHNTKAKIKVFDQLHGCSQR 81

Query: 369 VIII------------SSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPAN 512
           VI I             +K  +   C A+ AL ++   I+  DE N    K         
Sbjct: 82  VITIYCSVKEKQEEIGFTKSENEPLCCAQDALLKVYDAIVASDEEN--NTKTNVDRDDNK 139

Query: 513 SVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTVLAQ 626
             R L+  SQ+  LIG +G+NI+ +R  + A+V V+++
Sbjct: 140 ECRLLVPFSQSSSLIGKAGENIKRIRRRTRASVKVVSK 177



 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 40/161 (24%), Positives = 79/161 (49%), Gaps = 12/161 (7%)
 Frame = +3

Query: 171 AGTSAEVVPPLKKRVKV---------SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETR 323
           A T+A  VP     + V         S+++V++++ P   I +VIGK G  I++IRE + 
Sbjct: 283 AETAANPVPVFASSLPVTHGFGGSSRSEELVFKVLCPLCNIMRVIGKGGSTIKRIREASG 342

Query: 324 ATIKIADAISR--HEERVIIISSKDN-DGTFCDAESALHQIVTLILKDDESNIEAMKAGA 494
           + I++ D+ ++   +E VII+++ ++ D     A  A+  +   I  +D  N++      
Sbjct: 343 SCIEVNDSRTKCGDDECVIIVTATESPDDMKSMAVEAVLLLQEYINDEDAENVK------ 396

Query: 495 GHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
                  ++ L++    G +IG SG  I  +R  + A + +
Sbjct: 397 -------MQLLVSSKVIGCVIGKSGSVINEIRKRTNANICI 430



 Score = 33.1 bits (74), Expect = 3.9
 Identities = 14/47 (29%), Positives = 30/47 (63%)
 Frame = +3

Query: 243 IIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           I++P+  + KV+GK G  ++ IR  + A I+I+ + + H + + ++S
Sbjct: 540 ILIPAHAMSKVMGKGGGNLENIRRISGAMIEISASKTSHGDHIALLS 586



>gb:AC092390_1735383 Oryza sativa chromosome 3 BAC OSJNBb0013K08
           genomic sequence, complete sequence.
          Length = 510

 Score = 70.1 bits (170), Expect = 3e-11
 Identities = 42/130 (32%), Positives = 72/130 (55%), Gaps = 1/130 (0%)
 Frame = +3

Query: 234 VYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDN-DGTFC 410
           V+RI++P++++G +IG+ G  I+K+ EE++A IKI D      ER ++IS+KD  D    
Sbjct: 109 VFRILIPAQKVGAIIGRKGEFIKKMCEESKARIKILDGPPGVPERTVMISAKDEPDAPIS 168

Query: 411 DAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENLR 590
            A   L ++   I    + +    +    +V     R L+  SQAG LIG  G  I++++
Sbjct: 169 PAMDGLFRVYKRITDGSDGDSGQPERNISNV--GPTRLLVPASQAGSLIGKQGATIKSIQ 226

Query: 591 ISSGATVTVL 620
            SS + V ++
Sbjct: 227 DSSKSIVRIV 236



 Score = 35.8 bits (81), Expect = 0.60
 Identities = 15/53 (28%), Positives = 35/53 (66%), Gaps = 3/53 (5%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADA---ISRHEERVIIISSK 389
           R++VP+ Q G +IGK G  I+ I++ +++ ++I +    ++ +++RV+ I  +
Sbjct: 203 RLLVPASQAGSLIGKQGATIKSIQDSSKSIVRIVETLPLVALNDDRVVEIQGE 255



>gb:AC154033_1745263 Solanum demissum chromosome 5 clone PGEC132D05
           map MAP_LOC, complete sequence.
          Length = 581

 Score = 68.2 bits (165), Expect = 1e-10
 Identities = 52/179 (29%), Positives = 89/179 (49%), Gaps = 9/179 (5%)
 Frame = +3

Query: 114 KSTTAKRRRDEDAFEATDEAGTSAEVVPPLKKRVKVS-QDIVYRIIVPSKQIGKVIGKVG 290
           ++   KR + E  +  +D  G+        K+   +  +D V+R + P+ +IG +IG  G
Sbjct: 5   RNNYGKRMQSESDYSRSD--GSKRRTPTDEKESNSIGPEDTVFRYLCPTGKIGSIIGVGG 62

Query: 291 HRIQKIREETRATIKIADAISRHEERVIII--------SSKDNDGTFCDAESALHQIVTL 446
              +++R ET + I+I++ I   EERV+ I         S+D       A+ AL ++   
Sbjct: 63  DIAKQLRTETNSKIRISETIPGCEERVVTIYSGSEETNVSEDTGDLISPAQDALFRVHDR 122

Query: 447 ILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTVLA 623
           +L +D    E ++    H    +VR L+   Q G +IG  GQ I+NLR  +GA + VL+
Sbjct: 123 VLAEDLRMDEDLE---DHQQI-TVRMLVPSDQIGCVIGKGGQVIQNLRSETGAQIRVLS 177



 Score = 59.3 bits (142), Expect = 5e-08
 Identities = 39/141 (27%), Positives = 76/141 (53%)
 Frame = +3

Query: 204 KKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           + R    ++   R++ P++ +G VIGK G  I+++R+E+ A+IK+  A +  ++ +I +S
Sbjct: 263 RSRSSSVKEFAVRLVCPTENVGAVIGKGGGIIKQLRQESGASIKVDSAAAEGDDCIIFVS 322

Query: 384 SKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGV 563
           +K+    F D    +    T+ L+   S     ++G   +   + R L+  S+ G LIG 
Sbjct: 323 AKE---AFEDQSPTID--ATMRLQPRSSEKTEKESGDAIL---TTRLLVPSSRVGCLIGK 374

Query: 564 SGQNIENLRISSGATVTVLAQ 626
            G  I  +R S+ A++ VL++
Sbjct: 375 GGSIINEMRNSTRASIRVLSK 395



>gb:AC151803_1745123 Solanum demissum chromosome 5 BAC PGEC979H09
           genomic sequence, complete sequence.
          Length = 533

 Score = 68.2 bits (165), Expect = 1e-10
 Identities = 52/179 (29%), Positives = 89/179 (49%), Gaps = 9/179 (5%)
 Frame = +3

Query: 114 KSTTAKRRRDEDAFEATDEAGTSAEVVPPLKKRVKVS-QDIVYRIIVPSKQIGKVIGKVG 290
           ++   KR + E  +  +D  G+        K+   +  +D V+R + P+ +IG +IG  G
Sbjct: 5   RNNYGKRMQSESDYSRSD--GSKRRTPTDEKESNSIGPEDTVFRYLCPTGKIGSIIGVGG 62

Query: 291 HRIQKIREETRATIKIADAISRHEERVIII--------SSKDNDGTFCDAESALHQIVTL 446
              +++R ET + I+I++ I   EERV+ I         S+D       A+ AL ++   
Sbjct: 63  DIAKQLRTETNSKIRISETIPGCEERVVTIYSGSEETNVSEDTGDLISPAQDALFRVHDR 122

Query: 447 ILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTVLA 623
           +L +D    E ++    H    +VR L+   Q G +IG  GQ I+NLR  +GA + VL+
Sbjct: 123 VLAEDLRMDEDLE---DHQQI-TVRMLVPSDQIGCVIGKGGQVIQNLRSETGAQIRVLS 177



 Score = 58.9 bits (141), Expect = 7e-08
 Identities = 38/134 (28%), Positives = 74/134 (55%)
 Frame = +3

Query: 225 QDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGT 404
           ++   R++ P++ +G VIGK G  I+++R+E+ A+IK+  A +  ++ +I +S+K+    
Sbjct: 270 KEFAVRLVCPTENVGAVIGKGGGIIKQLRQESGASIKVDSAAAEGDDCIIFVSAKE---A 326

Query: 405 FCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIEN 584
           F D    +    T+ L+   S     ++G   +   + R L+  S+ G LIG  G  I  
Sbjct: 327 FEDQSPTID--ATMRLQPRSSEKTEKESGDAIL---TTRLLVPSSRVGCLIGKGGSIINE 381

Query: 585 LRISSGATVTVLAQ 626
           +R S+ A++ VL++
Sbjct: 382 MRNSTRASIRVLSK 395



>gb:AE016959_1023856 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC084763_1733720
           Oryza sativa chromosome 10 BAC OSJNBa0027P10 genomic
           sequence, complete sequence.>gb:AE017120_1753675 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           74 of 77 of the complete sequence.
          Length = 458

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 45/170 (26%), Positives = 85/170 (50%), Gaps = 1/170 (0%)
 Frame = +3

Query: 117 STTAKRRRDEDAFEATDEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHR 296
           S  A    + +A  A  E    A      K+      D V+R++VP  ++G +IG+ G  
Sbjct: 18  SPPAPAAEEAEAAAAVGEEAVPAAEAAAAKRWPGWPGDSVFRLVVPVLKVGSIIGRKGEL 77

Query: 297 IQKIREETRATIKIADAISRHEERVIIISSKDNDG-TFCDAESALHQIVTLILKDDESNI 473
           I+++ EET+A +++ +      ER++++S K++       A  AL ++   +    +   
Sbjct: 78  IKRLVEETKAKVRVLEGPVGATERIVLVSGKEDPALELPPAMDALMRVFKRVSGITDGAA 137

Query: 474 EAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTVLA 623
           E  +A A      + R L+ G+QA  LIG  G +I+ ++  +GAT+ V++
Sbjct: 138 EGTQA-ATAPGVCAARLLVPGAQAINLIGKQGASIKAIQEGTGATIRVIS 186



 Score = 32.0 bits (71), Expect = 8.7
 Identities = 17/46 (36%), Positives = 25/46 (54%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVII 377
           R++VP  Q   +IGK G  I+ I+E T ATI++     R     +I
Sbjct: 152 RLLVPGAQAINLIGKQGASIKAIQEGTGATIRVISIDERERPFYVI 197



>gb:AF361620_1791366 Arabidopsis thaliana AT5g46190/MCL19_25 gene,
           partial cds.
          Length = 640

 Score = 65.5 bits (158), Expect = 7e-10
 Identities = 50/147 (34%), Positives = 69/147 (46%), Gaps = 15/147 (10%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIII---------- 380
           +VYRI+ PS  +G VIGK G  I  IR+ETRA IK+ D      ERVI I          
Sbjct: 44  VVYRILCPSGVMGSVIGKSGKVINLIRQETRARIKVVDPFPGCSERVITIFCSVSEKKDI 103

Query: 381 -----SSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQA 545
                S  D     C A++AL ++   I+    +  E  K           R L+  SQ 
Sbjct: 104 VDIEYSELDYSVPLCSAQAALLKVHDAIVASLATAAENTKIDRDDF--RECRLLVPSSQC 161

Query: 546 GGLIGVSGQNIENLRISSGATVTVLAQ 626
             +IG SG  I+N+R  + A V V+++
Sbjct: 162 SIVIGKSGSIIKNIRGRTRANVKVVSK 188



 Score = 43.9 bits (102), Expect = 0.002
 Identities = 32/134 (23%), Positives = 66/134 (49%), Gaps = 2/134 (1%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVII--ISSKDN 395
           S+ +  ++I  S +IG+VIGK G  I+ IR+ + + I++ D+ + H++  +I   +++  
Sbjct: 314 SEKLAIKVICSSSKIGRVIGKGGLTIKGIRQASGSHIEVNDSRTNHDDDCVITVTATESP 373

Query: 396 DGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQN 575
           D     A  A+  +   I  +DE  ++             ++ L++    G +IG SG  
Sbjct: 374 DDLKSMAVEAVLLLQEKINDEDEDKVK-------------MQLLVSSKVIGCIIGKSGSI 420

Query: 576 IENLRISSGATVTV 617
           I  +R  + A + +
Sbjct: 421 ISEIRKRTKADIHI 434



>gb:AY085782_1570848 Arabidopsis thaliana clone 18140 mRNA, complete
           sequence.
          Length = 644

 Score = 65.5 bits (158), Expect = 7e-10
 Identities = 50/147 (34%), Positives = 69/147 (46%), Gaps = 15/147 (10%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIII---------- 380
           +VYRI+ PS  +G VIGK G  I  IR+ETRA IK+ D      ERVI I          
Sbjct: 44  VVYRILCPSGVMGSVIGKSGKVINLIRQETRARIKVVDPFPGCSERVITIFCSVSEKKDI 103

Query: 381 -----SSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQA 545
                S  D     C A++AL ++   I+    +  E  K           R L+  SQ 
Sbjct: 104 VDIEYSELDYSVPLCSAQAALLKVHDAIVASLATAAENTKIDRDDF--RECRLLVPSSQC 161

Query: 546 GGLIGVSGQNIENLRISSGATVTVLAQ 626
             +IG SG  I+N+R  + A V V+++
Sbjct: 162 SIVIGKSGSIIKNIRGRTRANVKVVSK 188



 Score = 43.9 bits (102), Expect = 0.002
 Identities = 32/134 (23%), Positives = 66/134 (49%), Gaps = 2/134 (1%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVII--ISSKDN 395
           S+ +  ++I  S +IG+VIGK G  I+ IR+ + + I++ D+ + H++  +I   +++  
Sbjct: 314 SEKLAIKVICASSKIGRVIGKGGLTIKGIRQASGSHIEVNDSRTNHDDDCVITVTATESP 373

Query: 396 DGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQN 575
           D     A  A+  +   I  +DE  ++             ++ L++    G +IG SG  
Sbjct: 374 DDLKSMAVEAVLLLQEKINDEDEDKVK-------------MQLLVSSKVIGCIIGKSGSI 420

Query: 576 IENLRISSGATVTV 617
           I  +R  + A + +
Sbjct: 421 ISEIRKRTKADIHI 434



>gb:AB006698_1509875 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MCL19.>gb:AY039918_1560431 Arabidopsis thaliana
           unknown protein (At5g46190) mRNA, complete
           cds.>gb:AY113859_1578270 Arabidopsis thaliana unknown
           protein (At5g46190) mRNA, complete cds.
          Length = 644

 Score = 65.5 bits (158), Expect = 7e-10
 Identities = 50/147 (34%), Positives = 69/147 (46%), Gaps = 15/147 (10%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIII---------- 380
           +VYRI+ PS  +G VIGK G  I  IR+ETRA IK+ D      ERVI I          
Sbjct: 44  VVYRILCPSGVMGSVIGKSGKVINLIRQETRARIKVVDPFPGCSERVITIFCSVSEKKDI 103

Query: 381 -----SSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQA 545
                S  D     C A++AL ++   I+    +  E  K           R L+  SQ 
Sbjct: 104 VDIEYSELDYSVPLCSAQAALLKVHDAIVASLATAAENTKIDRDDF--RECRLLVPSSQC 161

Query: 546 GGLIGVSGQNIENLRISSGATVTVLAQ 626
             +IG SG  I+N+R  + A V V+++
Sbjct: 162 SIVIGKSGSIIKNIRGRTRANVKVVSK 188



 Score = 43.9 bits (102), Expect = 0.002
 Identities = 32/134 (23%), Positives = 66/134 (49%), Gaps = 2/134 (1%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVII--ISSKDN 395
           S+ +  ++I  S +IG+VIGK G  I+ IR+ + + I++ D+ + H++  +I   +++  
Sbjct: 314 SEKLAIKVICSSSKIGRVIGKGGLTIKGIRQASGSHIEVNDSRTNHDDDCVITVTATESP 373

Query: 396 DGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQN 575
           D     A  A+  +   I  +DE  ++             ++ L++    G +IG SG  
Sbjct: 374 DDLKSMAVEAVLLLQEKINDEDEDKVK-------------MQLLVSSKVIGCIIGKSGSI 420

Query: 576 IENLRISSGATVTV 617
           I  +R  + A + +
Sbjct: 421 ISEIRKRTKADIHI 434



>pir|D96554|D96554 hypothetical protein F19C24.19 [imported] -
           Arabidopsis thaliana>gb:AE005173_893072 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC024261_1539313 Arabidopsis thaliana
           chromosome 1 BAC F5D21 genomic sequence, complete
           sequence.>gb:AC025294_1539405 Arabidopsis thaliana
           chromosome 1 BAC F19C24 genomic sequence, complete
           sequence.>gb:BT008776_1639972 Arabidopsis thaliana
           At1g51580 mRNA, complete cds.
          Length = 621

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 42/149 (28%), Positives = 79/149 (53%), Gaps = 2/149 (1%)
 Frame = +3

Query: 186 EVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEE 365
           E V P  + V V +++ +R++ P+ ++G +IGK G  ++ ++ E+ A+IK++D     EE
Sbjct: 262 EDVGPFNRPV-VEEEVAFRLLCPADKVGSLIGKGGAVVRALQNESGASIKVSDPTHDSEE 320

Query: 366 RVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSV--RFLIAGS 539
           R+I+IS+++N     +   +L Q       D    +       G  P+ +V  R L+   
Sbjct: 321 RIIVISAREN----LERRHSLAQ-------DGVMRVHNRIVEIGFEPSAAVVARLLVHSP 369

Query: 540 QAGGLIGVSGQNIENLRISSGATVTVLAQ 626
             G L+G  G  I  +R ++GA++ V A+
Sbjct: 370 YIGRLLGKGGHLISEMRRATGASIRVFAK 398



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 36/169 (21%), Positives = 71/169 (42%), Gaps = 37/169 (21%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAIS-RHEERVIII----SS 386
           ++ + +R++ P+ + G +IGK G  I+ ++  T + I++ D I    EERV++I      
Sbjct: 16  AESVHFRLLCPATRTGAIIGKGGSVIRHLQSVTGSKIRVIDDIPVPSEERVVLIIAPSGK 75

Query: 387 KDNDGTFCDAESA--------------------------------LHQIVTLILKDDESN 470
           K ++   CD+E+                                 L     ++  DD + 
Sbjct: 76  KKDESNVCDSENPGSEEPKQEKGSECAGTSGGDDEEAPSSAQMALLRVFERIVFGDDAAT 135

Query: 471 IEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
           ++  +   G       R ++ G+Q   L+   G+ I+ +R  SGA V +
Sbjct: 136 VDGDELDKGE-SEGLCRMIVRGNQVDYLMSKGGKMIQKIREDSGAIVRI 183



>gb:AE014296_1137452 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003596_1217151 Drosophila melanogaster
           chromosome 3L, section 77 of 83 of the complete
           sequence.>gb:AY060403_1292315 Drosophila melanogaster
           LD32520 full length cDNA.
          Length = 364

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 45/158 (28%), Positives = 75/158 (47%), Gaps = 4/158 (2%)
 Frame = +3

Query: 165 DEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIAD 344
           ++  TS+       K    S  +  R+I+  K++G +IGK G  + + REE+ A I I+D
Sbjct: 2   EDNNTSSSAGGASIKHEDPSVTLTIRLIMQGKEVGSIIGKKGEIVNRFREESGAKINISD 61

Query: 345 AISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNI----EAMKAGAGHVPAN 512
                 ER++ +S   N         A+    TLI K  E       +  K G   +P  
Sbjct: 62  GSC--PERIVTVSGTTN---------AIFSAFTLITKKFEEWCSQFNDVGKVGKTQIP-- 108

Query: 513 SVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTVLAQ 626
            +R ++  SQ G LIG SG  I+ +R ++G ++ V ++
Sbjct: 109 -IRLIVPASQCGSLIGKSGSKIKEIRQTTGCSIQVASE 145



 Score = 43.1 bits (100), Expect = 0.004
 Identities = 25/76 (32%), Positives = 44/76 (57%), Gaps = 1/76 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIISSKDNDGTF 407
           I  R+IVP+ Q G +IGK G +I++IR+ T  +I++A + +    ER + +S      T 
Sbjct: 107 IPIRLIVPASQCGSLIGKSGSKIKEIRQTTGCSIQVASEMLPNSTERAVTLSGSAEQITQ 166

Query: 408 CDAESALHQIVTLILK 455
           C     ++QI  ++L+
Sbjct: 167 C-----IYQICLVMLE 177



>gb:AE014296_1137450 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE014296_1137451 Drosophila melanogaster
           chromosome 3L, complete sequence.>gb:AE003596_1217149
           Drosophila melanogaster chromosome 3L, section 77 of 83
           of the complete sequence.>gb:AE003596_1217150 Drosophila
           melanogaster chromosome 3L, section 77 of 83 of the
           complete sequence.>gb:DMMUB_1379803 D.melanogaster
           genomic and mRNA for nucleic acid binding protein.
          Length = 386

 Score = 63.9 bits (154), Expect = 2e-09
 Identities = 45/158 (28%), Positives = 75/158 (47%), Gaps = 4/158 (2%)
 Frame = +3

Query: 165 DEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIAD 344
           ++  TS+       K    S  +  R+I+  K++G +IGK G  + + REE+ A I I+D
Sbjct: 2   EDNNTSSSAGGASIKHEDPSVTLTIRLIMQGKEVGSIIGKKGEIVNRFREESGAKINISD 61

Query: 345 AISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNI----EAMKAGAGHVPAN 512
                 ER++ +S   N         A+    TLI K  E       +  K G   +P  
Sbjct: 62  GSC--PERIVTVSGTTN---------AIFSAFTLITKKFEEWCSQFNDVGKVGKTQIP-- 108

Query: 513 SVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTVLAQ 626
            +R ++  SQ G LIG SG  I+ +R ++G ++ V ++
Sbjct: 109 -IRLIVPASQCGSLIGKSGSKIKEIRQTTGCSIQVASE 145



 Score = 43.1 bits (100), Expect = 0.004
 Identities = 25/76 (32%), Positives = 44/76 (57%), Gaps = 1/76 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIISSKDNDGTF 407
           I  R+IVP+ Q G +IGK G +I++IR+ T  +I++A + +    ER + +S      T 
Sbjct: 107 IPIRLIVPASQCGSLIGKSGSKIKEIRQTTGCSIQVASEMLPNSTERAVTLSGSAEQITQ 166

Query: 408 CDAESALHQIVTLILK 455
           C     ++QI  ++L+
Sbjct: 167 C-----IYQICLVMLE 177



>sp|P57723|PCB4_HUMAN Poly(rC)-binding protein 4
           (Alpha-CP4).>gb:AX881075_1478538 Sequence 15980 from
           Patent EP1074617.>gb:AF176330_1888015 Homo sapiens
           alphaCP-4 (PCBP4) mRNA, complete
           cds.>gb:AK023993_1909828 Homo sapiens cDNA FLJ13931 fis,
           clone Y79AA1000752, moderately similar to PUTATIVE
           HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN
           X.>gb:BC003008_1968605 Homo sapiens poly(rC) binding
           protein 4, transcript variant 3, mRNA (cDNA clone
           MGC:4008 IMAGE:2822683), complete
           cds.>gb:BC004153_1969030 Homo sapiens poly(rC) binding
           protein 4, transcript variant 3, mRNA (cDNA clone
           MGC:2386 IMAGE:2822683), complete cds.
          Length = 403

 Score = 62.8 bits (151), Expect = 5e-09
 Identities = 40/141 (28%), Positives = 76/141 (53%), Gaps = 2/141 (1%)
 Frame = +3

Query: 201 LKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIII 380
           L++  ++S  +  R+++  K++G +IGK G  +++IRE++ A I I++            
Sbjct: 8   LEEEPELSITLTLRMLMHGKEVGSIIGKKGETVKRIREQSSARITISEG----------- 56

Query: 381 SSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHV--PANSVRFLIAGSQAGGL 554
           S  +   T   + +A+   V++I    + ++ A  A  G+V  P  ++R +I  SQ G L
Sbjct: 57  SCPERITTITGSTAAVFHAVSMIAFKLDEDLCAAPANGGNVSRPPVTLRLVIPASQCGSL 116

Query: 555 IGVSGQNIENLRISSGATVTV 617
           IG +G  I+ +R ++GA V V
Sbjct: 117 IGKAGTKIKEIRETTGAQVQV 137



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIISSKDNDGTF 407
           +  R+++P+ Q G +IGK G +I++IRE T A +++A D +    ER + +S   +    
Sbjct: 102 VTLRLVIPASQCGSLIGKAGTKIKEIRETTGAQVQVAGDLLPNSTERAVTVSGVPDAIIL 161

Query: 408 CDAESALHQIVTLILK 455
           C     + QI  +IL+
Sbjct: 162 C-----VRQICAVILE 172



 Score = 34.7 bits (78), Expect = 1.3
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = +3

Query: 189 VVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEER 368
           VVP L    + S       +VP+  IG VIG+ G +I +IR+ + A IKI +      ER
Sbjct: 231 VVPGLDPGTQTSSQ---EFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGAGER 287

Query: 369 VIIIS 383
            + I+
Sbjct: 288 HVTIT 292



>gb:AF092441_1882633 Homo sapiens CBP mRNA, complete cds.
          Length = 397

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 42/141 (29%), Positives = 76/141 (53%), Gaps = 2/141 (1%)
 Frame = +3

Query: 201 LKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIII 380
           L++  ++S  +  R+++  K++G +IGK G  +++IRE++ A I I++      ER+  I
Sbjct: 8   LEEEPELSITLTLRMLMHGKEVGSIIGKKGETVKRIREQSSARITISE--GSFLERITTI 65

Query: 381 SSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHV--PANSVRFLIAGSQAGGL 554
           +            +  H +  +  K DE ++ A  A  G+V  P  ++R +I  SQ G L
Sbjct: 66  TG--------STAAVFHAVSMIAFKLDE-DLCAAPANGGNVSRPPVTLRLVIPASQCGSL 116

Query: 555 IGVSGQNIENLRISSGATVTV 617
           IG +G  I+ +R ++GA V V
Sbjct: 117 IGQAGTKIKEIRETTGAQVQV 137



 Score = 42.7 bits (99), Expect = 0.005
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 1/76 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIISSKDNDGTF 407
           +  R+++P+ Q G +IG+ G +I++IRE T A +++A D      ER + +S   +    
Sbjct: 102 VTLRLVIPASQCGSLIGQAGTKIKEIRETTGAQVQVAGDLFPNSTERAVTVSGVPDAIIL 161

Query: 408 CDAESALHQIVTLILK 455
           C     + QI  +IL+
Sbjct: 162 C-----VRQICAVILE 172



 Score = 34.7 bits (78), Expect = 1.3
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = +3

Query: 189 VVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEER 368
           VVP L    + S       +VP+  IG VIG+ G +I +IR+ + A IKI +      ER
Sbjct: 231 VVPGLDPGTQTSSQ---EFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGAGER 287

Query: 369 VIIIS 383
            + I+
Sbjct: 288 HVTIT 292



>gb:XLA243591_2582458 Xenopus laevis mRNA for hnRNP-E2 protein.
          Length = 353

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 39/131 (29%), Positives = 70/131 (53%), Gaps = 2/131 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER+I ++   N     
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISE--GNCPERIITLAGPTN----- 66

Query: 411 DAESALHQIVTLILKDDESNIEA--MKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIEN 584
               A+ +  ++I+   E +I +    + A   P  ++R ++  SQ G LIG  G  I+ 
Sbjct: 67  ----AIFKAFSMIIDKLEEDISSSMTNSTASSKPPVTLRLVVPASQCGSLIGKGGCKIKE 122

Query: 585 LRISSGATVTV 617
           +R S+GA V V
Sbjct: 123 IRESTGAQVQV 133



 Score = 42.7 bits (99), Expect = 0.005
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIIS 383
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER I I+
Sbjct: 98  VTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIA 149



 Score = 37.0 bits (84), Expect = 0.27
 Identities = 17/54 (31%), Positives = 33/54 (61%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           +Q   + + +P+  IG +IG+ G +I +IR+ + A IKIA+ +    +R + I+
Sbjct: 273 AQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSNDRQVTIT 326



>gb:BC084195_2563585 Xenopus laevis hnRNP-E2 protein, mRNA (cDNA
           clone MGC:79904 IMAGE:5073503), complete cds.
          Length = 353

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 39/131 (29%), Positives = 70/131 (53%), Gaps = 2/131 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER+I ++   N     
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISE--GNCPERIITLAGPTN----- 66

Query: 411 DAESALHQIVTLILKDDESNIEA--MKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIEN 584
               A+ +  ++I+   E +I +    + A   P  ++R ++  SQ G LIG  G  I+ 
Sbjct: 67  ----AIFKAFSMIIDKLEEDISSSMTNSTASSKPPVTLRLVVPASQCGSLIGKGGCKIKE 122

Query: 585 LRISSGATVTV 617
           +R S+GA V V
Sbjct: 123 IRESTGAQVQV 133



 Score = 42.7 bits (99), Expect = 0.005
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIIS 383
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER I I+
Sbjct: 98  VTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIA 149



 Score = 37.0 bits (84), Expect = 0.27
 Identities = 17/54 (31%), Positives = 33/54 (61%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           +Q   + + +P+  IG +IG+ G +I +IR+ + A IKIA+ +    +R + I+
Sbjct: 273 AQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSNDRQVTIT 326



>gb:BC074565_2558060 Xenopus tropicalis poly(rC) binding protein 2,
           mRNA (cDNA clone MGC:69512 IMAGE:5336447), complete cds.
          Length = 353

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 39/131 (29%), Positives = 70/131 (53%), Gaps = 2/131 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER+I ++   N     
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISE--GNCPERIITLAGPTN----- 66

Query: 411 DAESALHQIVTLILKDDESNIEA--MKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIEN 584
               A+ +  ++I+   E +I +    + A   P  ++R ++  SQ G LIG  G  I+ 
Sbjct: 67  ----AIFKAFSMIIDKLEEDISSSMTNSTASSKPPVTLRLVVPASQCGSLIGKGGCKIKE 122

Query: 585 LRISSGATVTV 617
           +R S+GA V V
Sbjct: 123 IRESTGAQVQV 133



 Score = 42.7 bits (99), Expect = 0.005
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIIS 383
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER I I+
Sbjct: 98  VTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIA 149



 Score = 37.0 bits (84), Expect = 0.27
 Identities = 17/54 (31%), Positives = 33/54 (61%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           +Q   + + +P+  IG +IG+ G +I +IR+ + A IKIA+ +    +R + I+
Sbjct: 273 AQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSNDRQVTIT 326



>gb:BC041241_2547876 Xenopus laevis poly(rC) binding protein 2, mRNA
           (cDNA clone MGC:52770 IMAGE:4684187), complete cds.
          Length = 353

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 39/131 (29%), Positives = 70/131 (53%), Gaps = 2/131 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER+I ++   N     
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISE--GNCPERIITLAGPTN----- 66

Query: 411 DAESALHQIVTLILKDDESNIEA--MKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIEN 584
               A+ +  ++I+   E +I +    + A   P  ++R ++  SQ G LIG  G  I+ 
Sbjct: 67  ----AIFKAFSMIIDKLEEDISSSMTNSTASSKPPVTLRLVVPASQCGSLIGKGGCKIKE 122

Query: 585 LRISSGATVTV 617
           +R S+GA V V
Sbjct: 123 IRESTGAQVQV 133



 Score = 42.7 bits (99), Expect = 0.005
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIIS 383
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER I I+
Sbjct: 98  VTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIA 149



 Score = 36.6 bits (83), Expect = 0.35
 Identities = 17/54 (31%), Positives = 33/54 (61%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           +Q   + + +P+  IG +IG+ G +I +IR+ + A IKIA+ +    +R + I+
Sbjct: 273 AQATSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSNDRQVTIT 326



>gb:BC010694_2091058 Mus musculus poly(rC) binding protein 4, mRNA
           (cDNA clone MGC:6891 IMAGE:2654291), complete cds.
          Length = 403

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 40/141 (28%), Positives = 75/141 (53%), Gaps = 2/141 (1%)
 Frame = +3

Query: 201 LKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIII 380
           L++  ++S  +  R+++  K++G +IGK G  +++IRE++ A I I++            
Sbjct: 8   LEEGPELSITLTLRMLMHGKEVGSIIGKKGETVKRIREQSSARITISEG----------- 56

Query: 381 SSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHV--PANSVRFLIAGSQAGGL 554
           S  +   T   + +A+   V++I    + ++ A  A  G V  P  ++R +I  SQ G L
Sbjct: 57  SCPERITTITGSTAAVFHAVSMIAFKLDEDLCAAPANGGSVSRPPVTLRLVIPASQCGSL 116

Query: 555 IGVSGQNIENLRISSGATVTV 617
           IG +G  I+ +R ++GA V V
Sbjct: 117 IGKAGTKIKEIRETTGAQVQV 137



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIISSKDNDGTF 407
           +  R+++P+ Q G +IGK G +I++IRE T A +++A D +    ER + +S   +    
Sbjct: 102 VTLRLVIPASQCGSLIGKAGTKIKEIRETTGAQVQVAGDLLPNSTERAVTVSGVPDAIIL 161

Query: 408 CDAESALHQIVTLILK 455
           C     + QI  +IL+
Sbjct: 162 C-----VRQICAVILE 172



 Score = 36.2 bits (82), Expect = 0.46
 Identities = 24/68 (35%), Positives = 35/68 (51%)
 Frame = +3

Query: 180 SAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRH 359
           S  VVP L    + S       +VP+  IG VIG+ G +I +IR+ + A IKI +     
Sbjct: 228 SPSVVPGLDPSTQTSSQ---EFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGA 284

Query: 360 EERVIIIS 383
            ER + I+
Sbjct: 285 GERHVTIT 292



>gb:AK077632_1171966 Mus musculus 8 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:5730488K16
           product:poly(rC) binding protein 4, full insert
           sequence.
          Length = 403

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 40/141 (28%), Positives = 75/141 (53%), Gaps = 2/141 (1%)
 Frame = +3

Query: 201 LKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIII 380
           L++  ++S  +  R+++  K++G +IGK G  +++IRE++ A I I++            
Sbjct: 8   LEEGPELSITLTLRMLMHGKEVGSIIGKKGETVKRIREQSSARITISEG----------- 56

Query: 381 SSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHV--PANSVRFLIAGSQAGGL 554
           S  +   T   + +A+   V++I    + ++ A  A  G V  P  ++R +I  SQ G L
Sbjct: 57  SCPERITTITGSTAAVFHAVSMIAFKLDEDLCAAPANGGSVSRPPVTLRLVIPASQCGSL 116

Query: 555 IGVSGQNIENLRISSGATVTV 617
           IG +G  I+ +R ++GA V V
Sbjct: 117 IGKAGTKIKEIRETTGAQVQV 137



 Score = 44.7 bits (104), Expect = 0.001
 Identities = 24/75 (32%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIISSKDNDGTF 407
           +  R+++P+ Q G +IGK G +I++IRE T A +++A D +    ER + +S   +    
Sbjct: 102 VTLRLVIPASQCGSLIGKAGTKIKEIRETTGAQVQVAGDLLPNSTERAVTVSGVPDAIIL 161

Query: 408 CDAESALHQIVTLIL 452
           C     + QI  +IL
Sbjct: 162 C-----VRQICAVIL 171



 Score = 36.2 bits (82), Expect = 0.46
 Identities = 24/68 (35%), Positives = 35/68 (51%)
 Frame = +3

Query: 180 SAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRH 359
           S  VVP L    + S       +VP+  IG VIG+ G +I +IR+ + A IKI +     
Sbjct: 228 SPSVVPGLDPSTQTSSQ---EFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGA 284

Query: 360 EERVIIIS 383
            ER + I+
Sbjct: 285 GERHVTIT 292



>gb:AK005383_1152981 Mus musculus adult male cerebellum cDNA, RIKEN
           full-length enriched library, clone:1500041G07
           product:poly(rC) binding protein 4, full insert
           sequence.
          Length = 403

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 40/141 (28%), Positives = 75/141 (53%), Gaps = 2/141 (1%)
 Frame = +3

Query: 201 LKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIII 380
           L++  ++S  +  R+++  K++G +IGK G  +++IRE++ A I I++            
Sbjct: 8   LEEGPELSITLTLRMLMHGKEVGSIIGKKGETVKRIREQSSARITISEG----------- 56

Query: 381 SSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHV--PANSVRFLIAGSQAGGL 554
           S  +   T   + +A+   V++I    + ++ A  A  G V  P  ++R +I  SQ G L
Sbjct: 57  SCPERITTITGSTAAVFHAVSMIAFKLDEDLCAAPANGGSVSRPPVTLRLVIPASQCGSL 116

Query: 555 IGVSGQNIENLRISSGATVTV 617
           IG +G  I+ +R ++GA V V
Sbjct: 117 IGKAGTKIKEIRETTGAQVQV 137



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIISSKDNDGTF 407
           +  R+++P+ Q G +IGK G +I++IRE T A +++A D +    ER + +S   +    
Sbjct: 102 VTLRLVIPASQCGSLIGKAGTKIKEIRETTGAQVQVAGDLLPNSTERAVTVSGVPDAIIL 161

Query: 408 CDAESALHQIVTLILK 455
           C     + QI  +IL+
Sbjct: 162 C-----VRQICAVILE 172



 Score = 36.2 bits (82), Expect = 0.46
 Identities = 24/68 (35%), Positives = 35/68 (51%)
 Frame = +3

Query: 180 SAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRH 359
           S  VVP L    + S       +VP+  IG VIG+ G +I +IR+ + A IKI +     
Sbjct: 228 SPSVVPGLDPSTQTSSQ---EFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGA 284

Query: 360 EERVIIIS 383
            ER + I+
Sbjct: 285 GERHVTIT 292



>sp|P57724|PCB4_MOUSE Poly(rC)-binding protein 4
           (Alpha-CP4).>gb:AF176328_2057828 Mus musculus alphaCP-4
           (Pcbp4) mRNA, complete cds.
          Length = 403

 Score = 61.2 bits (147), Expect = 1e-08
 Identities = 40/141 (28%), Positives = 75/141 (53%), Gaps = 2/141 (1%)
 Frame = +3

Query: 201 LKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIII 380
           L++  ++S  +  R+++  K++G +IGK G  +++IRE++ A I I++            
Sbjct: 8   LEEGPELSITLTLRMLMHGKEVGSIIGKKGETVKRIREQSSARITISEG----------- 56

Query: 381 SSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHV--PANSVRFLIAGSQAGGL 554
           S  +   T   + +A+   V++I    + ++ A  A  G V  P  ++R +I  SQ G L
Sbjct: 57  SCPERITTITGSTAAVFHAVSMIAFKLDEDLCAAPANGGSVSRPPVTLRLVIPASQCGSL 116

Query: 555 IGVSGQNIENLRISSGATVTV 617
           IG +G  I+ +R ++GA V V
Sbjct: 117 IGKAGTKIKEIRETTGAQVQV 137



 Score = 45.1 bits (105), Expect = 0.001
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIISSKDNDGTF 407
           +  R+++P+ Q G +IGK G +I++IRE T A +++A D +    ER + +S   +    
Sbjct: 102 VTLRLVIPASQCGSLIGKAGTKIKEIRETTGAQVQVAGDLLPNSTERAVTVSGVPDAIIL 161

Query: 408 CDAESALHQIVTLILK 455
           C     + QI  +IL+
Sbjct: 162 C-----VRQICAVILE 172



 Score = 35.4 bits (80), Expect = 0.79
 Identities = 23/68 (33%), Positives = 35/68 (51%)
 Frame = +3

Query: 180 SAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRH 359
           S  VVP +    + S       +VP+  IG VIG+ G +I +IR+ + A IKI +     
Sbjct: 228 SPSVVPGMDPSTQTSSQ---EFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGA 284

Query: 360 EERVIIIS 383
            ER + I+
Sbjct: 285 GERHVTIT 292



>gb:BC083972_2563385 Xenopus laevis hypothetical LOC494905, mRNA
           (cDNA clone MGC:98031 IMAGE:7198952), complete cds.
          Length = 318

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 39/131 (29%), Positives = 69/131 (52%), Gaps = 2/131 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER+I ++   N     
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISE--GNCPERIITLAGPTN----- 66

Query: 411 DAESALHQIVTLILKDDESNIEA--MKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIEN 584
               A+ +   +I+   E +I +    + A   P  ++R ++  SQ G LIG  G  I+ 
Sbjct: 67  ----AIFKAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKE 122

Query: 585 LRISSGATVTV 617
           +R S+GA V V
Sbjct: 123 IRESTGAQVQV 133



 Score = 42.7 bits (99), Expect = 0.005
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIIS 383
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER I I+
Sbjct: 98  VTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIA 149



 Score = 36.6 bits (83), Expect = 0.35
 Identities = 17/54 (31%), Positives = 33/54 (61%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           +Q   + + +P+  IG +IG+ G +I +IR+ + A IKIA+ +    +R + I+
Sbjct: 238 AQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTIT 291



>gb:AY398394_2531924 Danio rerio clone RK075A2E10 poly(rC) binding
           protein 2 (PCBP2) mRNA, complete
           cds.>gb:BC045508_2549344 Danio rerio poly(rC) binding
           protein 2, mRNA (cDNA clone MGC:55964 IMAGE:3819411),
           complete cds.>gb:BC066603_2554470 Danio rerio poly(rC)
           binding protein 2, mRNA (cDNA clone MGC:77206
           IMAGE:6962205), complete cds.
          Length = 318

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 39/131 (29%), Positives = 70/131 (53%), Gaps = 2/131 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER+I         T  
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISE--GNCPERII---------TLA 62

Query: 411 DAESALHQIVTLILKDDESNIEAMKAG--AGHVPANSVRFLIAGSQAGGLIGVSGQNIEN 584
              +A+ +  ++I++  E +I +  +   A   P  ++R ++  SQ G LIG  G  I+ 
Sbjct: 63  GPTTAIFKAFSMIIEKLEEDISSSMSNSTATSKPPVTLRIVVPASQCGSLIGKGGCKIKE 122

Query: 585 LRISSGATVTV 617
           +R S+GA V V
Sbjct: 123 IRESTGAQVQV 133



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 27/82 (32%), Positives = 44/82 (53%), Gaps = 1/82 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIISSKDNDGTF 407
           +  RI+VP+ Q G +IGK G +I++IRE T A +++A D +    ER I I+     GT 
Sbjct: 98  VTLRIVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIA-----GTP 152

Query: 408 CDAESALHQIVTLILKDDESNI 473
                 + QI  ++L+     +
Sbjct: 153 LSIIECVKQICVVMLESPPKGV 174



 Score = 36.2 bits (82), Expect = 0.46
 Identities = 16/49 (32%), Positives = 31/49 (63%)
 Frame = +3

Query: 237 YRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           + + +P+  IG +IG+ G +I +IR+ + A IKIA+ +    +R + I+
Sbjct: 243 HELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSSDRQVTIT 291



>gb:MMPCBPSVE_2116898 M.musculus mRNA for poly(C)-binding protein,
           splice variant E.
          Length = 349

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 39/131 (29%), Positives = 69/131 (52%), Gaps = 2/131 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER+I ++   N     
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISE--GNCPERIITLAGPTN----- 66

Query: 411 DAESALHQIVTLILKDDESNIEA--MKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIEN 584
               A+ +   +I+   E +I +    + A   P  ++R ++  SQ G LIG  G  I+ 
Sbjct: 67  ----AIFKAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKE 122

Query: 585 LRISSGATVTV 617
           +R S+GA V V
Sbjct: 123 IRESTGAQVQV 133



 Score = 42.7 bits (99), Expect = 0.005
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIIS 383
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER I I+
Sbjct: 98  VTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIA 149



>gb:MMCBPRNA_2114434 M.musculus mCBP mRNA.
          Length = 331

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 39/131 (29%), Positives = 69/131 (52%), Gaps = 2/131 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER+I ++   N     
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISE--GNCPERIITLAGPTN----- 66

Query: 411 DAESALHQIVTLILKDDESNIEA--MKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIEN 584
               A+ +   +I+   E +I +    + A   P  ++R ++  SQ G LIG  G  I+ 
Sbjct: 67  ----AIFKAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKE 122

Query: 585 LRISSGATVTV 617
           +R S+GA V V
Sbjct: 123 IRESTGAQVQV 133



 Score = 42.7 bits (99), Expect = 0.005
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIIS 383
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER I I+
Sbjct: 98  VTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIA 149



>gb:BC071942_1988896 Homo sapiens poly(rC) binding protein 2,
           transcript variant 1, mRNA (cDNA clone MGC:88629
           IMAGE:6424433), complete cds.
          Length = 366

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 39/131 (29%), Positives = 69/131 (52%), Gaps = 2/131 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER+I ++   N     
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISE--GNCPERIITLAGPTN----- 66

Query: 411 DAESALHQIVTLILKDDESNIEA--MKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIEN 584
               A+ +   +I+   E +I +    + A   P  ++R ++  SQ G LIG  G  I+ 
Sbjct: 67  ----AIFKAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKE 122

Query: 585 LRISSGATVTV 617
           +R S+GA V V
Sbjct: 123 IRESTGAQVQV 133



 Score = 42.7 bits (99), Expect = 0.005
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIIS 383
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER I I+
Sbjct: 98  VTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIA 149



 Score = 36.6 bits (83), Expect = 0.35
 Identities = 17/54 (31%), Positives = 33/54 (61%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           +Q   + + +P+  IG +IG+ G +I +IR+ + A IKIA+ +    +R + I+
Sbjct: 286 AQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTIT 339



>gb:AB188306_1874309 Homo sapiens PCBP2 mRNA for poly(rC) binding
           protein 2, complete cds.
          Length = 331

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 39/131 (29%), Positives = 69/131 (52%), Gaps = 2/131 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER+I ++   N     
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISE--GNCPERIITLAGPTN----- 66

Query: 411 DAESALHQIVTLILKDDESNIEA--MKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIEN 584
               A+ +   +I+   E +I +    + A   P  ++R ++  SQ G LIG  G  I+ 
Sbjct: 67  ----AIFKAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKE 122

Query: 585 LRISSGATVTV 617
           +R S+GA V V
Sbjct: 123 IRESTGAQVQV 133



 Score = 42.7 bits (99), Expect = 0.005
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIIS 383
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER I I+
Sbjct: 98  VTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIA 149



 Score = 36.6 bits (83), Expect = 0.35
 Identities = 17/54 (31%), Positives = 33/54 (61%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           +Q   + + +P+  IG +IG+ G +I +IR+ + A IKIA+ +    +R + I+
Sbjct: 251 AQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTIT 304



>gb:AX711240_1473664 Sequence 7 from Patent WO03016343.
          Length = 322

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 39/131 (29%), Positives = 69/131 (52%), Gaps = 2/131 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER+I ++   N     
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISE--GNCPERIITLAGPTN----- 66

Query: 411 DAESALHQIVTLILKDDESNIEA--MKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIEN 584
               A+ +   +I+   E +I +    + A   P  ++R ++  SQ G LIG  G  I+ 
Sbjct: 67  ----AIFKAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKE 122

Query: 585 LRISSGATVTV 617
           +R S+GA V V
Sbjct: 123 IRESTGAQVQV 133



 Score = 42.7 bits (99), Expect = 0.005
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIIS 383
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER I I+
Sbjct: 98  VTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIA 149



 Score = 36.6 bits (83), Expect = 0.35
 Identities = 17/54 (31%), Positives = 33/54 (61%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           +Q   + + +P+  IG +IG+ G +I +IR+ + A IKIA+ +    +R + I+
Sbjct: 242 AQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTIT 295



>gb:AX711238_1473663 Sequence 5 from Patent WO03016343.
          Length = 349

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 39/131 (29%), Positives = 69/131 (52%), Gaps = 2/131 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER+I ++   N     
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISE--GNCPERIITLAGPTN----- 66

Query: 411 DAESALHQIVTLILKDDESNIEA--MKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIEN 584
               A+ +   +I+   E +I +    + A   P  ++R ++  SQ G LIG  G  I+ 
Sbjct: 67  ----AIFKAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKE 122

Query: 585 LRISSGATVTV 617
           +R S+GA V V
Sbjct: 123 IRESTGAQVQV 133



 Score = 42.7 bits (99), Expect = 0.005
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIIS 383
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER I I+
Sbjct: 98  VTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIA 149



 Score = 36.6 bits (83), Expect = 0.35
 Identities = 17/54 (31%), Positives = 33/54 (61%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           +Q   + + +P+  IG +IG+ G +I +IR+ + A IKIA+ +    +R + I+
Sbjct: 269 AQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTIT 322



>gb:AF275629_1257877 Drosophila melanogaster bancal protein mRNA,
           complete cds.
          Length = 508

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 51/132 (38%), Positives = 70/132 (53%)
 Frame = +3

Query: 195 PPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVI 374
           P  +KR + S++ V RI++PS   G VIGK G  IQK+R + +AT+ + D  S+  ER I
Sbjct: 12  PQDQKRNRRSEETV-RILIPSSIAGAVIGKGGQHIQKMRTQYKATVSVDD--SQGPERTI 68

Query: 375 IISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGL 554
            IS+        D ES L +I+T +LK  E   E             VR LI  S AG +
Sbjct: 69  QISA--------DIESTL-EIITEMLKYFEERDEDF----------DVRLLIHQSLAGCV 109

Query: 555 IGVSGQNIENLR 590
           IG  GQ I+ +R
Sbjct: 110 IGKGGQKIKEIR 121



 Score = 39.3 bits (90), Expect = 0.055
 Identities = 18/48 (37%), Positives = 30/48 (62%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           ++ +P +  G +IGK G RI++IR E+ A I I + +    +R+I IS
Sbjct: 424 QVTIPKELAGAIIGKGGGRIRRIRNESSAYITIDEPLPNSNDRIITIS 471



 Score = 33.5 bits (75), Expect = 3.0
 Identities = 17/35 (48%), Positives = 23/35 (65%)
 Frame = +3

Query: 513 SVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
           +VR LI  S AG +IG  GQ+I+ +R    ATV+V
Sbjct: 24  TVRILIPSSIAGAVIGKGGQHIQKMRTQYKATVSV 58



 Score = 32.7 bits (73), Expect = 5.1
 Identities = 16/41 (39%), Positives = 21/41 (51%)
 Frame = +3

Query: 495 GHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
           GH P NS +  I    AG +IG  G  I  +R  S A +T+
Sbjct: 416 GHDPNNSTQVTIPKELAGAIIGKGGGRIRRIRNESSAYITI 456



>sp|Q61990|PCB2_MOUSE Poly(rC)-binding protein 2 (Alpha-CP2)
           (Putative heterogeneous nuclear ribonucleoprotein X)
           (hnRNP X) (CTBP) (CBP).>pir|S78515|S78515
           single-stranded nucleic acid-binding protein CBP -
           mouse>gb:BC001155_1967339 Homo sapiens poly(rC) binding
           protein 2, transcript variant 2, mRNA (cDNA clone
           MGC:1457 IMAGE:3356341), complete
           cds.>gb:AF236842S4_2060190 Mus musculus alpha-CP2
           (Pcbp2) gene, exon 13 and complete
           cds.>gb:BC078909_2107060 Rattus norvegicus cDNA clone
           MGC:93668 IMAGE:7127139, complete
           cds.>gb:MUSNUABPRO_2129441 Mus musculus (clones pB1001,
           pB1002, pB1003, pB1004, pB1005) nucleic acid binding
           protein (hnRNP X) mRNA, complete cds.
          Length = 362

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 39/131 (29%), Positives = 69/131 (52%), Gaps = 2/131 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER+I ++   N     
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISE--GNCPERIITLAGPTN----- 66

Query: 411 DAESALHQIVTLILKDDESNIEA--MKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIEN 584
               A+ +   +I+   E +I +    + A   P  ++R ++  SQ G LIG  G  I+ 
Sbjct: 67  ----AIFKAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKE 122

Query: 585 LRISSGATVTV 617
           +R S+GA V V
Sbjct: 123 IRESTGAQVQV 133



 Score = 42.7 bits (99), Expect = 0.005
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIIS 383
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER I I+
Sbjct: 98  VTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIA 149



 Score = 36.6 bits (83), Expect = 0.35
 Identities = 17/54 (31%), Positives = 33/54 (61%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           +Q   + + +P+  IG +IG+ G +I +IR+ + A IKIA+ +    +R + I+
Sbjct: 282 AQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTIT 335



>sp|Q15366|PCB2_HUMAN Poly(rC)-binding protein 2 (Alpha-CP2)
           (hnRNP-E2).>pir|S65679|S42471 hnRNP protein E2 -
           human>gb:AX711242_1473665 Sequence 9 from Patent
           WO03016343.>gb:HSRNPE2_2020122 H.sapiens hnRNP-E2
           mRNA.>gb:BC078906_2107057 Rattus norvegicus cDNA clone
           MGC:93663 IMAGE:7112287, complete cds.
          Length = 365

 Score = 60.5 bits (145), Expect = 2e-08
 Identities = 39/131 (29%), Positives = 69/131 (52%), Gaps = 2/131 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER+I ++   N     
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISE--GNCPERIITLAGPTN----- 66

Query: 411 DAESALHQIVTLILKDDESNIEA--MKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIEN 584
               A+ +   +I+   E +I +    + A   P  ++R ++  SQ G LIG  G  I+ 
Sbjct: 67  ----AIFKAFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKE 122

Query: 585 LRISSGATVTV 617
           +R S+GA V V
Sbjct: 123 IRESTGAQVQV 133



 Score = 42.7 bits (99), Expect = 0.005
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIIS 383
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER I I+
Sbjct: 98  VTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIA 149



 Score = 36.6 bits (83), Expect = 0.35
 Identities = 17/54 (31%), Positives = 33/54 (61%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           +Q   + + +P+  IG +IG+ G +I +IR+ + A IKIA+ +    +R + I+
Sbjct: 285 AQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTIT 338



>gb:BC074333_2557844 Xenopus laevis MGC84166 protein, mRNA (cDNA
           clone MGC:84166 IMAGE:6952543), complete cds.
          Length = 225

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 38/130 (29%), Positives = 67/130 (51%), Gaps = 1/130 (0%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER++ I+         
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISE--GNCPERIVTITG-------- 63

Query: 411 DAESALHQIVTLILKDDESNIEAM-KAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENL 587
             ++       +  K +E  I +M  + A   P  ++R ++  SQ G LIG  G  I+ +
Sbjct: 64  PTDAIFKAFAMIAYKFEEDIINSMSNSTATSKPPVTLRLVVPASQCGSLIGKGGSKIKEI 123

Query: 588 RISSGATVTV 617
           R S+GA V V
Sbjct: 124 RESTGAQVQV 133



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIIS 383
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER + IS
Sbjct: 98  VTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTIS 149



 Score = 32.3 bits (72), Expect = 6.7
 Identities = 14/49 (28%), Positives = 27/49 (55%)
 Frame = +3

Query: 471 IEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
           +EA  +  G     ++R L+ G + G +IG  G+ ++ +R  SGA + +
Sbjct: 1   MEAKVSEGGLNVTLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINI 49



>gb:BC079196_2107323 Rattus norvegicus poly(rC) binding protein 3
           (predicted), mRNA (cDNA clone MGC:94248 IMAGE:7131426),
           complete cds.
          Length = 319

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 38/130 (29%), Positives = 67/130 (51%), Gaps = 1/130 (0%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER++ I+         
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISE--GNCPERIVTITG-------- 63

Query: 411 DAESALHQIVTLILKDDESNIEAM-KAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENL 587
             ++       +  K +E  I +M  + A   P  ++R ++  SQ G LIG  G  I+ +
Sbjct: 64  PTDAIFKAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVVPASQCGSLIGKGGSKIKEI 123

Query: 588 RISSGATVTV 617
           R S+GA V V
Sbjct: 124 RESTGAQVQV 133



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIIS 383
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER + IS
Sbjct: 98  VTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTIS 149



 Score = 38.1 bits (87), Expect = 0.12
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +3

Query: 237 YRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           + + +P+  IG +IG+ G +I +IR+ + A IKIA+A     ER I I+
Sbjct: 244 HELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANATEGSSERQITIT 292



>gb:BC042440_2098614 Mus musculus poly(rC) binding protein 3, mRNA
           (cDNA clone MGC:30407 IMAGE:4511401), complete cds.
          Length = 249

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 38/130 (29%), Positives = 67/130 (51%), Gaps = 1/130 (0%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER++ I+         
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISE--GNCPERIVTITG-------- 63

Query: 411 DAESALHQIVTLILKDDESNIEAM-KAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENL 587
             ++       +  K +E  I +M  + A   P  ++R ++  SQ G LIG  G  I+ +
Sbjct: 64  PTDAIFKAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVVPASQCGSLIGKGGSKIKEI 123

Query: 588 RISSGATVTV 617
           R S+GA V V
Sbjct: 124 RESTGAQVQV 133



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIIS 383
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER + IS
Sbjct: 98  VTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTIS 149



>gb:AF176327_2057827 Mus musculus alphaCP-3 (Pcbp3) mRNA, complete
           cds.
          Length = 339

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 38/130 (29%), Positives = 67/130 (51%), Gaps = 1/130 (0%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER++ I+         
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISE--GNCPERIVTITG-------- 63

Query: 411 DAESALHQIVTLILKDDESNIEAM-KAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENL 587
             ++       +  K +E  I +M  + A   P  ++R ++  SQ G LIG  G  I+ +
Sbjct: 64  PTDAIFKAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVVPASQCGSLIGKGGSKIKEI 123

Query: 588 RISSGATVTV 617
           R S+GA V V
Sbjct: 124 RESTGAQVQV 133



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIIS 383
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER + IS
Sbjct: 98  VTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTIS 149



 Score = 38.1 bits (87), Expect = 0.12
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +3

Query: 237 YRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           + + +P+  IG +IG+ G +I +IR+ + A IKIA+A     ER I I+
Sbjct: 264 HELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANATEGSSERQITIT 312



>gb:BC012061_1973407 Homo sapiens poly(rC) binding protein 3, mRNA
           (cDNA clone MGC:19901 IMAGE:4637826), complete cds.
          Length = 313

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 38/130 (29%), Positives = 67/130 (51%), Gaps = 1/130 (0%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER++ I+         
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISE--GNCPERIVTITG-------- 63

Query: 411 DAESALHQIVTLILKDDESNIEAM-KAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENL 587
             ++       +  K +E  I +M  + A   P  ++R ++  SQ G LIG  G  I+ +
Sbjct: 64  PTDAIFKAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVVPASQCGSLIGKGGSKIKEI 123

Query: 588 RISSGATVTV 617
           R S+GA V V
Sbjct: 124 RESTGAQVQV 133



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIIS 383
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER + IS
Sbjct: 98  VTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTIS 149



 Score = 38.1 bits (87), Expect = 0.12
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +3

Query: 237 YRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           + + +P+  IG +IG+ G +I +IR+ + A IKIA+A     ER I I+
Sbjct: 238 HELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANATEGSSERQITIT 286



>gb:AY780793_1964717 Homo sapiens poly(rC) binding protein 3 (PCBP3)
           mRNA, complete cds, alternatively spliced.
          Length = 361

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 38/130 (29%), Positives = 67/130 (51%), Gaps = 1/130 (0%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER++ I+         
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISE--GNCPERIVTITG-------- 63

Query: 411 DAESALHQIVTLILKDDESNIEAM-KAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENL 587
             ++       +  K +E  I +M  + A   P  ++R ++  SQ G LIG  G  I+ +
Sbjct: 64  PTDAIFKAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVVPASQCGSLIGKGGSKIKEI 123

Query: 588 RISSGATVTV 617
           R S+GA V V
Sbjct: 124 RESTGAQVQV 133



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIIS 383
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER + IS
Sbjct: 98  VTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTIS 149



 Score = 38.1 bits (87), Expect = 0.12
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +3

Query: 237 YRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           + + +P+  IG +IG+ G +I +IR+ + A IKIA+A     ER I I+
Sbjct: 286 HELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANATEGSSERQITIT 334



>gb:AK094301_1914139 Homo sapiens cDNA FLJ36982 fis, clone
           BRACE2006488, highly similar to POLY(RC) BINDING PROTEIN
           2.
          Length = 351

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 38/130 (29%), Positives = 67/130 (51%), Gaps = 1/130 (0%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER++ I+         
Sbjct: 46  LTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISE--GNCPERIVTITG-------- 95

Query: 411 DAESALHQIVTLILKDDESNIEAM-KAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENL 587
             ++       +  K +E  I +M  + A   P  ++R ++  SQ G LIG  G  I+ +
Sbjct: 96  PTDAIFKAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVVPASQCGSLIGKGGSKIKEI 155

Query: 588 RISSGATVTV 617
           R S+GA V V
Sbjct: 156 RESTGAQVQV 165



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIIS 383
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER + IS
Sbjct: 130 VTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTIS 181



 Score = 38.1 bits (87), Expect = 0.12
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +3

Query: 237 YRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           + + +P+  IG +IG+ G +I +IR+ + A IKIA+A     ER I I+
Sbjct: 276 HELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANATEGSSERQITIT 324



>gb:AK079564_1172737 Mus musculus adult male hypothalamus cDNA,
           RIKEN full-length enriched library, clone:A230078G24
           product:poly(rC) binding protein 3, full insert
           sequence.
          Length = 371

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 38/130 (29%), Positives = 67/130 (51%), Gaps = 1/130 (0%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER++ I+         
Sbjct: 46  LTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISE--GNCPERIVTITG-------- 95

Query: 411 DAESALHQIVTLILKDDESNIEAM-KAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENL 587
             ++       +  K +E  I +M  + A   P  ++R ++  SQ G LIG  G  I+ +
Sbjct: 96  PTDAIFKAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVVPASQCGSLIGKGGSKIKEI 155

Query: 588 RISSGATVTV 617
           R S+GA V V
Sbjct: 156 RESTGAQVQV 165



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIIS 383
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER + IS
Sbjct: 130 VTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTIS 181



 Score = 38.1 bits (87), Expect = 0.12
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +3

Query: 237 YRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           + + +P+  IG +IG+ G +I +IR+ + A IKIA+A     ER I I+
Sbjct: 296 HELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANATEGSSERQITIT 344



>gb:AK034811_1163883 Mus musculus 12 days embryo embryonic body
           between diaphragm region and neck cDNA, RIKEN
           full-length enriched library, clone:9430042C14
           product:poly(rC) binding protein 3, full insert
           sequence.
          Length = 370

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 38/130 (29%), Positives = 67/130 (51%), Gaps = 1/130 (0%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER++ I+         
Sbjct: 46  LTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISE--GNCPERIVTITG-------- 95

Query: 411 DAESALHQIVTLILKDDESNIEAM-KAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENL 587
             ++       +  K +E  I +M  + A   P  ++R ++  SQ G LIG  G  I+ +
Sbjct: 96  PTDAIFKAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVVPASQCGSLIGKGGSKIKEI 155

Query: 588 RISSGATVTV 617
           R S+GA V V
Sbjct: 156 RESTGAQVQV 165



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIIS 383
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER + IS
Sbjct: 130 VTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTIS 181



 Score = 38.1 bits (87), Expect = 0.12
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +3

Query: 237 YRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           + + +P+  IG +IG+ G +I +IR+ + A IKIA+A     ER I I+
Sbjct: 295 HELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANATEGSSERQITIT 343



>sp|P57722|PCB3_MOUSE Poly(rC)-binding protein 3 (Alpha-CP3).
          Length = 339

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 38/130 (29%), Positives = 67/130 (51%), Gaps = 1/130 (0%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER++ I+         
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISE--GNCPERIVTITG-------- 63

Query: 411 DAESALHQIVTLILKDDESNIEAM-KAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENL 587
             ++       +  K +E  I +M  + A   P  ++R ++  SQ G LIG  G  I+ +
Sbjct: 64  PTDAIFKAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVVPASQCGSLIGKGGSKIKEI 123

Query: 588 RISSGATVTV 617
           R S+GA V V
Sbjct: 124 RESTGAQVQV 133



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIIS 383
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER + IS
Sbjct: 98  VTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTIS 149



 Score = 38.1 bits (87), Expect = 0.12
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +3

Query: 237 YRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           + + +P+  IG +IG+ G +I +IR+ + A IKIA+A     ER I I+
Sbjct: 264 HELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANATEGSSERQITIT 312



>sp|P57721|PCB3_HUMAN Poly(rC)-binding protein 3
           (Alpha-CP3).>gb:AF176329_1888014 Homo sapiens alphaCP-3
           (PCBP3) mRNA, complete cds.
          Length = 339

 Score = 60.1 bits (144), Expect = 3e-08
 Identities = 38/130 (29%), Positives = 67/130 (51%), Gaps = 1/130 (0%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER++ I+         
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISE--GNCPERIVTITG-------- 63

Query: 411 DAESALHQIVTLILKDDESNIEAM-KAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENL 587
             ++       +  K +E  I +M  + A   P  ++R ++  SQ G LIG  G  I+ +
Sbjct: 64  PTDAIFKAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVVPASQCGSLIGKGGSKIKEI 123

Query: 588 RISSGATVTV 617
           R S+GA V V
Sbjct: 124 RESTGAQVQV 133



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIIS 383
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER + IS
Sbjct: 98  VTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTIS 149



 Score = 38.1 bits (87), Expect = 0.12
 Identities = 19/49 (38%), Positives = 31/49 (63%)
 Frame = +3

Query: 237 YRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           + + +P+  IG +IG+ G +I +IR+ + A IKIA+A     ER I I+
Sbjct: 264 HELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANATEGSSERQITIT 312



>gb:BC056323_2551763 Danio rerio zgc:65870, mRNA (cDNA clone
           MGC:65870 IMAGE:6800379), complete
           cds.>gb:BC065955_2554209 Danio rerio zgc:65870, mRNA
           (cDNA clone MGC:77347 IMAGE:6968104), complete cds.
          Length = 442

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 40/131 (30%), Positives = 67/131 (51%), Gaps = 2/131 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  +++IREE+ A I I++      ER+I I+         
Sbjct: 5   LTLRLLMHGKEVGSIIGKKGETVKRIREESSARINISEGSC--PERIITITG-------- 54

Query: 411 DAESALHQIVTLILKDDESNIEAMKAG--AGHVPANSVRFLIAGSQAGGLIGVSGQNIEN 584
            A   + +  T+I    E ++ A+ A       P  ++R +I  SQ G LIG  G  I+ 
Sbjct: 55  -ATECVFRAFTMITIKLEEDLAALVANGTVTSKPPVTLRLVIPASQCGSLIGKGGSKIKE 113

Query: 585 LRISSGATVTV 617
           +R  +GA V V
Sbjct: 114 IREKTGAQVQV 124



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 20/56 (35%), Positives = 36/56 (64%), Gaps = 1/56 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIISSKDN 395
           +  R+++P+ Q G +IGK G +I++IRE+T A +++A D +    ER + IS   +
Sbjct: 89  VTLRLVIPASQCGSLIGKGGSKIKEIREKTGAQVQVAGDLLPNSTERGVTISGSQD 144



 Score = 36.6 bits (83), Expect = 0.35
 Identities = 17/54 (31%), Positives = 31/54 (57%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           SQ     +++P+  IG +IG+ G +I +IR+ + A IKI   +    +R + I+
Sbjct: 255 SQTASQELLIPNDLIGSIIGRQGTKINEIRQVSGAQIKIGSQLDSTSDRHVTIT 308



>gb:HSRNPE1_2020121 H.sapiens hnRNP-E1 mRNA.
          Length = 356

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 37/131 (28%), Positives = 69/131 (52%), Gaps = 2/131 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  +++IREE+ A I I++      ER+I ++   N     
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISE--GNCPERIITLTGPTN----- 66

Query: 411 DAESALHQIVTLILK--DDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIEN 584
               A+ +   +I+   +++ N     + A   P  ++R ++  +Q G LIG  G  I+ 
Sbjct: 67  ----AIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCGSLIGKGGCKIKE 122

Query: 585 LRISSGATVTV 617
           +R S+GA V V
Sbjct: 123 IRESTGAQVQV 133



 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 26/73 (35%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIISSKDNDGTF 407
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER I I+      T 
Sbjct: 98  VTLRLVVPATQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGVPQSVTE 157

Query: 408 CDAESALHQIVTL 446
           C  +  L  + TL
Sbjct: 158 CVKQICLVMLETL 170



 Score = 35.0 bits (79), Expect = 1.0
 Identities = 17/54 (31%), Positives = 30/54 (55%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           S    + + +P+  IG +IG+ G  I +IR+ + A IKIA+ +     R + I+
Sbjct: 277 STQTTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTIT 330



>gb:HSNUACBIP_2019231 H.sapiens mRNA for nucleic acid binding
           protein sub2.3.
          Length = 299

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 37/131 (28%), Positives = 69/131 (52%), Gaps = 2/131 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  +++IREE+ A I I++      ER+I ++   N     
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISE--GNCPERIITLTGPTN----- 66

Query: 411 DAESALHQIVTLILK--DDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIEN 584
               A+ +   +I+   +++ N     + A   P  ++R ++  +Q G LIG  G  I+ 
Sbjct: 67  ----AIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCGSLIGKGGCKIKE 122

Query: 585 LRISSGATVTV 617
           +R S+GA V V
Sbjct: 123 IRESTGAQVQV 133



 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 26/73 (35%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIISSKDNDGTF 407
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER I I+      T 
Sbjct: 98  VTLRLVVPATQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGVPQSVTE 157

Query: 408 CDAESALHQIVTL 446
           C  +  L  + TL
Sbjct: 158 CVKQICLVMLETL 170



>gb:AX711234_1473661 Sequence 1 from Patent WO03016343.
          Length = 356

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 37/131 (28%), Positives = 69/131 (52%), Gaps = 2/131 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  +++IREE+ A I I++      ER+I ++   N     
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISE--GNCPERIITLTGPTN----- 66

Query: 411 DAESALHQIVTLILK--DDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIEN 584
               A+ +   +I+   +++ N     + A   P  ++R ++  +Q G LIG  G  I+ 
Sbjct: 67  ----AIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCGSLIGKGGCKIKE 122

Query: 585 LRISSGATVTV 617
           +R S+GA V V
Sbjct: 123 IRESTGAQVQV 133



 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 26/73 (35%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIISSKDNDGTF 407
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER I I+      T 
Sbjct: 98  VTLRLVVPATQCGSLIGKGGCKIKEIRESTGAQVQVAVDMLPNSTERAITIAGVPQSVTE 157

Query: 408 CDAESALHQIVTL 446
           C  +  L  + TL
Sbjct: 158 CVKQICLVMLETL 170



 Score = 32.0 bits (71), Expect = 8.7
 Identities = 16/54 (29%), Positives = 29/54 (53%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           S    + + +P+  IG +IG+ G  I +I + + A IKIA+ +     R + I+
Sbjct: 277 STQTTHELTIPNNLIGCIIGRQGANINEICQMSGAQIKIANPVEGSSGRQVTIT 330



>sp|Q15365|PCB1_HUMAN Poly(rC)-binding protein 1 (Alpha-CP1)
           (hnRNP-E1) (Nucleic acid binding protein
           SUB2.3).>sp|P60335|PCB1_MOUSE Poly(rC)-binding protein 1
           (Alpha-CP1) (hnRNP-E1).>sp|O19048|PCB1_RABIT
           Poly(rC)-binding protein 1 (Alpha-CP1)
           (hnRNP-E1).>pir|S58529|S58529 alpha-complex protein 1 -
           human>gb:BT021017_1436375 Bos taurus poly(rC) binding
           protein 1 (PCBP1), mRNA, complete
           cds.>gb:OCHNRNPE1_1442179 Oryctolagus cuniculus mRNA for
           hnRNP-E1 protein.>gb:BC039742_1982628 Homo sapiens
           poly(rC) binding protein 1, mRNA (cDNA clone MGC:47561
           IMAGE:6061411), complete cds.>gb:HSU24223_2022943 Human
           alpha-CP1 mRNA, complete cds.>gb:AF139894_2056064 Mus
           musculus RNA-binding protein alpha-CP1 (Pcbp1) mRNA,
           complete cds.>gb:AF139895_2056065 Mus musculus
           RNA-binding protein alpha-CP1 (Pcbp1) gene, complete
           cds.>gb:BC004793_2089796 Mus musculus poly(rC) binding
           protein 1, mRNA (cDNA clone MGC:5645 IMAGE:3588737),
           complete cds.>gb:BC069915_2106187 Mus musculus poly(rC)
           binding protein 1, mRNA (cDNA clone MGC:78172
           IMAGE:3673570), complete cds.>gb:BC084040_2563447
           Xenopus laevis hypothetical LOC494952, mRNA (cDNA clone
           MGC:98389 IMAGE:7197321), complete cds.
          Length = 356

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 37/131 (28%), Positives = 69/131 (52%), Gaps = 2/131 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G  +++IREE+ A I I++      ER+I ++   N     
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGESVKRIREESGARINISE--GNCPERIITLTGPTN----- 66

Query: 411 DAESALHQIVTLILK--DDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIEN 584
               A+ +   +I+   +++ N     + A   P  ++R ++  +Q G LIG  G  I+ 
Sbjct: 67  ----AIFKAFAMIIDKLEEDINSSMTNSTAASRPPVTLRLVVPATQCGSLIGKGGCKIKE 122

Query: 585 LRISSGATVTV 617
           +R S+GA V V
Sbjct: 123 IRESTGAQVQV 133



 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 26/73 (35%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIISSKDNDGTF 407
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER I I+      T 
Sbjct: 98  VTLRLVVPATQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGVPQSVTE 157

Query: 408 CDAESALHQIVTL 446
           C  +  L  + TL
Sbjct: 158 CVKQICLVMLETL 170



 Score = 35.0 bits (79), Expect = 1.0
 Identities = 17/54 (31%), Positives = 30/54 (55%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           S    + + +P+  IG +IG+ G  I +IR+ + A IKIA+ +     R + I+
Sbjct: 277 STQTTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTIT 330



>gb:BC017098_1975906 Homo sapiens poly(rC) binding protein 4, mRNA
           (cDNA clone MGC:14975 IMAGE:3508303), complete cds.
          Length = 360

 Score = 59.3 bits (142), Expect = 5e-08
 Identities = 40/141 (28%), Positives = 75/141 (53%), Gaps = 4/141 (2%)
 Frame = +3

Query: 201 LKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIII 380
           L++  ++S  +  R+++  K++G +IGK G  +++IRE++ A I I++            
Sbjct: 8   LEEEPELSITLTLRMLMHGKEVGSIIGKKGETVKRIREQSSARITISEG----------- 56

Query: 381 SSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHV--PANSVRFLIAGSQAGGL 554
           S  +   T   + +A+   V++I    + ++ A  A  G+V  P  ++R +I  SQ G L
Sbjct: 57  SCPERITTITGSTAAVFHAVSMIAFKLDEDLCAAPANGGNVSRPPVTLRLVIPASQCGSL 116

Query: 555 IGVSGQNIENLRIS--SGATV 611
           IG +G  I+ +R S   GAT+
Sbjct: 117 IGKAGTKIKEIRESPPKGATI 137



 Score = 34.7 bits (78), Expect = 1.3
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = +3

Query: 189 VVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEER 368
           VVP L    + S       +VP+  IG VIG+ G +I +IR+ + A IKI +      ER
Sbjct: 188 VVPGLDPGTQTSSQ---EFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGAGER 244

Query: 369 VIIIS 383
            + I+
Sbjct: 245 HVTIT 249



>gb:DME238947_1378938 Drosophila melanogaster mRNA for Hrb57A
           ribonucleoprotein.
          Length = 496

 Score = 59.3 bits (142), Expect = 5e-08
 Identities = 50/132 (37%), Positives = 70/132 (53%)
 Frame = +3

Query: 195 PPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVI 374
           P  +KR + +++ V RI++PS   G VIGK G  IQK+R + +AT+ + D  S+  ER I
Sbjct: 12  PQDQKRNRRNEETV-RILIPSSIAGAVIGKGGQHIQKMRTQYKATVSVDD--SQGPERTI 68

Query: 375 IISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGL 554
            IS+        D ES L +I+T +LK  E   E             VR LI  S AG +
Sbjct: 69  QISA--------DIESTL-EIITEMLKYFEERDEDF----------DVRLLIHQSLAGCV 109

Query: 555 IGVSGQNIENLR 590
           IG  GQ I+ +R
Sbjct: 110 IGKGGQKIKEIR 121



 Score = 39.3 bits (90), Expect = 0.055
 Identities = 18/48 (37%), Positives = 30/48 (62%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           ++ +P +  G +IGK G RI++IR E+ A I I + +    +R+I IS
Sbjct: 424 QVTIPKELAGAIIGKGGGRIRRIRNESSAYITIDEPLPNSNDRIITIS 471



 Score = 33.5 bits (75), Expect = 3.0
 Identities = 17/35 (48%), Positives = 23/35 (65%)
 Frame = +3

Query: 513 SVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
           +VR LI  S AG +IG  GQ+I+ +R    ATV+V
Sbjct: 24  TVRILIPSSIAGAVIGKGGQHIQKMRTQYKATVSV 58



 Score = 32.7 bits (73), Expect = 5.1
 Identities = 16/41 (39%), Positives = 21/41 (51%)
 Frame = +3

Query: 495 GHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
           GH P NS +  I    AG +IG  G  I  +R  S A +T+
Sbjct: 416 GHDPNNSTQVTIPKELAGAIIGKGGGRIRRIRNESSAYITI 456



>gb:AF142631_1244390 Drosophila melanogaster hnRNP K protein homolog
           (bancal) mRNA, complete cds.
          Length = 490

 Score = 59.3 bits (142), Expect = 5e-08
 Identities = 50/132 (37%), Positives = 70/132 (53%)
 Frame = +3

Query: 195 PPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVI 374
           P  +KR + +++ V RI++PS   G VIGK G  IQK+R + +AT+ + D  S+  ER I
Sbjct: 12  PQDQKRNRRNEETV-RILIPSSIAGAVIGKGGQHIQKMRTQYKATVSVDD--SQGPERTI 68

Query: 375 IISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGL 554
            IS+        D ES L +I+T +LK  E   E             VR LI  S AG +
Sbjct: 69  QISA--------DIESTL-EIITEMLKYFEERDEDF----------DVRLLIHQSLAGCV 109

Query: 555 IGVSGQNIENLR 590
           IG  GQ I+ +R
Sbjct: 110 IGKGGQKIKEIR 121



 Score = 39.3 bits (90), Expect = 0.055
 Identities = 18/48 (37%), Positives = 30/48 (62%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           ++ +P +  G +IGK G RI++IR E+ A I I + +    +R+I IS
Sbjct: 421 QVTIPKELAGAIIGKGGGRIRRIRNESSAYITIDEPLPNSNDRIITIS 468



 Score = 33.5 bits (75), Expect = 3.0
 Identities = 17/35 (48%), Positives = 23/35 (65%)
 Frame = +3

Query: 513 SVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
           +VR LI  S AG +IG  GQ+I+ +R    ATV+V
Sbjct: 24  TVRILIPSSIAGAVIGKGGQHIQKMRTQYKATVSV 58



 Score = 32.7 bits (73), Expect = 5.1
 Identities = 16/41 (39%), Positives = 21/41 (51%)
 Frame = +3

Query: 495 GHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
           GH P NS +  I    AG +IG  G  I  +R  S A +T+
Sbjct: 413 GHDPNNSTQVTIPKELAGAIIGKGGGRIRRIRNESSAYITI 453



>gb:AE013599_1132956 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003791_1224728 Drosophila melanogaster
           chromosome 2R, section 59 of 74 of the complete
           sequence.
          Length = 496

 Score = 59.3 bits (142), Expect = 5e-08
 Identities = 50/132 (37%), Positives = 70/132 (53%)
 Frame = +3

Query: 195 PPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVI 374
           P  +KR + +++ V RI++PS   G VIGK G  IQK+R + +AT+ + D  S+  ER I
Sbjct: 12  PQDQKRNRRNEETV-RILIPSSIAGAVIGKGGQHIQKMRTQYKATVSVDD--SQGPERTI 68

Query: 375 IISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGL 554
            IS+        D ES L +I+T +LK  E   E             VR LI  S AG +
Sbjct: 69  QISA--------DIESTL-EIITEMLKYFEERDEDF----------DVRLLIHQSLAGCV 109

Query: 555 IGVSGQNIENLR 590
           IG  GQ I+ +R
Sbjct: 110 IGKGGQKIKEIR 121



 Score = 39.3 bits (90), Expect = 0.055
 Identities = 18/48 (37%), Positives = 30/48 (62%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           ++ +P +  G +IGK G RI++IR E+ A I I + +    +R+I IS
Sbjct: 424 QVTIPKELAGAIIGKGGGRIRRIRNESSAYITIDEPLPNSNDRIITIS 471



 Score = 33.5 bits (75), Expect = 3.0
 Identities = 17/35 (48%), Positives = 23/35 (65%)
 Frame = +3

Query: 513 SVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
           +VR LI  S AG +IG  GQ+I+ +R    ATV+V
Sbjct: 24  TVRILIPSSIAGAVIGKGGQHIQKMRTQYKATVSV 58



 Score = 32.7 bits (73), Expect = 5.1
 Identities = 16/41 (39%), Positives = 21/41 (51%)
 Frame = +3

Query: 495 GHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
           GH P NS +  I    AG +IG  G  I  +R  S A +T+
Sbjct: 416 GHDPNNSTQVTIPKELAGAIIGKGGGRIRRIRNESSAYITI 456



>gb:AE013599_1132955 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003791_1224727 Drosophila melanogaster
           chromosome 2R, section 59 of 74 of the complete
           sequence.
          Length = 502

 Score = 59.3 bits (142), Expect = 5e-08
 Identities = 50/132 (37%), Positives = 70/132 (53%)
 Frame = +3

Query: 195 PPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVI 374
           P  +KR + +++ V RI++PS   G VIGK G  IQK+R + +AT+ + D  S+  ER I
Sbjct: 18  PQDQKRNRRNEETV-RILIPSSIAGAVIGKGGQHIQKMRTQYKATVSVDD--SQGPERTI 74

Query: 375 IISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGL 554
            IS+        D ES L +I+T +LK  E   E             VR LI  S AG +
Sbjct: 75  QISA--------DIESTL-EIITEMLKYFEERDEDF----------DVRLLIHQSLAGCV 115

Query: 555 IGVSGQNIENLR 590
           IG  GQ I+ +R
Sbjct: 116 IGKGGQKIKEIR 127



 Score = 39.3 bits (90), Expect = 0.055
 Identities = 18/48 (37%), Positives = 30/48 (62%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           ++ +P +  G +IGK G RI++IR E+ A I I + +    +R+I IS
Sbjct: 430 QVTIPKELAGAIIGKGGGRIRRIRNESSAYITIDEPLPNSNDRIITIS 477



 Score = 33.5 bits (75), Expect = 3.0
 Identities = 17/35 (48%), Positives = 23/35 (65%)
 Frame = +3

Query: 513 SVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
           +VR LI  S AG +IG  GQ+I+ +R    ATV+V
Sbjct: 30  TVRILIPSSIAGAVIGKGGQHIQKMRTQYKATVSV 64



 Score = 32.7 bits (73), Expect = 5.1
 Identities = 16/41 (39%), Positives = 21/41 (51%)
 Frame = +3

Query: 495 GHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
           GH P NS +  I    AG +IG  G  I  +R  S A +T+
Sbjct: 422 GHDPNNSTQVTIPKELAGAIIGKGGGRIRRIRNESSAYITI 462



>gb:AP001539_1821279 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, clone:P0708G02.
          Length = 449

 Score = 58.9 bits (141), Expect = 7e-08
 Identities = 38/135 (28%), Positives = 72/135 (53%), Gaps = 1/135 (0%)
 Frame = +3

Query: 225 QDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGT 404
           + + +R++  S ++G +IGK G+ I+ I+ +T   IK+ D + + E+R++ IS   + G 
Sbjct: 113 EPLTFRLLCSSDKVGGIIGKGGNNIKSIQNDTGCEIKVLDTVPKSEDRIVFISGPAHPGD 172

Query: 405 -FCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIE 581
               A++A+  +   I+    +     K G    PA   R +++ +Q G L+G  G  I 
Sbjct: 173 GISPAQNAILHVQRKIVPTSNT-----KEG----PA-ICRLIVSPNQVGCLLGKGGSIIA 222

Query: 582 NLRISSGATVTVLAQ 626
            +R  SGA + VL++
Sbjct: 223 EMRKLSGAHIIVLSK 237



>gb:AC006714_1203839 Caenorhabditis elegans cosmid Y119D3B, complete
           sequence.
          Length = 430

 Score = 58.5 bits (140), Expect = 9e-08
 Identities = 37/132 (28%), Positives = 70/132 (53%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           +  R+++  K++G +IGK G +I+KIREE+ A I I+D      ER++ I+     GT  
Sbjct: 72  LTIRLLMQGKEVGSIIGKKGDQIKKIREESGAKINISDGSC--PERIVTIT-----GTLG 124

Query: 411 DAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENLR 590
               A + +     +D       +   +   P  ++R ++  +Q G LIG  G  I+++R
Sbjct: 125 VIGKAFNMVCNKFEED-----MLLLPNSVPKPPITMRVIVPATQCGSLIGKGGSKIKDIR 179

Query: 591 ISSGATVTVLAQ 626
            ++GA++ V ++
Sbjct: 180 EATGASIQVASE 191



 Score = 44.3 bits (103), Expect = 0.002
 Identities = 23/52 (44%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHE-ERVIIIS 383
           I  R+IVP+ Q G +IGK G +I+ IRE T A+I++A  +  H  ER + +S
Sbjct: 153 ITMRVIVPATQCGSLIGKGGSKIKDIREATGASIQVASEMLPHSTERAVTLS 204



>gb:AF525701_1808321 Arabidopsis thaliana HEN4 isoform 2 (HEN4)
           mRNA, complete cds.
          Length = 836

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 40/159 (25%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query: 150 AFEATDEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRAT 329
           +F  +     +A + PP  +    +QD+V++I+  ++  G VIG  G  ++ +  ET A 
Sbjct: 437 SFTTSASMANTATMKPPPSEVEVGNQDVVFKILCSTENAGGVIGTGGKVVRMLHSETGAF 496

Query: 330 IKIADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPA 509
           I + +A+   EER+I +++ +N    C +  A   I+ +  +  E    A      + P 
Sbjct: 497 INVGNALDDCEERLIAVTASENPE--CQSSPAQKAIMLIFSRLFEL---ATNKILDNGPR 551

Query: 510 NSV--RFLIAGSQAGGLIGVSGQNIENLRISSGATVTVL 620
           +S+  R ++  SQ G ++G  G  +  +R ++GA + +L
Sbjct: 552 SSITARLVVPTSQIGCVLGKGGVIVSEMRKTTGAAIQIL 590



 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 36/140 (25%), Positives = 71/140 (50%), Gaps = 13/140 (9%)
 Frame = +3

Query: 237 YRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSK--------- 389
           +R++ P   +G VIGK G+ I+++++ T A I++ +  S   +RVI I ++         
Sbjct: 49  FRLLCPLSHVGAVIGKSGNVIKQLQQSTGAKIRVEEPPSGSPDRVITIIAQADSKSRVKL 108

Query: 390 --DNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSV--RFLIAGSQAGGLI 557
             +N+G   +AE    +    + K   + I+  +  A    +++V  R L   S AG +I
Sbjct: 109 GANNNG---NAEGEKKEEEVEVSKAQGALIKVFELLAAEADSDTVVCRLLTESSHAGAVI 165

Query: 558 GVSGQNIENLRISSGATVTV 617
           G  GQ + ++R  +G  +++
Sbjct: 166 GKGGQMVGSIRKETGCKISI 185



>gb:AF525700_1808320 Arabidopsis thaliana HEN4 (HEN4) mRNA, complete
           cds.
          Length = 869

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 40/159 (25%), Positives = 80/159 (50%), Gaps = 2/159 (1%)
 Frame = +3

Query: 150 AFEATDEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRAT 329
           +F  +     +A + PP  +    +QD+V++I+  ++  G VIG  G  ++ +  ET A 
Sbjct: 437 SFTTSASMANTATMKPPPSEVEVGNQDVVFKILCSTENAGGVIGTGGKVVRMLHSETGAF 496

Query: 330 IKIADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPA 509
           I + +A+   EER+I +++ +N    C +  A   I+ +  +  E    A      + P 
Sbjct: 497 INVGNALDDCEERLIAVTASENPE--CQSSPAQKAIMLIFSRLFEL---ATNKILDNGPR 551

Query: 510 NSV--RFLIAGSQAGGLIGVSGQNIENLRISSGATVTVL 620
           +S+  R ++  SQ G ++G  G  +  +R ++GA + +L
Sbjct: 552 SSITARLVVPTSQIGCVLGKGGVIVSEMRKTTGAAIQIL 590



 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 36/140 (25%), Positives = 71/140 (50%), Gaps = 13/140 (9%)
 Frame = +3

Query: 237 YRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSK--------- 389
           +R++ P   +G VIGK G+ I+++++ T A I++ +  S   +RVI I ++         
Sbjct: 49  FRLLCPLSHVGAVIGKSGNVIKQLQQSTGAKIRVEEPPSGSPDRVITIIAQADSKSRVKL 108

Query: 390 --DNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSV--RFLIAGSQAGGLI 557
             +N+G   +AE    +    + K   + I+  +  A    +++V  R L   S AG +I
Sbjct: 109 GANNNG---NAEGEKKEEEVEVSKAQGALIKVFELLAAEADSDTVVCRLLTESSHAGAVI 165

Query: 558 GVSGQNIENLRISSGATVTV 617
           G  GQ + ++R  +G  +++
Sbjct: 166 GKGGQMVGSIRKETGCKISI 185



>gb:AY062686_1565342 Arabidopsis thaliana RNA-binding protein-like
           (At5g53060; MNB8.12) mRNA, complete
           cds.>gb:BT008402_1639619 Arabidopsis thaliana At5g53060
           gene, complete cds.
          Length = 652

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 45/159 (28%), Positives = 73/159 (45%), Gaps = 18/159 (11%)
 Frame = +3

Query: 198 PLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVII 377
           P K   +      YRI+    + G VIGK G  I+ IR+ T A I + + +    ER+I 
Sbjct: 57  PSKSHPETMATTTYRILCHDAKAGGVIGKSGTIIKSIRQHTGAWINVHELVPGDAERIIE 116

Query: 378 ISS---KDNDG---TFCDAESALHQIVTLILK------------DDESNIEAMKAGAGHV 503
           IS    +D DG   +F  A+ AL  +   IL+            ++E +   ++ G G V
Sbjct: 117 ISDNRRRDPDGRMPSFSPAQEALFSVHDRILESEAQFGYGGPPPEEEEDYGGVRPGGGRV 176

Query: 504 PANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTVL 620
                R +++    G L+G  G+ IE +RI +   + +L
Sbjct: 177 ---VTRLVVSRMHVGCLLGKGGKIIEQMRIETKTHIRIL 212



 Score = 46.2 bits (108), Expect = 4e-04
 Identities = 37/138 (26%), Positives = 73/138 (52%), Gaps = 3/138 (2%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKD-ND 398
           S+++V++I+ P+ +I +V+G+    I  ++ E    ++++D ++  +E++I ISS++  D
Sbjct: 322 SEELVFQILCPADKIVRVVGESQGIIDLLQNEIGVDVRVSDPVAGSDEQIITISSEEAPD 381

Query: 399 GTFCDAESALHQIVTLI--LKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQ 572
             F  A+ AL  I T I  L  D+ N+             + R L+    +  L G +G 
Sbjct: 382 DPFFPAQEALLHIQTQIIDLIPDKDNL------------ITTRLLVPSRDSICLEGKAGS 429

Query: 573 NIENLRISSGATVTVLAQ 626
             E  R+ +G +V +LA+
Sbjct: 430 VSEISRL-TGTSVQILAR 446



>gb:AB018116_1513841 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MNB8.
          Length = 660

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 45/159 (28%), Positives = 73/159 (45%), Gaps = 18/159 (11%)
 Frame = +3

Query: 198 PLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVII 377
           P K   +      YRI+    + G VIGK G  I+ IR+ T A I + + +    ER+I 
Sbjct: 57  PSKSHPETMATTTYRILCHDAKAGGVIGKSGTIIKSIRQHTGAWINVHELVPGDAERIIE 116

Query: 378 ISS---KDNDG---TFCDAESALHQIVTLILK------------DDESNIEAMKAGAGHV 503
           IS    +D DG   +F  A+ AL  +   IL+            ++E +   ++ G G V
Sbjct: 117 ISDNRRRDPDGRMPSFSPAQEALFSVHDRILESEAQFGYGGPPPEEEEDYGGVRPGGGRV 176

Query: 504 PANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTVL 620
                R +++    G L+G  G+ IE +RI +   + +L
Sbjct: 177 ---VTRLVVSRMHVGCLLGKGGKIIEQMRIETKTHIRIL 212



 Score = 46.2 bits (108), Expect = 4e-04
 Identities = 37/138 (26%), Positives = 73/138 (52%), Gaps = 3/138 (2%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKD-ND 398
           S+++V++I+ P+ +I +V+G+    I  ++ E    ++++D ++  +E++I ISS++  D
Sbjct: 322 SEELVFQILCPADKIVRVVGESQGIIDLLQNEIGVDVRVSDPVAGSDEQIITISSEEAPD 381

Query: 399 GTFCDAESALHQIVTLI--LKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQ 572
             F  A+ AL  I T I  L  D+ N+             + R L+    +  L G +G 
Sbjct: 382 DPFFPAQEALLHIQTQIIDLIPDKDNL------------ITTRLLVPSRDSICLEGKAGS 429

Query: 573 NIENLRISSGATVTVLAQ 626
             E  R+ +G +V +LA+
Sbjct: 430 VSEISRL-TGTSVQILAR 446



>gb:AB008268_1510468 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MSJ1.
          Length = 833

 Score = 56.6 bits (135), Expect = 3e-07
 Identities = 39/159 (24%), Positives = 79/159 (49%), Gaps = 2/159 (1%)
 Frame = +3

Query: 150 AFEATDEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRAT 329
           +F  +     +A + PP  +    +QD+V++I+  ++  G VIG  G  ++ +  ET A 
Sbjct: 425 SFTTSASMANTATMKPPPSEVEVGNQDVVFKILCSTENAGGVIGTGGKVVRMLHSETGAF 484

Query: 330 IKIADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPA 509
           I + + +   EER+I +++ +N    C +  A   I+ +  +  E    A      + P 
Sbjct: 485 INVGNTLDDCEERLIAVTASENPE--CQSSPAQKAIMLIFSRLFEL---ATNKILDNGPR 539

Query: 510 NSV--RFLIAGSQAGGLIGVSGQNIENLRISSGATVTVL 620
           +S+  R ++  SQ G ++G  G  +  +R ++GA + +L
Sbjct: 540 SSITARLVVPTSQIGCVLGKGGVIVSEMRKTTGAAIQIL 578



 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 36/140 (25%), Positives = 71/140 (50%), Gaps = 13/140 (9%)
 Frame = +3

Query: 237 YRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSK--------- 389
           +R++ P   +G VIGK G+ I+++++ T A I++ +  S   +RVI I ++         
Sbjct: 49  FRLLCPLSHVGAVIGKSGNVIKQLQQSTGAKIRVEEPPSGSPDRVITIIAQADSKSRVKL 108

Query: 390 --DNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSV--RFLIAGSQAGGLI 557
             +N+G   +AE    +    + K   + I+  +  A    +++V  R L   S AG +I
Sbjct: 109 GANNNG---NAEGEKKEEEVEVSKAQGALIKVFELLAAEADSDTVVCRLLTESSHAGAVI 165

Query: 558 GVSGQNIENLRISSGATVTV 617
           G  GQ + ++R  +G  +++
Sbjct: 166 GKGGQMVGSIRKETGCKISI 185



>gb:AE016959_1022570 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AE017094_1752389
           Oryza sativa (japonica cultivar-group) chromosome 10,
           section 48 of 77 of the complete sequence.
          Length = 619

 Score = 55.5 bits (132), Expect = 7e-07
 Identities = 43/175 (24%), Positives = 78/175 (44%), Gaps = 7/175 (4%)
 Frame = +3

Query: 117 STTAKRRRDEDAFEATDEAGTSAEVVPPLKKRVKVSQD------IVYRIIVPSKQIGKVI 278
           S T ++  DE  +   ++  T  E           ++D       V+R+++P+ ++G VI
Sbjct: 15  SKTKRQEEDEVIWRMVEQGATDDEECGGTNCSAGENRDPGWPGTSVFRMLIPATKVGAVI 74

Query: 279 GKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDN-DGTFCDAESALHQIVTLILK 455
           G  G R++++ EET+A +++        ER +II +K+  D     A  AL ++   I+ 
Sbjct: 75  GHSGERLRRLCEETKACVRVIGGHFAAAERAVIIFAKEQPDEPKPPAIDALLRVYECIIN 134

Query: 456 DDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTVL 620
           DD  ++               R L    QA  LIG  G  I  ++ +S   + V+
Sbjct: 135 DDGLDVRYNNIVV-------ARILTPSEQAASLIGDQGSVINYIKKASKTNIHVI 182



>gb:BC054653_2551062 Danio rerio heterogeneous nuclear
           ribonucleoprotein K, mRNA (cDNA clone MGC:66162
           IMAGE:5600243), complete cds.
          Length = 420

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 46/176 (26%), Positives = 78/176 (44%)
 Frame = +3

Query: 99  EDDPYKSTTAKRRRDEDAFEATDEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVI 278
           E+DP +  T   +       A D     +E   P K+     + +  RI++ SK  G VI
Sbjct: 4   ENDPQEEETFSNKESNGKRSADD-----SEEEKPYKRSRNSDEMVELRILLQSKNAGAVI 58

Query: 279 GKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKD 458
           GK G  I+ +R +  AT+ + D  S   ER++ +S+        D  +    ++ +I   
Sbjct: 59  GKGGKDIKALRTDYNATVSVPD--SSGPERILSVSA--------DIPTVAEILLKII--- 105

Query: 459 DESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTVLAQ 626
               +E  +   G      +R LI  S AG +IG+ G  I+ LR S+  T+ +  +
Sbjct: 106 --PTLEEYQHHKGVDFDCELRLLIHQSLAGSIIGLKGAKIKELRDSTQTTIKLFQE 159



 Score = 46.2 bits (108), Expect = 4e-04
 Identities = 26/72 (36%), Positives = 43/72 (59%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           I  ++ +P    G +IGK G RI++IR E+ A+IKI + +   E+R+I I+     GT  
Sbjct: 342 ITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLQGSEDRIITIT-----GTQD 396

Query: 411 DAESALHQIVTL 446
             ++AL+Q  T+
Sbjct: 397 QIQNALYQPPTV 408



>gb:AJ720731_2502918 Gallus gallus mRNA for hypothetical protein,
           clone 24e23.
          Length = 427

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 47/167 (28%), Positives = 76/167 (45%), Gaps = 4/167 (2%)
 Frame = +3

Query: 138 RDEDAFEATDEAGT----SAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQK 305
           + E+ F  T+  G       E     K+     + +  RI++ SK  G VIGK G  I+ 
Sbjct: 5   QQEETFTNTETNGKRPAEDMEEEQAFKRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKA 64

Query: 306 IREETRATIKIADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMK 485
           +R +  A++ + D  S   ER++ IS+        D E+     +  ILK     +E  +
Sbjct: 65  LRTDYNASVSVPD--SSGPERILSISA--------DTET-----IGEILKKIIPTLEEYQ 109

Query: 486 AGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTVLAQ 626
              G      +R LI  S AGG+IGV G  I+ LR ++  T+ +  +
Sbjct: 110 HYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQE 156



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 20/51 (39%), Positives = 33/51 (64%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           I  ++ +P    G +IGK G RI++IR E+ A+IKI + +   E+R+I I+
Sbjct: 352 ITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITIT 402



 Score = 36.6 bits (83), Expect = 0.35
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 1/62 (1%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHE-ERVIIISSKDNDGT 404
           D   R+++     G +IG  G +I+++RE T+ TIK+      H  +RV++I  K +   
Sbjct: 117 DCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVV 176

Query: 405 FC 410
            C
Sbjct: 177 EC 178



>gb:AL354733_1923325 Human DNA sequence from clone RP11-575L7 on
           chromosome 9 Contains the 5' end of the gene for protein
           kinase anchoring protein GKAP42 (FKSG21), a novel gene
           (DKFZp43D0917), a novel gene (MGC10999), the HNRPK gene
           for heterogeneous nuclear ribonucleoprotein K (CSBP,
           TUNP, HNRNPK), three novel genes, the 5' UTR of a novel
           gene (FLJ12888) and six CpG islands, complete sequence.
          Length = 379

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 44/141 (31%), Positives = 71/141 (50%), Gaps = 1/141 (0%)
 Frame = +3

Query: 207 KRVKVSQDIV-YRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           KR + + ++V  RI++ SK  G VIGK G  I+ +R +  A++ + D  S   ER++ IS
Sbjct: 34  KRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPD--SSGPERILSIS 91

Query: 384 SKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGV 563
           +        D E+     +  ILK     +E  +   G      +R LI  S AGG+IGV
Sbjct: 92  A--------DIET-----IGEILKKIIPTLEEYQHYKGSDFDCELRLLIHQSLAGGIIGV 138

Query: 564 SGQNIENLRISSGATVTVLAQ 626
            G  I+ LR ++  T+ +  +
Sbjct: 139 KGAKIKELRENTQTTIKLFQE 159



 Score = 36.6 bits (83), Expect = 0.35
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 1/62 (1%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHE-ERVIIISSKDNDGT 404
           D   R+++     G +IG  G +I+++RE T+ TIK+      H  +RV++I  K +   
Sbjct: 120 DCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVV 179

Query: 405 FC 410
            C
Sbjct: 180 EC 181



>gb:AE017350_1758965 Cryptococcus neoformans var. neoformans JEC21
           chromosome 10, complete sequence.
          Length = 357

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 34/150 (22%), Positives = 75/150 (50%)
 Frame = +3

Query: 156 EATDEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIK 335
           E + +   S+E   P K      Q I  R ++ ++    +IG+ G  + +IRE++ A + 
Sbjct: 56  EGSPKTAPSSEPTAPAKPDPG-PQQISMRSLIVTQDASIIIGRGGAHVNEIREKSSARVT 114

Query: 336 IADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANS 515
           ++++I  + ER++ +S         DA +    ++   + D+  ++ ++        A +
Sbjct: 115 VSESIPGNPERILNVSGP------LDAVAKAFGLIVRRINDEPFDVPSVPGSR----AVT 164

Query: 516 VRFLIAGSQAGGLIGVSGQNIENLRISSGA 605
           ++F+I  S+ G +IG  G  I+ ++ +SGA
Sbjct: 165 IKFIIPNSRMGSVIGKGGSKIKEIQEASGA 194



 Score = 42.4 bits (98), Expect = 0.006
 Identities = 36/148 (24%), Positives = 66/148 (44%), Gaps = 16/148 (10%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADA-ISRHEERVIIISSKDND 398
           S+ +  + I+P+ ++G VIGK G +I++I+E + A +  ++A +    ERV+ +S     
Sbjct: 160 SRAVTIKFIIPNSRMGSVIGKGGSKIKEIQEASGARLNASEAMLPGSTERVLSVS----- 214

Query: 399 GTFCDAESALHQIVTLIL--------------KDDESNIEAMKAGAGHVPA-NSVRFLIA 533
           G       A++ I T++L              K  +S      + A   P   + +  I 
Sbjct: 215 GVADAVHIAVYYIGTILLEYQDRYPSNATGSYKQSQSRGPPPNSNAPPPPGMQTQQIFIP 274

Query: 534 GSQAGGLIGVSGQNIENLRISSGATVTV 617
            +  G +IG  G  I  +R  S   + V
Sbjct: 275 NALVGAIIGRGGSKINEIRSQSSCQIRV 302



>gb:AK051313_1169649 Mus musculus 12 days embryo spinal ganglion
           cDNA, RIKEN full-length enriched library,
           clone:D130033C09 product:heterogeneous nuclear
           ribonucleoprotein K, full insert
           sequence.>gb:AK088462_1175419 Mus musculus 2 days
           neonate thymus thymic cells cDNA, RIKEN full-length
           enriched library, clone:E430018E05 product:heterogeneous
           nuclear ribonucleoprotein K, full insert sequence.
          Length = 439

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 44/141 (31%), Positives = 71/141 (50%), Gaps = 1/141 (0%)
 Frame = +3

Query: 207 KRVKVSQDIV-YRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           KR + + ++V  RI++ SK  G VIGK G  I+ +R +  A++ + D  S   ER++ IS
Sbjct: 34  KRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPD--SSGPERILSIS 91

Query: 384 SKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGV 563
           +        D E+     +  ILK     +E  +   G      +R LI  S AGG+IGV
Sbjct: 92  A--------DIET-----IGEILKKIIPTLEEYQHYKGSDFDCELRLLIHQSLAGGIIGV 138

Query: 564 SGQNIENLRISSGATVTVLAQ 626
            G  I+ LR ++  T+ +  +
Sbjct: 139 KGAKIKELRENTQTTIKLFQE 159



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 20/51 (39%), Positives = 33/51 (64%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           I  ++ +P    G +IGK G RI++IR E+ A+IKI + +   E+R+I I+
Sbjct: 364 ITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITIT 414



 Score = 36.6 bits (83), Expect = 0.35
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 1/62 (1%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHE-ERVIIISSKDNDGT 404
           D   R+++     G +IG  G +I+++RE T+ TIK+      H  +RV++I  K +   
Sbjct: 120 DCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVV 179

Query: 405 FC 410
            C
Sbjct: 180 EC 181



>gb:BC064170_2553723 Xenopus tropicalis hypothetical protein
           MGC75642, mRNA (cDNA clone MGC:75642 IMAGE:5379554),
           complete cds.
          Length = 399

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 41/129 (31%), Positives = 64/129 (49%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAE 419
           RI++ SK  G VIGK G  I+ +R +  A++ + D  S   ER++ IS+        D E
Sbjct: 43  RILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPD--SSGPERILSISA--------DIE 92

Query: 420 SALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISS 599
           +     +  ILK     +E  +   G+     +R LI  S AGG+IGV G  I+ LR  +
Sbjct: 93  T-----IGEILKKIIPTLEEYQHFKGNDFDCELRLLIHQSLAGGIIGVKGAKIKELREKT 147

Query: 600 GATVTVLAQ 626
             T+ +  +
Sbjct: 148 QTTIKLFQE 156



 Score = 42.4 bits (98), Expect = 0.006
 Identities = 19/51 (37%), Positives = 33/51 (64%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           I  ++ +P    G +IGK G RI++IR E+ A+IKI + +   ++R+I I+
Sbjct: 321 ITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSDDRIITIT 371



 Score = 37.0 bits (84), Expect = 0.27
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 1/62 (1%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHE-ERVIIISSKDNDGT 404
           D   R+++     G +IG  G +I+++RE+T+ TIK+      H  +RV++I  K +   
Sbjct: 117 DCELRLLIHQSLAGGIIGVKGAKIKELREKTQTTIKLFQECCPHSTDRVVLIGGKPDRVV 176

Query: 405 FC 410
            C
Sbjct: 177 EC 178



>sp|Q80WA4|NOA1_RAT RNA-binding protein Nova-1 (Neuro-oncological
           ventral antigen 1) (Fragment).>gb:AY262017_2081151
           Rattus norvegicus neuro-oncological ventral antigen
           1-like protein mRNA, partial cds.
          Length = 474

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 46/165 (27%), Positives = 79/165 (47%), Gaps = 13/165 (7%)
 Frame = +3

Query: 156 EATDEAGTSAEVVPPLKKRVKVSQDIVY--RIIVPSKQIGKVIGKVGHRIQKIREETRAT 329
           EA  EAG++        KR    +D  Y  ++++PS   G +IGK G  I ++++ET AT
Sbjct: 30  EAPPEAGST--------KRTNTGEDGQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGAT 81

Query: 330 IKIA---DAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGH 500
           IK++   D      ERV +I      GT  +A +A+H  +   +++   N+   +  +  
Sbjct: 82  IKLSKSKDFYPGTTERVCLI-----QGTI-EALNAVHGFIAEKIREMPQNVAKTEPVSIL 135

Query: 501 VPANS--------VRFLIAGSQAGGLIGVSGQNIENLRISSGATV 611
            P  +        V+ ++  S AG +IG  G  ++ +   SGA V
Sbjct: 136 QPQTTVNPDRIKQVKIIVPNSTAGLIIGKGGATVKAIMEQSGAWV 180



 Score = 38.1 bits (87), Expect = 0.12
 Identities = 38/142 (26%), Positives = 67/142 (47%), Gaps = 17/142 (11%)
 Frame = +3

Query: 186 EVVPPLKKRVKVSQDIV--YRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA---DAI 350
           E V  L+ +  V+ D +   +IIVP+   G +IGK G  ++ I E++ A ++++   D I
Sbjct: 130 EPVSILQPQTTVNPDRIKQVKIIVPNSTAGLIIGKGGATVKAIMEQSGAWVQLSQKPDGI 189

Query: 351 SRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDES---------NIEAMKAGA--- 494
           +  +ERV+ +S +           A+  I+  I +D +S         N+    A +   
Sbjct: 190 NL-QERVVTVSGEPEQN-----RKAVELIIQKIQEDPQSGSCLNISYANVTGPVANSNPT 243

Query: 495 GHVPANSVRFLIAGSQAGGLIG 560
           G   AN+   L   + A GL+G
Sbjct: 244 GFPYANTAEVLPTAAAAAGLLG 265



>gb:BC044711_2548907 Xenopus laevis heterogeneous nuclear
           ribonucleoprotein K, mRNA (cDNA clone MGC:53459
           IMAGE:5572030), complete cds.
          Length = 399

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 40/129 (31%), Positives = 64/129 (49%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAE 419
           RI++ SK  G VIGK G  I+ +R +  A++ + D  S   ER++ +S+        D E
Sbjct: 43  RILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPD--SSGPERILSMSA--------DIE 92

Query: 420 SALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISS 599
           +     +  ILK     +E  +   G+     +R LI  S AGG+IGV G  I+ LR  +
Sbjct: 93  T-----IGEILKKIIPTLEEYQHFKGNDFDCELRLLIHQSLAGGIIGVKGAKIKELREKT 147

Query: 600 GATVTVLAQ 626
             T+ +  +
Sbjct: 148 QTTIKLFQE 156



 Score = 42.0 bits (97), Expect = 0.008
 Identities = 18/51 (35%), Positives = 33/51 (64%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           +  ++ +P    G +IGK G RI++IR E+ A+IKI + +   ++R+I I+
Sbjct: 321 VTTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSDDRIITIT 371



 Score = 37.0 bits (84), Expect = 0.27
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 1/62 (1%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHE-ERVIIISSKDNDGT 404
           D   R+++     G +IG  G +I+++RE+T+ TIK+      H  +RV++I  K +   
Sbjct: 117 DCELRLLIHQSLAGGIIGVKGAKIKELREKTQTTIKLFQECCPHSTDRVVLIGGKPDRVV 176

Query: 405 FC 410
            C
Sbjct: 177 EC 178



>gb:AP005311_1850362 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0482F12.
          Length = 458

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 35/147 (23%), Positives = 75/147 (51%), Gaps = 18/147 (12%)
 Frame = +3

Query: 234 VYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHE----------------- 362
           V+R++V + ++G +IG+ G  I+++ E+TRA +++ +A +                    
Sbjct: 98  VFRLVVATDKVGGLIGRRGDTIKRLCEDTRARVRVLEAAAAAAANRIVDSDSNDFIAKVT 157

Query: 363 -ERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGS 539
            E V+I +++++      A  A  +I   I   ++ N +   +G+      S + L+  +
Sbjct: 158 FEMVLISATEESQAELPPAMDAAIKIFMHINDIEKINCDDTLSGSAPEKC-SAKLLVPSA 216

Query: 540 QAGGLIGVSGQNIENLRISSGATVTVL 620
           QA  LIG  G  I++++ ++GATV ++
Sbjct: 217 QATHLIGKQGVRIKSIQETTGATVKII 243



 Score = 38.5 bits (88), Expect = 0.093
 Identities = 18/37 (48%), Positives = 26/37 (70%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAI 350
           +++VPS Q   +IGK G RI+ I+E T AT+KI D +
Sbjct: 210 KLLVPSAQATHLIGKQGVRIKSIQETTGATVKIIDKV 246



>pir|S41224|S41224 hnRNP protein - African clawed frog
          Length = 396

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 47/177 (26%), Positives = 79/177 (44%)
 Frame = +3

Query: 96  TEDDPYKSTTAKRRRDEDAFEATDEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKV 275
           TE +  + T  +      A +  DE           K+       +  RI++ SK  G V
Sbjct: 3   TEQEEVEFTNTETNGKRPAEDMEDEQA--------FKRSRNTDMMVELRILLQSKNAGAV 54

Query: 276 IGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILK 455
           IGK G  I+ +R +  A++ + D  S   ER++ IS+        D E+ + +I+  I+ 
Sbjct: 55  IGKGGKNIKALRTDYNASVSVPD--SSGPERILSISA--------DIET-IGEILKKIIP 103

Query: 456 DDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTVLAQ 626
             E + +      G+     +R LI  S AGG+IGV G  I+ LR  +  T+ +  +
Sbjct: 104 TLEEHFK------GNDFDCELRLLIHQSLAGGIIGVKGAKIKELREKTQTTIKLFQE 154



 Score = 42.4 bits (98), Expect = 0.006
 Identities = 19/51 (37%), Positives = 33/51 (64%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           I  ++ +P    G +IGK G RI++IR E+ A+IKI + +   ++R+I I+
Sbjct: 318 ITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSDDRIITIT 368



 Score = 39.3 bits (90), Expect = 0.055
 Identities = 21/77 (27%), Positives = 43/77 (55%), Gaps = 2/77 (2%)
 Frame = +3

Query: 186 EVVPPLKKRVKVSQ-DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHE 362
           +++P L++  K +  D   R+++     G +IG  G +I+++RE+T+ TIK+      H 
Sbjct: 100 KIIPTLEEHFKGNDFDCELRLLIHQSLAGGIIGVKGAKIKELREKTQTTIKLFQECCPHS 159

Query: 363 -ERVIIISSKDNDGTFC 410
            +RV++I  + +    C
Sbjct: 160 TDRVVLIGGRPDRVVEC 176



>gb:BC074252_2557767 Xenopus laevis MGC84002 protein, mRNA (cDNA
           clone MGC:84002 IMAGE:6946330), complete cds.
          Length = 484

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 45/165 (27%), Positives = 78/165 (47%), Gaps = 13/165 (7%)
 Frame = +3

Query: 156 EATDEAGTSAEVVPPLKKRVKVSQD--IVYRIIVPSKQIGKVIGKVGHRIQKIREETRAT 329
           EA  EAG++        KR    +D     ++++PS   G +IGK G  I ++++ET AT
Sbjct: 31  EAPPEAGST--------KRTNTGEDGQFFLKVLIPSYAAGSIIGKGGQTIVQLQKETGAT 82

Query: 330 IKIA---DAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGH 500
           IK++   D      ERV +I      GT  +A +A+H  +   +++   N+   +  +  
Sbjct: 83  IKLSKSKDFYPGTTERVCLI-----QGT-VEALNAVHGFIAEKIREMPQNVAKTEPVSIL 136

Query: 501 VPANS--------VRFLIAGSQAGGLIGVSGQNIENLRISSGATV 611
            P  +        V+ ++  S AG +IG  G  ++ +   SGA V
Sbjct: 137 QPQTTVNPDRIKQVKIIVPNSTAGLIIGKGGATVKAVMEQSGAWV 181



 Score = 38.1 bits (87), Expect = 0.12
 Identities = 38/142 (26%), Positives = 67/142 (47%), Gaps = 17/142 (11%)
 Frame = +3

Query: 186 EVVPPLKKRVKVSQDIV--YRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA---DAI 350
           E V  L+ +  V+ D +   +IIVP+   G +IGK G  ++ + E++ A ++++   D I
Sbjct: 131 EPVSILQPQTTVNPDRIKQVKIIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPDGI 190

Query: 351 SRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDES---------NIEAMKAGA--- 494
           +  +ERV+ +S +           A+  IV  I +D +S         N+    A +   
Sbjct: 191 NL-QERVVTVSGEPEQN-----RKAVELIVQKIQEDPQSGSCLNISYANVTGPVANSNPT 244

Query: 495 GHVPANSVRFLIAGSQAGGLIG 560
           G   AN+   L   + A GL+G
Sbjct: 245 GSPYANTAEVLPTAAAAAGLLG 266



>gb:CR382134_1667264 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 486

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 43/182 (23%), Positives = 81/182 (44%), Gaps = 5/182 (2%)
 Frame = +3

Query: 96  TEDDPYKSTTAKRRRDE-DAFEATDEAGTSAEVVP-PLKKRVKVSQD---IVYRIIVPSK 260
           TED+     + K   DE +AF  TD+A T+ +    P+    +  +D   +++R+  P K
Sbjct: 62  TEDNQETEESHKAPNDEAEAF--TDDASTTTDASSKPVSNHREKERDPTYVMFRMYCPVK 119

Query: 261 QIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAESALHQIV 440
           +   V+GK G +I  IR++    I +++ +    ER++++      G   +   A   I 
Sbjct: 120 EASTVVGKKGEKINHIRDKANVRINVSENLKNVPERIVLVR-----GPAENVARAFGLIT 174

Query: 441 TLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTVL 620
             IL++ E    +M +        +++ LI     G +IG  G     +  +S A +   
Sbjct: 175 RTILEEPEDEPASMLS-----RQYNLKLLIPHPMVGYIIGKQGVKFREIEENSAAKLKAA 229

Query: 621 AQ 626
            Q
Sbjct: 230 EQ 231



>gb:CR382137_1670416 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 347

 Score = 49.3 bits (116), Expect = 5e-05
 Identities = 46/179 (25%), Positives = 72/179 (40%), Gaps = 13/179 (7%)
 Frame = +3

Query: 93  STEDDPYKSTTAKRRRDEDAFEATDEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGK 272
           S+E+ P  +T      +     + D A      +P +      S  I YR++V +K+ G 
Sbjct: 23  SSEESPINNTGVSPSTNG----SNDNANGETNTLPSINDNSNSSALINYRVLVSAKESGC 78

Query: 273 VIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLIL 452
           +IG+ G  I  IREET     I+       ER++ +S     GT  D   AL      + 
Sbjct: 79  LIGQNGAVIDSIREETNTKAGISKLQPGSHERILTVS-----GTLDDCAKALSYFAQALC 133

Query: 453 KDDESNIEAMKAGAGHVPANS-------------VRFLIAGSQAGGLIGVSGQNIENLR 590
               +NIE +     + P                +R LI  +Q G LIG  G  I+ ++
Sbjct: 134 ---NANIENL-VSYSYFPLKQLSLNPCVEGETTILRLLIPNAQMGTLIGSKGARIQQIQ 188



 Score = 38.9 bits (89), Expect = 0.071
 Identities = 22/59 (37%), Positives = 31/59 (52%)
 Frame = +3

Query: 207 KRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           KR      +   I   +  +G +IGK G RIQ +R+ + ATI I+D +    ERV  IS
Sbjct: 259 KRFNNQNAVTTSISFANDMVGALIGKNGSRIQGVRKVSGATIGISDEVEGKPERVFTIS 317



 Score = 37.7 bits (86), Expect = 0.16
 Identities = 33/145 (22%), Positives = 62/145 (42%), Gaps = 17/145 (11%)
 Frame = +3

Query: 234 VYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADA-ISRHEERVIIISSKDNDGTFC 410
           + R+++P+ Q+G +IG  G RIQ+I+     ++  + + +    ER++ +      GT  
Sbjct: 163 ILRLLIPNAQMGTLIGSKGARIQQIQANYNISMIASKSFLPGSNERLVELQ-----GTVD 217

Query: 411 DAESALHQIVTLILKDDES----------------NIEAMKAGAGHVPANSVRFLIAGSQ 542
           +   +L  I   +++D  S                N         +  A +     A   
Sbjct: 218 NLYDSLRIISRCLIEDFSSIVGTSYYVPKASNYARNNNQTNKRFNNQNAVTTSISFANDM 277

Query: 543 AGGLIGVSGQNIENLRISSGATVTV 617
            G LIG +G  I+ +R  SGAT+ +
Sbjct: 278 VGALIGKNGSRIQGVRKVSGATIGI 302



>gb:HSU70477_2025805 Human putative astrocytic NOVA-like RNA-binding
           protein (ANOVA) mRNA, partial cds.
          Length = 498

 Score = 48.5 bits (114), Expect = 9e-05
 Identities = 42/156 (26%), Positives = 71/156 (45%), Gaps = 11/156 (7%)
 Frame = +3

Query: 177 TSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA---DA 347
           T  EVV   +       +   ++++PS   G +IGK G  I ++++ET ATIK++   D 
Sbjct: 21  TPPEVVCTKRSNTGEEGEYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDF 80

Query: 348 ISRHEERVIIISSKDNDGTFCDAESALH--------QIVTLILKDDESNIEAMKAGAGHV 503
                ERV ++      GT  +A +A+H        +I   + K +  NI   +      
Sbjct: 81  YPGTTERVCLV-----QGT-AEALNAVHSFIAEKVREIPQAMTKPEVVNILQPQTTMNPD 134

Query: 504 PANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATV 611
            A   + ++  S AG +IG  G  ++ +   SGA V
Sbjct: 135 RAKQAKLIVPNSTAGLIIGKGGATVKAVMEQSGAWV 170



 Score = 35.0 bits (79), Expect = 1.0
 Identities = 26/105 (24%), Positives = 53/105 (50%), Gaps = 4/105 (3%)
 Frame = +3

Query: 168 EAGTSAEVVPPLKKRVKVSQDIVY--RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA 341
           +A T  EVV  L+ +  ++ D     ++IVP+   G +IGK G  ++ + E++ A ++++
Sbjct: 114 QAMTKPEVVNILQPQTTMNPDRAKQAKLIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLS 173

Query: 342 DAIS--RHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESN 470
                   +ERV+ +S +           A+  IV  + +D +S+
Sbjct: 174 QKPEGINLQERVVTVSGEPE-----QVHKAVSAIVQKVQEDPQSS 213



>sp|Q9UNW9|NOA2_HUMAN RNA-binding protein Nova-2 (Neuro-oncological
           ventral antigen 2) (Astrocytic NOVA1-like RNA-binding
           protein).>gb:AF083898_1881642 Homo sapiens RNA-binding
           protein Nova-2 mRNA, complete cds.
          Length = 492

 Score = 48.5 bits (114), Expect = 9e-05
 Identities = 42/156 (26%), Positives = 71/156 (45%), Gaps = 11/156 (7%)
 Frame = +3

Query: 177 TSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA---DA 347
           T  EVV   +       +   ++++PS   G +IGK G  I ++++ET ATIK++   D 
Sbjct: 15  TPPEVVCTKRSNTGEEGEYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDF 74

Query: 348 ISRHEERVIIISSKDNDGTFCDAESALH--------QIVTLILKDDESNIEAMKAGAGHV 503
                ERV ++      GT  +A +A+H        +I   + K +  NI   +      
Sbjct: 75  YPGTTERVCLV-----QGT-AEALNAVHSFIAEKVREIPQAMTKPEVVNILQPQTTMNPD 128

Query: 504 PANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATV 611
            A   + ++  S AG +IG  G  ++ +   SGA V
Sbjct: 129 RAKQAKLIVPNSTAGLIIGKGGATVKAVMEQSGAWV 164



 Score = 35.0 bits (79), Expect = 1.0
 Identities = 26/105 (24%), Positives = 53/105 (50%), Gaps = 4/105 (3%)
 Frame = +3

Query: 168 EAGTSAEVVPPLKKRVKVSQDIVY--RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA 341
           +A T  EVV  L+ +  ++ D     ++IVP+   G +IGK G  ++ + E++ A ++++
Sbjct: 108 QAMTKPEVVNILQPQTTMNPDRAKQAKLIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLS 167

Query: 342 DAIS--RHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESN 470
                   +ERV+ +S +           A+  IV  + +D +S+
Sbjct: 168 QKPEGINLQERVVTVSGEPE-----QVHKAVSAIVQKVQEDPQSS 207



>gb:AP003572_1831069 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0459H02.
          Length = 662

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 34/134 (25%), Positives = 68/134 (50%), Gaps = 3/134 (2%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDN-DGT 404
           DI++RI+ PS ++  ++G     ++ ++E+    I++ D++   +ER+III+S++  D  
Sbjct: 338 DIIFRILCPSDKVNSLVGTRDGLLEMLQEDVGVDIRLTDSLDGSDERIIIITSREGPDHE 397

Query: 405 FCDAESALHQIVTLI--LKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNI 578
              A+ AL  + T I  L  D+ NI             + R L+  S+     G  G ++
Sbjct: 398 LFPAQEALLHLQTHIVDLGPDKDNI------------ITTRLLVPSSEIACFEGRDG-SL 444

Query: 579 ENLRISSGATVTVL 620
            +++  + A V +L
Sbjct: 445 SDIQRQTSANVQIL 458



 Score = 34.3 bits (77), Expect = 1.8
 Identities = 19/64 (29%), Positives = 34/64 (53%)
 Frame = +3

Query: 198 PLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVII 377
           P  K  +    +  R+IVP   +G ++GK G  I+++R ET+  I+I     +H  R + 
Sbjct: 176 PRAKDARDRGKVTTRLIVPRLHVGCLLGKGGKIIEQMRAETKTHIRILPR-DQHTPRCVS 234

Query: 378 ISSK 389
           +S +
Sbjct: 235 LSEE 238



>gb:BC059161_2103677 Rattus norvegicus cDNA clone MGC:72982
           IMAGE:6887770, complete cds.
          Length = 296

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 39/129 (30%), Positives = 66/129 (51%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTF 407
           DI   + VP + +  +IG+ G  I+++R++T A I + D     +ERV++IS        
Sbjct: 52  DIEIEMRVPQEAVKLIIGRQGANIKQLRKQTGARIDV-DTEDVGDERVLLISGFPVQ--V 108

Query: 408 CDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENL 587
           C A++A+HQI+T    ++    E +      VP  SV         G +IG  G+ I ++
Sbjct: 109 CKAKAAIHQILT----ENTPVFEQLS-----VPQRSV---------GRIIGRGGETIRSI 150

Query: 588 RISSGATVT 614
             +SGA +T
Sbjct: 151 CKASGAKIT 159



>gb:BC057030_2102548 Mus musculus tudor and KH domain containing
           protein, mRNA (cDNA clone MGC:67203 IMAGE:6833743),
           complete cds.
          Length = 560

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 39/129 (30%), Positives = 66/129 (51%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTF 407
           DI   + VP + +  +IG+ G  I+++R++T A I + D     +ERV++IS        
Sbjct: 52  DIEIEMRVPQEAVKLIIGRQGANIKQLRKQTGARIDV-DTEDVGDERVLLISGFPVQ--V 108

Query: 408 CDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENL 587
           C A++A+HQI+T    ++    E +      VP  SV         G +IG  G+ I ++
Sbjct: 109 CKAKAAIHQILT----ENTPVFEQLS-----VPQRSV---------GRIIGRGGETIRSI 150

Query: 588 RISSGATVT 614
             +SGA +T
Sbjct: 151 CKASGAKIT 159



>sp|Q80VL1|TDRH_MOUSE Tudor and KH domain containing
           protein.>gb:BC049363_2100026 Mus musculus tudor and KH
           domain containing protein, mRNA (cDNA clone MGC:57093
           IMAGE:6490411), complete cds.
          Length = 560

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 39/129 (30%), Positives = 66/129 (51%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTF 407
           DI   + VP + +  +IG+ G  I+++R++T A I + D     +ERV++IS        
Sbjct: 52  DIEIEMRVPQEAVKLIIGRQGANIKQLRKQTGARIDV-DTEDVGDERVLLISGFPVQ--V 108

Query: 408 CDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENL 587
           C A++A+HQI+T    ++    E +      VP  SV         G +IG  G+ I ++
Sbjct: 109 CKAKAAIHQILT----ENTPVFEQLS-----VPQRSV---------GRIIGRGGETIRSI 150

Query: 588 RISSGATVT 614
             +SGA +T
Sbjct: 151 CKASGAKIT 159



>gb:AB072788_1871306 Macaca fascicularis testis cDNA
           clone:QtsA-20987, full insert sequence.
          Length = 561

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 38/133 (28%), Positives = 68/133 (51%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTF 407
           DI   + VP + +  +IG+ G  I+++R++T A I + D     +ERV++IS        
Sbjct: 52  DIEIEMRVPQEAVKLIIGRQGANIKQLRKQTGARIDV-DTEDVGDERVLLISGFPVQ--V 108

Query: 408 CDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENL 587
           C A++A+HQI+T     + + +    +    VP  SV         G +IG  G+ I ++
Sbjct: 109 CKAKAAIHQILT-----ENTPVSEQLS----VPQRSV---------GRIIGRGGETIRSI 150

Query: 588 RISSGATVTVLAQ 626
             +SGA +T + +
Sbjct: 151 CKASGARITCVKE 163



>gb:BC072959_2556878 Xenopus laevis cDNA clone MGC:82481
           IMAGE:4959497, complete cds.
          Length = 413

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 42/179 (23%), Positives = 77/179 (43%), Gaps = 13/179 (7%)
 Frame = +3

Query: 114 KSTTAKRRRDEDAFEATD--EAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKV 287
           ++T +++R  E   EAT    + T+AE             ++  ++++PS   G +IGK 
Sbjct: 4   EATDSRKRPLETPTEATSTKRSNTAAE-----------DGELFLKVLIPSYAAGSIIGKG 52

Query: 288 GHRIQKIREETRATIKIA---DAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKD 458
           G  I +++ ET ATIK++   D      ERV ++          +A  ++H  +   +++
Sbjct: 53  GQTIVQLQRETGATIKLSKSKDFYPGTTERVCLVQGS------AEALLSVHNFIAEKVRE 106

Query: 459 DESNIEAMKAGAGHVP--------ANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATV 611
                     G    P        A   + ++  + AG +IG  G  + N+   SGA V
Sbjct: 107 VPQGAPKNDLGVLLPPQSTINAERAKQAKLIVPNTTAGLIIGKGGATVRNIMEESGAWV 165



 Score = 37.0 bits (84), Expect = 0.27
 Identities = 23/86 (26%), Positives = 45/86 (52%), Gaps = 2/86 (2%)
 Frame = +3

Query: 189 VVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIAD--AISRHE 362
           V+ P +  +   +    ++IVP+   G +IGK G  ++ I EE+ A ++++   A S   
Sbjct: 118 VLLPPQSTINAERAKQAKLIVPNTTAGLIIGKGGATVRNIMEESGAWVQLSQKPAGSNLH 177

Query: 363 ERVIIISSKDNDGTFCDAESALHQIV 440
           ERV+ +S + +       + A+H I+
Sbjct: 178 ERVVTVSGEPS-----QVQKAIHSII 198



>gb:BC032690_1980619 Homo sapiens tudor and KH domain containing
           protein, mRNA (cDNA clone MGC:45166 IMAGE:5241008),
           complete cds.
          Length = 561

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 38/129 (29%), Positives = 66/129 (51%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTF 407
           DI   + VP + +  +IG+ G  I+++R++T A I + D     +ERV++IS        
Sbjct: 52  DIEIEMRVPQEAVKLIIGRQGANIKQLRKQTGARIDV-DTEDVGDERVLLISGFPVQ--V 108

Query: 408 CDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENL 587
           C A++A+HQI+T     + + +    +    VP  SV         G +IG  G+ I ++
Sbjct: 109 CKAKAAIHQILT-----ENTPVSEQLS----VPQRSV---------GRIIGRGGETIRSI 150

Query: 588 RISSGATVT 614
             +SGA +T
Sbjct: 151 CKASGAKIT 159



>gb:AL589765_1929175 Human DNA sequence from clone RP11-98D18 on
           chromosome 1 Contains the 3' end of the SNX27 gene for
           sorting nexin family member 27, the TNRC4 gene for
           trinucleotide repeat containing 4, five novel genes, a
           ribosomal protein S11 (RPS11) pseudogene, the MRPL9 gene
           for mitochondrial ribosomal protein L9, the OAZ3 gene
           for ornithine decarboxylase antizyme 3, a novel gene
           (FLJ36032) the TDRKH gene for tudor and KH domain
           containing, the RORC gene for RAR-related orphan
           receptor C and four CpG islands, complete sequence.
          Length = 561

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 38/129 (29%), Positives = 66/129 (51%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTF 407
           DI   + VP + +  +IG+ G  I+++R++T A I + D     +ERV++IS        
Sbjct: 52  DIEIEMRVPQEAVKLIIGRQGANIKQLRKQTGARIDV-DTEDVGDERVLLISGFPVQ--V 108

Query: 408 CDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENL 587
           C A++A+HQI+T     + + +    +    VP  SV         G +IG  G+ I ++
Sbjct: 109 CKAKAAIHQILT-----ENTPVSEQLS----VPQRSV---------GRIIGRGGETIRSI 150

Query: 588 RISSGATVT 614
             +SGA +T
Sbjct: 151 CKASGAKIT 159



>gb:AF227192_1891523 Homo sapiens tudor and KH domain-containing
           protein (TDRKH) (TDRKH) mRNA, complete cds.
          Length = 561

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 38/129 (29%), Positives = 66/129 (51%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTF 407
           DI   + VP + +  +IG+ G  I+++R++T A I + D     +ERV++IS        
Sbjct: 52  DIEIEMRVPQEAVKLIIGRQGANIKQLRKQTGARIDV-DTEDVGDERVLLISGFPVQ--V 108

Query: 408 CDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENL 587
           C A++A+HQI+T     + + +    +    VP  SV         G +IG  G+ I ++
Sbjct: 109 CKAKAAIHQILT-----ENTPVSEQLS----VPQRSV---------GRIIGRGGETIRSI 150

Query: 588 RISSGATVT 614
             +SGA +T
Sbjct: 151 CKASGAKIT 159



>gb:AC006540_1875178 Homo sapiens chromosome 19, cosmid F23842,
           complete sequence.
          Length = 464

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 38/135 (28%), Positives = 65/135 (48%), Gaps = 11/135 (8%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA---DAISRHEERVIIISSKDNDGTFC 410
           ++++PS   G +IGK G  I ++++ET ATIK++   D      ERV ++      GT  
Sbjct: 8   KVLIPSYAAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLV-----QGT-A 61

Query: 411 DAESALH--------QIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVS 566
           +A +A+H        +I   + K +  NI   +       A   + ++  S AG +IG  
Sbjct: 62  EALNAVHSFIAEKVREIPQAMTKPEVVNILQPQTTMNPDRAKQAKLIVPNSTAGLIIGKG 121

Query: 567 GQNIENLRISSGATV 611
           G  ++ +   SGA V
Sbjct: 122 GATVKAVMEQSGAWV 136



 Score = 35.0 bits (79), Expect = 1.0
 Identities = 26/105 (24%), Positives = 53/105 (50%), Gaps = 4/105 (3%)
 Frame = +3

Query: 168 EAGTSAEVVPPLKKRVKVSQDIVY--RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA 341
           +A T  EVV  L+ +  ++ D     ++IVP+   G +IGK G  ++ + E++ A ++++
Sbjct: 80  QAMTKPEVVNILQPQTTMNPDRAKQAKLIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLS 139

Query: 342 DAIS--RHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESN 470
                   +ERV+ +S +           A+  IV  + +D +S+
Sbjct: 140 QKPEGINLQERVVTVSGEPE-----QVHKAVSAIVQKVQEDPQSS 179



>gb:AX711236_1473662 Sequence 3 from Patent WO03016343.
          Length = 345

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 26/73 (35%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIISSKDNDGTF 407
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER I I+      T 
Sbjct: 87  VTLRLVVPATQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIAGVPQSVTE 146

Query: 408 CDAESALHQIVTL 446
           C  +  L  + TL
Sbjct: 147 CVKQICLVMLETL 159



 Score = 35.0 bits (79), Expect = 1.0
 Identities = 17/54 (31%), Positives = 30/54 (55%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           S    + + +P+  IG +IG+ G  I +IR+ + A IKIA+ +     R + I+
Sbjct: 266 STQTTHELTIPNNLIGCIIGRQGANINEIRQMSGAQIKIANPVEGSSGRQVTIT 319



>sp|Q9Y2W6|TDRH_HUMAN Tudor and KH domain containing
           protein.>gb:AF119121_1884730 Homo sapiens putative RNA
           binding protein mRNA, alternatively spliced, complete
           cds.
          Length = 606

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 38/129 (29%), Positives = 66/129 (51%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTF 407
           DI   + VP + +  +IG+ G  I+++R++T A I + D     +ERV++IS        
Sbjct: 52  DIEIEMRVPQEAVKLIIGRQGANIKQLRKQTGARIDV-DTEDVGDERVLLISGFPVQ--V 108

Query: 408 CDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENL 587
           C A++A+HQI+T     + + +    +    VP  SV         G +IG  G+ I ++
Sbjct: 109 CKAKAAIHQILT-----ENTPVSEQLS----VPQRSV---------GRIIGRGGETIRSI 150

Query: 588 RISSGATVT 614
             +SGA +T
Sbjct: 151 CKASGAKIT 159



>sp|Q9JKN6|NOA1_MOUSE RNA-binding protein Nova-1 (Neuro-oncological
           ventral antigen 1) (Ventral neuron-specific protein 1)
           (Fragment).>gb:AF232828_2060076 Mus musculus ventral
           neuron-specific protein 1 NOVA1 (Nova1) mRNA, partial
           cds.
          Length = 493

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 49/189 (25%), Positives = 81/189 (42%), Gaps = 37/189 (19%)
 Frame = +3

Query: 156 EATDEAGTSAEVVPPLKKRVKVSQDIVY--RIIVPSKQIGKVIGKVGHRIQKIREETRAT 329
           EA  EAG++        KR    +D  Y  ++++PS   G +IGK G  I ++++ET AT
Sbjct: 17  EAPPEAGST--------KRTNTGEDGQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGAT 68

Query: 330 IKIA---DAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNI--------- 473
           IK++   D      ERV +I      GT  +A +A+H  +   +++   N+         
Sbjct: 69  IKLSKSKDFYPGTTERVCLI-----QGTI-EALNAVHGFIAEKIREMPQNVAKTEPVSIL 122

Query: 474 --------EAMKAGAGHVP---------------ANSVRFLIAGSQAGGLIGVSGQNIEN 584
                   + +K      P               AN V+ ++  S AG +IG  G  ++ 
Sbjct: 123 QPQTTVNPDRIKQTLPSSPTTTKSSPSDPMTTSRANQVKIIVPNSTAGLIIGKGGATVKA 182

Query: 585 LRISSGATV 611
           +   SGA V
Sbjct: 183 IMEQSGAWV 191



 Score = 37.0 bits (84), Expect = 0.27
 Identities = 33/122 (27%), Positives = 58/122 (47%), Gaps = 15/122 (12%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA---DAISRHEERVIIISSKDNDGTFC 410
           +IIVP+   G +IGK G  ++ I E++ A ++++   D I+  +ERV+ +S +       
Sbjct: 161 KIIVPNSTAGLIIGKGGATVKAIMEQSGAWVQLSQKPDGINL-QERVVTVSGEPEQN--- 216

Query: 411 DAESALHQIVTLILKDDES---------NIEAMKAGA---GHVPANSVRFLIAGSQAGGL 554
               A+  I+  I +D +S         N+    A +   G   AN+   L   + A GL
Sbjct: 217 --RKAVELIIQKIQEDPQSGSCLNISYANVTGPVANSNPTGSPYANTAEVLPTAAAAAGL 274

Query: 555 IG 560
           +G
Sbjct: 275 LG 276



>gb:MUSPHOSPHO_2129634 Mus cookii phosphoprotein mRNA, complete cds.
          Length = 464

 Score = 46.2 bits (108), Expect = 4e-04
 Identities = 44/161 (27%), Positives = 76/161 (47%), Gaps = 21/161 (13%)
 Frame = +3

Query: 207 KRVKVSQDIV-YRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           KR + + ++V  RI++ SK  G VIGK G  I+ +R +  A++ + D  S   ER++ IS
Sbjct: 34  KRSRNTDEMVELRILLQSKNAGAVIGKGGKNIKALRTDYNASVSVPD--SSGPERILSIS 91

Query: 384 SKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGA-GHVPANS--------------- 515
           +        D E+ + +I+  I+   E  ++     A   +P  S               
Sbjct: 92  A--------DIET-IGEILKKIIPTLEEGLQLPSPTATSQLPLESDAVEVLNYPHYKGSD 142

Query: 516 ----VRFLIAGSQAGGLIGVSGQNIENLRISSGATVTVLAQ 626
               +R LI  + AGG+IGV G  I+ LR ++  T+ +  +
Sbjct: 143 FDCELRLLIHQTLAGGIIGVKGAKIKELRENTQTTIKLFQE 183



 Score = 43.5 bits (101), Expect = 0.003
 Identities = 20/51 (39%), Positives = 33/51 (64%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           I  ++ +P    G +IGK G RI++IR E+ A+IKI + +   E+R+I I+
Sbjct: 388 ITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITIT 438



 Score = 36.2 bits (82), Expect = 0.46
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 1/62 (1%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHE-ERVIIISSKDNDGT 404
           D   R+++     G +IG  G +I+++RE T+ TIK+      H  +RV++I  K +   
Sbjct: 144 DCELRLLIHQTLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVV 203

Query: 405 FC 410
            C
Sbjct: 204 EC 205



>gb:AC024089_1204191 Caenorhabditis elegans cosmid C36E6, complete
           sequence.
          Length = 641

 Score = 46.2 bits (108), Expect = 4e-04
 Identities = 29/130 (22%), Positives = 58/130 (44%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
           I   I +P+ + G +IGK G +++K+R  T   +++     +       +      G   
Sbjct: 157 ITIEIPIPANKCGAIIGKGGEQMRKLRSWTNCNVQLL----QDNNIADTVKPLKITGDPK 212

Query: 411 DAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENLR 590
             E     +  ++  +D++   AM AG G V   S++  +     G ++G+ G+NI+ L 
Sbjct: 213 QVEQCRLLVADILACNDDTPASAMMAGNGPVATMSLQVKVPRCTVGAIMGLQGKNIKKLS 272

Query: 591 ISSGATVTVL 620
             +G  +  L
Sbjct: 273 DETGTKIQFL 282



>pir|T41600|T41600 probable pre-mRNA splicing factor - fission yeast
            (Schizosaccharomyces pombe)>gb:SPCC757_1721604 S.pombe
           chromosome III cosmid c757.
          Length = 398

 Score = 46.2 bits (108), Expect = 4e-04
 Identities = 32/129 (24%), Positives = 59/129 (45%)
 Frame = +3

Query: 195 PPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVI 374
           PP+      +Q +  R ++ +++ G +IGK G  + ++R  T     +  A+    +RV+
Sbjct: 82  PPMDDATYATQQLTLRALLSTREAGIIIGKAGKNVAELRSTTNVKAGVTKAVPNVHDRVL 141

Query: 375 IISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGL 554
            IS     G   +   A   I+ +  K + +N +   + A       +R LIA S  G +
Sbjct: 142 TIS-----GPLENVVRAYRFIIDIFAK-NSTNPDGTPSDAN--TPRKLRLLIAHSLMGSI 193

Query: 555 IGVSGQNIE 581
           IG +G  I+
Sbjct: 194 IGRNGLRIK 202



>gb:BC075038_1989537 Homo sapiens neuro-oncological ventral antigen
           1, transcript variant 1, mRNA (cDNA clone MGC:103957
           IMAGE:30915356), complete cds.>gb:BC075039_1989538 Homo
           sapiens neuro-oncological ventral antigen 1, transcript
           variant 1, mRNA (cDNA clone MGC:104118 IMAGE:30915572),
           complete cds.
          Length = 507

 Score = 45.8 bits (107), Expect = 6e-04
 Identities = 49/189 (25%), Positives = 81/189 (42%), Gaps = 37/189 (19%)
 Frame = +3

Query: 156 EATDEAGTSAEVVPPLKKRVKVSQDIVY--RIIVPSKQIGKVIGKVGHRIQKIREETRAT 329
           EA  EAG++        KR    +D  Y  ++++PS   G +IGK G  I ++++ET AT
Sbjct: 31  EAPPEAGST--------KRTNTGEDGQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGAT 82

Query: 330 IKIA---DAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNI--------- 473
           IK++   D      ERV +I      GT  +A +A+H  +   +++   N+         
Sbjct: 83  IKLSKSKDFYPGTTERVCLI-----QGT-VEALNAVHGFIAEKIREMPQNVAKTEPVSIL 136

Query: 474 --------EAMKAGAGHVP---------------ANSVRFLIAGSQAGGLIGVSGQNIEN 584
                   + +K      P               AN V+ ++  S AG +IG  G  ++ 
Sbjct: 137 QPQTTVNPDRIKQTLPSSPTTTKSSPSDPMTTSRANQVKIIVPNSTAGLIIGKGGATVKA 196

Query: 585 LRISSGATV 611
           +   SGA V
Sbjct: 197 VMEQSGAWV 205



 Score = 36.6 bits (83), Expect = 0.35
 Identities = 32/122 (26%), Positives = 58/122 (47%), Gaps = 15/122 (12%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA---DAISRHEERVIIISSKDNDGTFC 410
           +IIVP+   G +IGK G  ++ + E++ A ++++   D I+  +ERV+ +S +       
Sbjct: 175 KIIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPDGINL-QERVVTVSGEPEQN--- 230

Query: 411 DAESALHQIVTLILKDDES---------NIEAMKAGA---GHVPANSVRFLIAGSQAGGL 554
               A+  I+  I +D +S         N+    A +   G   AN+   L   + A GL
Sbjct: 231 --RKAVELIIQKIQEDPQSGSCLNISYANVTGPVANSNPTGSPYANTAEVLPTAAAAAGL 288

Query: 555 IG 560
           +G
Sbjct: 289 LG 290



>gb:AE017344_1756264 Cryptococcus neoformans var. neoformans JEC21
           chromosome 4, complete sequence.
          Length = 365

 Score = 45.8 bits (107), Expect = 6e-04
 Identities = 35/122 (28%), Positives = 61/122 (50%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAE 419
           R +V +K+ G +IGK G  I  IR+ T     ++  +   ++RV+ ++  D +G      
Sbjct: 34  RSLVSTKEAGIIIGKSGATIATIRDSTGVKAGVSKVVQGVQDRVLSVTG-DLEGV----A 88

Query: 420 SALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISS 599
           SA  ++  L+L+   S+        G     S+R LI+ +  G +IG SG  I+ ++  S
Sbjct: 89  SAYAEVARLLLETPLSDSSLPPPPVGSF--TSIRLLISHNLMGTVIGRSGLKIKQIQDMS 146

Query: 600 GA 605
           GA
Sbjct: 147 GA 148



>gb:U00047_1401485 Caenorhabditis elegans cosmid ZK418, complete
           sequence.
          Length = 510

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 34/125 (27%), Positives = 64/125 (51%), Gaps = 3/125 (2%)
 Frame = +3

Query: 243 IIVPSKQIGKVIGKVGHRIQKIREETRATIKI-ADAISRHEERV-IIISSKDNDGTFCDA 416
           +IVP    G +IGK G  I+++  ET   I+   D     E+R+ +I+ ++D       A
Sbjct: 197 VIVPRLSAGMIIGKGGEMIKRLAAETGTKIQFKPDTNPNSEDRIAVIMGTRDQ---IYRA 253

Query: 417 ESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFL-IAGSQAGGLIGVSGQNIENLRI 593
              + +IV   +K++ +  +   AG   +P  S+ ++ +   + G +IG  G+NI+ +  
Sbjct: 254 TERITEIVNRAIKNNGAPQDRGSAGT-VLPGQSIFYMHVPAGKCGLVIGKGGENIKQIER 312

Query: 594 SSGAT 608
            +GAT
Sbjct: 313 ETGAT 317



 Score = 37.4 bits (85), Expect = 0.21
 Identities = 37/137 (27%), Positives = 55/137 (40%)
 Frame = +3

Query: 159 ATDEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI 338
           A  + G++  V+P         Q I Y + VP+ + G VIGK G  I++I  ET AT  +
Sbjct: 270 APQDRGSAGTVLP--------GQSIFY-MHVPAGKCGLVIGKGGENIKQIERETGATCGL 320

Query: 339 ADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSV 518
           A A  +  E   +   K   G+      A H +   + +   +       GAG       
Sbjct: 321 APAAEQKNEDEKVFEIK---GSQLQIHHASHLVRIKVGEISPNTPVPPLQGAGGGYQQQQ 377

Query: 519 RFLIAGSQAGGLIGVSG 569
               AG+Q GG     G
Sbjct: 378 AMFSAGTQNGGYQSTGG 394



>gb:U00047_1401484 Caenorhabditis elegans cosmid ZK418, complete
           sequence.
          Length = 557

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 34/125 (27%), Positives = 64/125 (51%), Gaps = 3/125 (2%)
 Frame = +3

Query: 243 IIVPSKQIGKVIGKVGHRIQKIREETRATIKI-ADAISRHEERV-IIISSKDNDGTFCDA 416
           +IVP    G +IGK G  I+++  ET   I+   D     E+R+ +I+ ++D       A
Sbjct: 244 VIVPRLSAGMIIGKGGEMIKRLAAETGTKIQFKPDTNPNSEDRIAVIMGTRDQ---IYRA 300

Query: 417 ESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFL-IAGSQAGGLIGVSGQNIENLRI 593
              + +IV   +K++ +  +   AG   +P  S+ ++ +   + G +IG  G+NI+ +  
Sbjct: 301 TERITEIVNRAIKNNGAPQDRGSAGT-VLPGQSIFYMHVPAGKCGLVIGKGGENIKQIER 359

Query: 594 SSGAT 608
            +GAT
Sbjct: 360 ETGAT 364



 Score = 37.4 bits (85), Expect = 0.21
 Identities = 37/137 (27%), Positives = 55/137 (40%)
 Frame = +3

Query: 159 ATDEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI 338
           A  + G++  V+P         Q I Y + VP+ + G VIGK G  I++I  ET AT  +
Sbjct: 317 APQDRGSAGTVLP--------GQSIFY-MHVPAGKCGLVIGKGGENIKQIERETGATCGL 367

Query: 339 ADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSV 518
           A A  +  E   +   K   G+      A H +   + +   +       GAG       
Sbjct: 368 APAAEQKNEDEKVFEIK---GSQLQIHHASHLVRIKVGEISPNTPVPPLQGAGGGYQQQQ 424

Query: 519 RFLIAGSQAGGLIGVSG 569
               AG+Q GG     G
Sbjct: 425 AMFSAGTQNGGYQSTGG 441



>pir|T27855|T27855 hypothetical protein ZK418.9 - Caenorhabditis
           elegans
          Length = 768

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 34/125 (27%), Positives = 64/125 (51%), Gaps = 3/125 (2%)
 Frame = +3

Query: 243 IIVPSKQIGKVIGKVGHRIQKIREETRATIKI-ADAISRHEERV-IIISSKDNDGTFCDA 416
           +IVP    G +IGK G  I+++  ET   I+   D     E+R+ +I+ ++D       A
Sbjct: 455 VIVPRLSAGMIIGKGGEMIKRLAAETGTKIQFKPDTNPNSEDRIAVIMGTRDQ---IYRA 511

Query: 417 ESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFL-IAGSQAGGLIGVSGQNIENLRI 593
              + +IV   +K++ +  +   AG   +P  S+ ++ +   + G +IG  G+NI+ +  
Sbjct: 512 TERITEIVNRAIKNNGAPQDRGSAGT-VLPGQSIFYMHVPAGKCGLVIGKGGENIKQIER 570

Query: 594 SSGAT 608
            +GAT
Sbjct: 571 ETGAT 575



 Score = 37.4 bits (85), Expect = 0.21
 Identities = 37/137 (27%), Positives = 55/137 (40%)
 Frame = +3

Query: 159 ATDEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI 338
           A  + G++  V+P         Q I Y + VP+ + G VIGK G  I++I  ET AT  +
Sbjct: 528 APQDRGSAGTVLP--------GQSIFY-MHVPAGKCGLVIGKGGENIKQIERETGATCGL 578

Query: 339 ADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSV 518
           A A  +  E   +   K   G+      A H +   + +   +       GAG       
Sbjct: 579 APAAEQKNEDEKVFEIK---GSQLQIHHASHLVRIKVGEISPNTPVPPLQGAGGGYQQQQ 635

Query: 519 RFLIAGSQAGGLIGVSG 569
               AG+Q GG     G
Sbjct: 636 AMFSAGTQNGGYQSTGG 652



>gb:AJ719686_2501873 Gallus gallus mRNA for hypothetical protein,
           clone 5e15.
          Length = 584

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 34/152 (22%), Positives = 72/152 (47%), Gaps = 2/152 (1%)
 Frame = +3

Query: 168 EAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI--A 341
           + G   +  P    R K   D+  R++VP++ +G +IGK G  I+ I ++T++ I I   
Sbjct: 176 QRGPPRQGSPSATTRQKPQSDVPLRMLVPTQFVGAIIGKEGATIRNITKQTQSKIDIHRK 235

Query: 342 DAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVR 521
           +     E+ + I S+ +   T C       +I+  I++ +  + +  +     +P   ++
Sbjct: 236 ENAGAAEKPITIHSTPEGCSTAC-------KIIMEIMQKEAQDTKFTE----EIP---LK 281

Query: 522 FLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
            L   +  G LIG  G+N++ +   +   +T+
Sbjct: 282 ILAHNNFVGRLIGKEGRNLKKIEQDTDTKITI 313



>gb:AF257771_1893222 Homo sapiens RNA binding protein MCG10 mRNA,
           complete cds, alternatively spliced.
          Length = 369

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 1/76 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIISSKDNDGTF 407
           +  R+++P+ Q G +IGK G +I++IRE T A +++A D +    ER + +S   +    
Sbjct: 68  VTLRLVIPASQCGSLIGKAGTKIKEIRETTGAQVQVAGDLLPNSTERAVTVSGVPDAIIL 127

Query: 408 CDAESALHQIVTLILK 455
           C     + QI  +IL+
Sbjct: 128 C-----VRQICAVILE 138



 Score = 34.7 bits (78), Expect = 1.3
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = +3

Query: 189 VVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEER 368
           VVP L    + S       +VP+  IG VIG+ G +I +IR+ + A IKI +      ER
Sbjct: 197 VVPGLDPGTQTSSQ---EFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGAGER 253

Query: 369 VIIIS 383
            + I+
Sbjct: 254 HVTIT 258



>gb:BX842627_1643867 Neurospora crassa DNA linkage group I BAC clone
           B8J22.
          Length = 489

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 37/156 (23%), Positives = 66/156 (42%), Gaps = 1/156 (0%)
 Frame = +3

Query: 141 DEDAFEATDEAGTSAEVVPPLKKRVKVSQDIVY-RIIVPSKQIGKVIGKVGHRIQKIREE 317
           D    +AT + G  +   PP+  +       ++ R ++ S +   +IGK G  + KIRE 
Sbjct: 94  DAPQSKATKDHGARSRAQPPVSAQPHDETAWIHVRSVISSPEAATIIGKGGENVSKIREM 153

Query: 318 TRATIKIADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAG 497
           + A   ++D      ER++ +S         DA +    ++   L    +N    +    
Sbjct: 154 SNAKCTVSDYQKGAVERILTVSG------VVDAVAKAFGLIIRTL----NNEPLAEPSNT 203

Query: 498 HVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGA 605
           H     +R LI     G +IG  G  I+ ++ +SGA
Sbjct: 204 HSKTYPLRLLIPHVLIGSIIGKGGARIKEIQEASGA 239



 Score = 37.7 bits (86), Expect = 0.16
 Identities = 16/54 (29%), Positives = 32/54 (59%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKD 392
           +  +I +P+  +G +IGK G +I +IR+ + + IKI +      ER++ I+  +
Sbjct: 407 LTQQIYIPNDMVGAIIGKGGQKINEIRQISGSVIKINEPQDNSNERLVTITGTE 460



 Score = 33.5 bits (75), Expect = 3.0
 Identities = 16/48 (33%), Positives = 31/48 (64%), Gaps = 1/48 (2%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADA-ISRHEERVIII 380
           R+++P   IG +IGK G RI++I+E + A +  +D+ +    ER +++
Sbjct: 211 RLLIPHVLIGSIIGKGGARIKEIQEASGARLNASDSCLPLSTERSLVV 258



>pir|T04011|T04011 hypothetical protein T5L19.200 - Arabidopsis
           thaliana>gb:ATCHRIV28_1544721 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 28.>gb:ATT5L19_1556223
           Arabidopsis thaliana DNA chromosome 4, BAC clone T5L19
           (ESSA project).
          Length = 748

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 39/152 (25%), Positives = 70/152 (46%), Gaps = 11/152 (7%)
 Frame = +3

Query: 204 KKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI-----ADAISRHEER 368
           +K V  +Q    RI VPS ++G +IGK G  I+ ++  + A I+I     AD  S     
Sbjct: 190 QKEVDGTQSTTRRIDVPSSKVGVLIGKGGETIRYLQFNSGAKIQILRDSEADPSSALRPV 249

Query: 369 VIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANS------VRFLI 530
            II       G+    ESA  ++++ ++ + E+         GH   ++      +   +
Sbjct: 250 EII-------GSVACIESA-EKLISAVIAEAEAGGSPALVARGHPSTHAIGIPEQIEIKV 301

Query: 531 AGSQAGGLIGVSGQNIENLRISSGATVTVLAQ 626
              + G +IG  G+ I+N++  SGA   ++ Q
Sbjct: 302 PNDKVGLIIGRGGETIKNMQTRSGARTQLIPQ 333



>gb:BT001739_1356512 Drosophila melanogaster RE72930 full insert
           cDNA.
          Length = 580

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 43/150 (28%), Positives = 67/150 (44%), Gaps = 5/150 (3%)
 Frame = +3

Query: 177 TSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA--DA- 347
           T A VVPP+          +Y   +P+  +G +IG  G  I+ I   + A++KIA  DA 
Sbjct: 295 TPASVVPPVFPNDLQETTYLY---IPNNAVGAIIGTRGSHIRSIMRFSNASLKIAPLDAD 351

Query: 348 --ISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVR 521
             + +  ER + I      GT      A + I       ++   E    G   V   +V 
Sbjct: 352 KPLDQQTERKVTIV-----GTPEGQWKAQYMIF------EKMREEGFMCGTDDVRL-TVE 399

Query: 522 FLIAGSQAGGLIGVSGQNIENLRISSGATV 611
            L+A SQ G +IG  GQN+  L+  +G+ +
Sbjct: 400 LLVASSQVGRIIGKGGQNVRELQRVTGSVI 429



 Score = 36.2 bits (82), Expect = 0.46
 Identities = 24/88 (27%), Positives = 49/88 (55%), Gaps = 3/88 (3%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA---DAISRHEERVIIISSKDND 398
           +I  +I+  +  IG++IGK G+ I++I ++T   I ++   D  S + ER+I +      
Sbjct: 171 EICLKILAHNNLIGRIIGKSGNTIKRIMQDTDTKITVSSINDINSFNLERIITVK----- 225

Query: 399 GTFCDAESALHQIVTLILKDDESNIEAM 482
           G   +   A +QI T + +  E++++A+
Sbjct: 226 GLIENMSRAENQISTKLRQSYENDLQAI 253



 Score = 32.0 bits (71), Expect = 8.7
 Identities = 11/38 (28%), Positives = 25/38 (65%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIAD 344
           +   ++V S Q+G++IGK G  +++++  T + IK+ +
Sbjct: 396 LTVELLVASSQVGRIIGKGGQNVRELQRVTGSVIKLPE 433



>gb:AE014298_1125119 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE014298_1125120 Drosophila melanogaster
           chromosome X, complete sequence.>gb:AE014298_1125121
           Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003484_1212128 Drosophila melanogaster
           chromosome X, section 36 of 74 of the complete
           sequence.>gb:AE003484_1212129 Drosophila melanogaster
           chromosome X, section 36 of 74 of the complete
           sequence.>gb:AE003484_1212130 Drosophila melanogaster
           chromosome X, section 36 of 74 of the complete
           sequence.>gb:AF241237_1254368 Drosophila melanogaster
           IGF-II mRNA-binding protein mRNA, complete
           cds.>gb:AY069821_1294551 Drosophila melanogaster SD07045
           full length cDNA.
          Length = 566

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 43/150 (28%), Positives = 67/150 (44%), Gaps = 5/150 (3%)
 Frame = +3

Query: 177 TSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA--DA- 347
           T A VVPP+          +Y   +P+  +G +IG  G  I+ I   + A++KIA  DA 
Sbjct: 281 TPASVVPPVFPNDLQETTYLY---IPNNAVGAIIGTRGSHIRSIMRFSNASLKIAPLDAD 337

Query: 348 --ISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVR 521
             + +  ER + I      GT      A + I       ++   E    G   V   +V 
Sbjct: 338 KPLDQQTERKVTIV-----GTPEGQWKAQYMIF------EKMREEGFMCGTDDVRL-TVE 385

Query: 522 FLIAGSQAGGLIGVSGQNIENLRISSGATV 611
            L+A SQ G +IG  GQN+  L+  +G+ +
Sbjct: 386 LLVASSQVGRIIGKGGQNVRELQRVTGSVI 415



 Score = 37.7 bits (86), Expect = 0.16
 Identities = 25/88 (28%), Positives = 49/88 (55%), Gaps = 3/88 (3%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA---DAISRHEERVIIISSKDND 398
           +I  +I+  +  IG++IGK G+ I++I ++T   I ++   D  S + ER+I +      
Sbjct: 157 EICLKILAHNNLIGRIIGKSGNTIKRIMQDTDTKITVSSINDINSFNLERIITVK----- 211

Query: 399 GTFCDAESALHQIVTLILKDDESNIEAM 482
           G   +   A +QI T + +  E++++AM
Sbjct: 212 GLIENMSRAENQISTKLRQSYENDLQAM 239



 Score = 32.0 bits (71), Expect = 8.7
 Identities = 11/38 (28%), Positives = 25/38 (65%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIAD 344
           +   ++V S Q+G++IGK G  +++++  T + IK+ +
Sbjct: 382 LTVELLVASSQVGRIIGKGGQNVRELQRVTGSVIKLPE 419



>gb:AE014298_1125114 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE014298_1125115 Drosophila melanogaster
           chromosome X, complete sequence.>gb:AE014298_1125116
           Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE014298_1125117 Drosophila melanogaster
           chromosome X, complete sequence.>gb:AE014298_1125118
           Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003484_1212123 Drosophila melanogaster
           chromosome X, section 36 of 74 of the complete
           sequence.>gb:AE003484_1212124 Drosophila melanogaster
           chromosome X, section 36 of 74 of the complete
           sequence.>gb:AE003484_1212125 Drosophila melanogaster
           chromosome X, section 36 of 74 of the complete
           sequence.>gb:AE003484_1212126 Drosophila melanogaster
           chromosome X, section 36 of 74 of the complete
           sequence.>gb:AE003484_1212127 Drosophila melanogaster
           chromosome X, section 36 of 74 of the complete sequence.
          Length = 573

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 43/150 (28%), Positives = 67/150 (44%), Gaps = 5/150 (3%)
 Frame = +3

Query: 177 TSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA--DA- 347
           T A VVPP+          +Y   +P+  +G +IG  G  I+ I   + A++KIA  DA 
Sbjct: 288 TPASVVPPVFPNDLQETTYLY---IPNNAVGAIIGTRGSHIRSIMRFSNASLKIAPLDAD 344

Query: 348 --ISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVR 521
             + +  ER + I      GT      A + I       ++   E    G   V   +V 
Sbjct: 345 KPLDQQTERKVTIV-----GTPEGQWKAQYMIF------EKMREEGFMCGTDDVRL-TVE 392

Query: 522 FLIAGSQAGGLIGVSGQNIENLRISSGATV 611
            L+A SQ G +IG  GQN+  L+  +G+ +
Sbjct: 393 LLVASSQVGRIIGKGGQNVRELQRVTGSVI 422



 Score = 37.7 bits (86), Expect = 0.16
 Identities = 25/88 (28%), Positives = 49/88 (55%), Gaps = 3/88 (3%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA---DAISRHEERVIIISSKDND 398
           +I  +I+  +  IG++IGK G+ I++I ++T   I ++   D  S + ER+I +      
Sbjct: 164 EICLKILAHNNLIGRIIGKSGNTIKRIMQDTDTKITVSSINDINSFNLERIITVK----- 218

Query: 399 GTFCDAESALHQIVTLILKDDESNIEAM 482
           G   +   A +QI T + +  E++++AM
Sbjct: 219 GLIENMSRAENQISTKLRQSYENDLQAM 246



 Score = 32.0 bits (71), Expect = 8.7
 Identities = 11/38 (28%), Positives = 25/38 (65%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIAD 344
           +   ++V S Q+G++IGK G  +++++  T + IK+ +
Sbjct: 389 LTVELLVASSQVGRIIGKGGQNVRELQRVTGSVIKLPE 426



>sp|P51513|NOA1_HUMAN RNA-binding protein Nova-1 (Neuro-oncological
           ventral antigen 1) (Onconeural ventral antigen-1)
           (Paraneoplastic Ri antigen) (Ventral neuron-specific
           protein 1).>pir|I38489|I38489 onconeural ventral
           antigen-1 - human>gb:HSU04840_2021588 Human onconeural
           ventral antigen-1 (Nova-1) mRNA, complete cds.
          Length = 510

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 49/192 (25%), Positives = 81/192 (42%), Gaps = 40/192 (20%)
 Frame = +3

Query: 156 EATDEAGTSAEVVPPLKKRVKVSQDIVY--RIIVPSKQIGKVIGKVGHRIQKIREETRAT 329
           EA  EAG++        KR    +D  Y  ++++PS   G +IGK G  I ++++ET AT
Sbjct: 31  EAPPEAGST--------KRTNTGEDGQYFLKVLIPSYAAGSIIGKGGQTIVQLQKETGAT 82

Query: 330 IKIA------DAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNI------ 473
           IK++      D      ERV +I      GT  +A +A+H  +   +++   N+      
Sbjct: 83  IKLSKLSKSKDFYPGTTERVCLI-----QGT-VEALNAVHGFIAEKIREMPQNVAKTEPV 136

Query: 474 -----------EAMKAGAGHVP---------------ANSVRFLIAGSQAGGLIGVSGQN 575
                      + +K      P               AN V+ ++  S AG +IG  G  
Sbjct: 137 SILQPQTTVNPDRIKQTLPSSPTTTKSSPSDPMTTSRANQVKIIVPNSTAGLIIGKGGAT 196

Query: 576 IENLRISSGATV 611
           ++ +   SGA V
Sbjct: 197 VKAVMEQSGAWV 208



 Score = 36.6 bits (83), Expect = 0.35
 Identities = 32/122 (26%), Positives = 58/122 (47%), Gaps = 15/122 (12%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA---DAISRHEERVIIISSKDNDGTFC 410
           +IIVP+   G +IGK G  ++ + E++ A ++++   D I+  +ERV+ +S +       
Sbjct: 178 KIIVPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPDGINL-QERVVTVSGEPEQN--- 233

Query: 411 DAESALHQIVTLILKDDES---------NIEAMKAGA---GHVPANSVRFLIAGSQAGGL 554
               A+  I+  I +D +S         N+    A +   G   AN+   L   + A GL
Sbjct: 234 --RKAVELIIQKIQEDPQSGSCLNISYANVTGPVANSNPTGSPYANTAEVLPTAAAAAGL 291

Query: 555 IG 560
           +G
Sbjct: 292 LG 293



>gb:AF161270_2477760 Danio rerio Vg1 RNA binding protein mRNA,
           complete cds.>gb:BC045873_2549391 Danio rerio
           decapentaplegic and Vg-related 1, RNA binding protein,
           mRNA (cDNA clone MGC:56031 IMAGE:3820008), complete cds.
          Length = 582

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 33/143 (23%), Positives = 65/143 (45%), Gaps = 2/143 (1%)
 Frame = +3

Query: 195 PPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI--ADAISRHEER 368
           P L  R K+  D+  R++VP++ +G +IGK G  I+ I ++T + I I   +     E+ 
Sbjct: 183 PSLGARPKLQSDVPLRLLVPTQFVGAIIGKEGATIRNITKQTHSKIDIHRKENAGAAEKP 242

Query: 369 VIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAG 548
           + + S+ +   + C     + Q   +  K  E            +P   ++ L   +  G
Sbjct: 243 ITVHSTPEGCSSACRNIMEIMQKEAIDTKITE-----------EIP---LKILAHNNFVG 288

Query: 549 GLIGVSGQNIENLRISSGATVTV 617
            LIG  G+N++ +   +   +T+
Sbjct: 289 RLIGKEGRNLKKIEQDTDTKITI 311



 Score = 32.3 bits (72), Expect = 6.7
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 2/47 (4%)
 Frame = +3

Query: 243 IIVPSKQIGKVIGKVGHRIQKIREETRATIKI--ADAISRHEERVII 377
           + +P+  +G +IGK G  I+++     A+IKI  AD I   +  VII
Sbjct: 413 LFIPALAVGAIIGKQGQHIKQLSRFAGASIKIAPADGIDAKQRMVII 459



>gb:CR382126_1658831 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 417

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 39/139 (28%), Positives = 59/139 (42%), Gaps = 2/139 (1%)
 Frame = +3

Query: 216 KVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDN 395
           +V   I  R++   KQ  KV+G  G R+ +I+ ET   I ++D I+   ERVI +  K  
Sbjct: 62  QVPNYINLRMLCLMKQASKVVGGKGERVNRIKSETNTRINVSDNINGVMERVIFVRGKCE 121

Query: 396 DGTFCDAESALHQIVTLI--LKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSG 569
                +   A  +IV  I    DD+SN  ++           V  LI     G +IG  G
Sbjct: 122 -----EVARAFGKIVRAINNESDDDSNERSLPL--------VVNLLIPHHFMGCIIGRQG 168

Query: 570 QNIENLRISSGATVTVLAQ 626
             +  +   S A +    Q
Sbjct: 169 SRLHEIEDLSAARLMASPQ 187



 Score = 39.3 bits (90), Expect = 0.055
 Identities = 25/83 (30%), Positives = 41/83 (49%)
 Frame = +3

Query: 243 IIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAES 422
           + + +K +G VIGK G  IQ+I++ T   IKI D +   +ER +++      GT    ++
Sbjct: 336 VFIDNKFVGNVIGKGGKNIQQIKQSTGCMIKINDPVEGLDERKLVLI-----GTPLATQT 390

Query: 423 ALHQIVTLILKDDESNIEAMKAG 491
           A+  I   I  D     E +  G
Sbjct: 391 AIMMINNRIDMDKRKRQENITIG 413



>pir|C86460|C86460 F14M2.18 protein - Arabidopsis
           thaliana>gb:AE005172_892175 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC010164_1536954 Arabidopsis thaliana
           chromosome I BAC F14M2 genomic sequence, complete
           sequence.
          Length = 389

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 44/161 (27%), Positives = 72/161 (44%), Gaps = 7/161 (4%)
 Frame = +3

Query: 165 DEAGTSAEVVP--PLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI 338
           DE G  ++ V      K V  +Q    RI VPS ++G +IGK G  ++ ++  + A I+I
Sbjct: 186 DEIGDESKEVNGGSTHKEVDDTQSTTRRIDVPSSKVGTLIGKGGEMVRYLQVNSGAKIQI 245

Query: 339 -----ADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHV 503
                AD  S      II       GT    E A   I  +I + +   + A+ A    V
Sbjct: 246 RRDAEADPSSALRPVEII-------GTVSCIEKAEKLINAVIAEVEAGGVPALAARG--V 296

Query: 504 PANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTVLAQ 626
           P   +   +   + G +IG  G+ I+N++  S A + ++ Q
Sbjct: 297 P-EQMEIKVPSDKVGVIIGRGGETIKNMQTKSRARIQLIPQ 336



>gb:HSTUNPB_2021343 H.sapiens tunp mRNA for transformation
           upregulated nuclear protein.
          Length = 464

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 20/51 (39%), Positives = 33/51 (64%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           I  ++ +P    G +IGK G RI++IR E+ A+IKI + +   E+R+I I+
Sbjct: 388 ITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITIT 438



 Score = 36.6 bits (83), Expect = 0.35
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 1/62 (1%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHE-ERVIIISSKDNDGT 404
           D   R+++     G +IG  G +I+++RE T+ TIK+      H  +RV++I  K +   
Sbjct: 144 DCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVV 203

Query: 405 FC 410
            C
Sbjct: 204 EC 205



>gb:AY911506_1966107 Homo sapiens heterogeneous nuclear
           ribonucleoprotein K transcript variant (HNRPK) mRNA,
           complete cds, alternatively spliced.
          Length = 464

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 20/51 (39%), Positives = 33/51 (64%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           I  ++ +P    G +IGK G RI++IR E+ A+IKI + +   E+R+I I+
Sbjct: 388 ITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITIT 438



 Score = 36.6 bits (83), Expect = 0.35
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 1/62 (1%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHE-ERVIIISSKDNDGT 404
           D   R+++     G +IG  G +I+++RE T+ TIK+      H  +RV++I  K +   
Sbjct: 144 DCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVV 203

Query: 405 FC 410
            C
Sbjct: 204 EC 205



>gb:AL354733_1923322 Human DNA sequence from clone RP11-575L7 on
           chromosome 9 Contains the 5' end of the gene for protein
           kinase anchoring protein GKAP42 (FKSG21), a novel gene
           (DKFZp43D0917), a novel gene (MGC10999), the HNRPK gene
           for heterogeneous nuclear ribonucleoprotein K (CSBP,
           TUNP, HNRNPK), three novel genes, the 5' UTR of a novel
           gene (FLJ12888) and six CpG islands, complete sequence.
          Length = 428

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 20/51 (39%), Positives = 33/51 (64%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           I  ++ +P    G +IGK G RI++IR E+ A+IKI + +   E+R+I I+
Sbjct: 353 ITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITIT 403



 Score = 36.6 bits (83), Expect = 0.35
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 1/62 (1%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHE-ERVIIISSKDNDGT 404
           D   R+++     G +IG  G +I+++RE T+ TIK+      H  +RV++I  K +   
Sbjct: 109 DCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVV 168

Query: 405 FC 410
            C
Sbjct: 169 EC 170



 Score = 33.9 bits (76), Expect = 2.3
 Identities = 31/110 (28%), Positives = 52/110 (47%)
 Frame = +3

Query: 297 IQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIE 476
           I+ +R +  A++ + D  S   ER++ IS+        D E+     +  ILK     +E
Sbjct: 54  IKALRTDYNASVSVPD--SSGPERILSISA--------DIET-----IGEILKKIIPTLE 98

Query: 477 AMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTVLAQ 626
             +   G      +R LI  S AGG+IGV G  I+ LR ++  T+ +  +
Sbjct: 99  EYQHYKGSDFDCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQE 148



>pir|S43363|S43363 transformation upregulated nuclear protein -
           human>gb:AK078777_1172440 Mus musculus 15 days embryo
           male testis cDNA, RIKEN full-length enriched library,
           clone:8030474M07 product:heterogeneous nuclear
           ribonucleoprotein K, full insert
           sequence.>gb:CR860881_1184927 Pongo pygmaeus mRNA; cDNA
           DKFZp469J0720 (from clone
           DKFZp469J0720).>gb:AL354733_1923324 Human DNA sequence
           from clone RP11-575L7 on chromosome 9 Contains the 5'
           end of the gene for protein kinase anchoring protein
           GKAP42 (FKSG21), a novel gene (DKFZp43D0917), a novel
           gene (MGC10999), the HNRPK gene for heterogeneous
           nuclear ribonucleoprotein K (CSBP, TUNP, HNRNPK), three
           novel genes, the 5' UTR of a novel gene (FLJ12888) and
           six CpG islands, complete sequence.>gb:BC000355_1966644
           Homo sapiens heterogeneous nuclear ribonucleoprotein K,
           transcript variant 3, mRNA (cDNA clone MGC:8660
           IMAGE:2964383), complete cds.>gb:CR456771_1992978 Homo
           sapiens full open reading frame cDNA clone RZPDo834E024D
           for gene HNRPK, heterogeneous nuclear ribonucleoprotein
           K; complete cds, incl. stopcodon.>gb:BC006694_2090316
           Mus musculus heterogeneous nuclear ribonucleoprotein K,
           mRNA (cDNA clone MGC:6388 IMAGE:3583037), complete
           cds.>gb:BC061867_2104721 Rattus norvegicus heterogeneous
           nuclear ribonucleoprotein K, mRNA (cDNA clone MGC:72338
           IMAGE:5598872), complete cds.>gb:BC089328_2110777 Mus
           musculus heterogeneous nuclear ribonucleoprotein K, mRNA
           (cDNA clone MGC:102032 IMAGE:6402614), complete cds.
          Length = 464

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 20/51 (39%), Positives = 33/51 (64%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           I  ++ +P    G +IGK G RI++IR E+ A+IKI + +   E+R+I I+
Sbjct: 388 ITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITIT 438



 Score = 36.6 bits (83), Expect = 0.35
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 1/62 (1%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHE-ERVIIISSKDNDGT 404
           D   R+++     G +IG  G +I+++RE T+ TIK+      H  +RV++I  K +   
Sbjct: 144 DCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVV 203

Query: 405 FC 410
            C
Sbjct: 204 EC 205



>pir|A54143|A54143 kappa-B motif-binding phosphoprotein - mouse
          Length = 464

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 20/51 (39%), Positives = 33/51 (64%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           I  ++ +P    G +IGK G RI++IR E+ A+IKI + +   E+R+I I+
Sbjct: 388 ITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITIT 438



 Score = 36.6 bits (83), Expect = 0.35
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 1/62 (1%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHE-ERVIIISSKDNDGT 404
           D   R+++     G +IG  G +I+++RE T+ TIK+      H  +RV++I  K +   
Sbjct: 144 DCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVV 203

Query: 405 FC 410
            C
Sbjct: 204 EC 205



>sp|O19049|ROK_RABIT Heterogeneous nuclear ribonucleoprotein K
           (hnRNP K).>gb:OCHNRNPK_1442180 Oryctolagus cuniculus
           mRNA for hnRNP-K protein.
          Length = 463

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 20/51 (39%), Positives = 33/51 (64%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           I  ++ +P    G +IGK G RI++IR E+ A+IKI + +   E+R+I I+
Sbjct: 388 ITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITIT 438



 Score = 36.6 bits (83), Expect = 0.35
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 1/62 (1%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHE-ERVIIISSKDNDGT 404
           D   R+++     G +IG  G +I+++RE T+ TIK+      H  +RV++I  K +   
Sbjct: 144 DCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVV 203

Query: 405 FC 410
            C
Sbjct: 204 EC 205



>sp|P61978|ROK_HUMAN Heterogeneous nuclear ribonucleoprotein K
           (hnRNP K) (Transformation up-regulated nuclear protein)
           (TUNP).>sp|P61979|ROK_MOUSE Heterogeneous nuclear
           ribonucleoprotein K.>sp|P61980|ROK_RAT Heterogeneous
           nuclear ribonucleoprotein K (dC-stretch binding protein)
           (CSBP).>pir|S41495|S41495 dC stretch-binding protein
           CSBP - rat>gb:AK011428_1156394 Mus musculus 10 days
           embryo whole body cDNA, RIKEN full-length enriched
           library, clone:2610016P11 product:heterogeneous nuclear
           ribonucleoprotein K, full insert
           sequence.>gb:AL354733_1923323 Human DNA sequence from
           clone RP11-575L7 on chromosome 9 Contains the 5' end of
           the gene for protein kinase anchoring protein GKAP42
           (FKSG21), a novel gene (DKFZp43D0917), a novel gene
           (MGC10999), the HNRPK gene for heterogeneous nuclear
           ribonucleoprotein K (CSBP, TUNP, HNRNPK), three novel
           genes, the 5' UTR of a novel gene (FLJ12888) and six CpG
           islands, complete sequence.>gb:BC014980_1974874 Homo
           sapiens heterogeneous nuclear ribonucleoprotein K,
           transcript variant 2, mRNA (cDNA clone MGC:23171
           IMAGE:4906241), complete cds.>gb:S74678_2041435
           heterogeneous nuclear ribonucleoprotein complex K
           [human, mRNA, 2302 nt].>gb:RATCSBP_2131916 Rattus
           norvegicus mRNA for dC-stretch binding protein (CSBP),
           complete cds.
          Length = 463

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 20/51 (39%), Positives = 33/51 (64%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           I  ++ +P    G +IGK G RI++IR E+ A+IKI + +   E+R+I I+
Sbjct: 388 ITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITIT 438



 Score = 36.6 bits (83), Expect = 0.35
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 1/62 (1%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHE-ERVIIISSKDNDGT 404
           D   R+++     G +IG  G +I+++RE T+ TIK+      H  +RV++I  K +   
Sbjct: 144 DCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVV 203

Query: 405 FC 410
            C
Sbjct: 204 EC 205



>gb:AY223387_1176847 Schistosoma japonicum clone ZZZ282 mRNA
           sequence.
          Length = 454

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 43/160 (26%), Positives = 68/160 (42%), Gaps = 18/160 (11%)
 Frame = +3

Query: 165 DEAGTSAEVVPPLKKRVKVS-QDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA 341
           D +G + +  P   +R  V   ++  R ++P +  G +IGK G  I+KIR +    + I 
Sbjct: 4   DNSGNNQDGPPTKFQRSSVDLTNVSIRFLIPGRAAGIMIGKGGENIKKIRSQYNVKLNIP 63

Query: 342 DAISRHEERVIIISS--KDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANS 515
           D  SR  ER++ I    +       D    L  I+   L D +  +     GA   P  +
Sbjct: 64  D--SRGPERIMTIEGDLQAICSIMRDVCPKLKDIMNAKLSDPKRIMGTQ--GARRRPRRN 119

Query: 516 ---------------VRFLIAGSQAGGLIGVSGQNIENLR 590
                           R L+  SQAG +IG  G+ I++LR
Sbjct: 120 EDPERDDDEDENMIDFRILVHESQAGSVIGRGGERIKDLR 159



>gb:AY223294_1176755 Schistosoma japonicum clone ZZD545 mRNA
           sequence.
          Length = 265

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 43/160 (26%), Positives = 68/160 (42%), Gaps = 18/160 (11%)
 Frame = +3

Query: 165 DEAGTSAEVVPPLKKRVKVS-QDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA 341
           D +G + +  P   +R  V   ++  R ++P +  G +IGK G  I+KIR +    + I 
Sbjct: 4   DNSGNNQDGPPTKFQRSSVDLTNVSIRFLIPGRAAGIMIGKGGENIKKIRSQYNVKLNIP 63

Query: 342 DAISRHEERVIIISS--KDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANS 515
           D  SR  ER++ I    +       D    L  I+   L D +  +     GA   P  +
Sbjct: 64  D--SRGPERIMTIEGDLQAICSIMRDVCPKLKDIMNAKLSDPKRIMGTQ--GARRRPRRN 119

Query: 516 ---------------VRFLIAGSQAGGLIGVSGQNIENLR 590
                           R L+  SQAG +IG  G+ I++LR
Sbjct: 120 EDPERDDDEDENMIDFRILVHESQAGSVIGRGGERIKDLR 159



>gb:XLA421448_2582574 Xenopus laevis mRNA for hnRNP-E2 protein copy
           b (hnRNP-E2 gene).
          Length = 251

 Score = 42.7 bits (99), Expect = 0.005
 Identities = 21/52 (40%), Positives = 34/52 (65%), Gaps = 1/52 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA-DAISRHEERVIIIS 383
           +  R++VP+ Q G +IGK G +I++IRE T A +++A D +    ER I I+
Sbjct: 30  VTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPNSTERAITIA 81



 Score = 36.6 bits (83), Expect = 0.35
 Identities = 17/54 (31%), Positives = 33/54 (61%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           +Q   + + +P+  IG +IG+ G +I +IR+ + A IKIA+ +    +R + I+
Sbjct: 171 AQATSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSNDRQVTIT 224



>gb:AF042353_2470351 Xenopus laevis KH domain-containing
           transcription factor B3 mRNA, complete
           cds.>gb:AF064633_2471403 Xenopus laevis Vg1 RNA binding
           protein variant A mRNA, complete
           cds.>gb:BC057700_2552173 Xenopus laevis KH
           domain-containing transcription factor B3, mRNA (cDNA
           clone MGC:68429 IMAGE:6862521), complete cds.
          Length = 593

 Score = 42.7 bits (99), Expect = 0.005
 Identities = 34/177 (19%), Positives = 79/177 (44%), Gaps = 2/177 (1%)
 Frame = +3

Query: 93  STEDDPYKSTTAKRRRDEDAFEATDEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGK 272
           +T   P +     +++         + G + +  P    R K   ++  R++VP++ +G 
Sbjct: 159 ATPQSPSQQLQQPQQQHPQGRRGFGQRGPARQGSPGAAARPKPQSEVPLRMLVPTQFVGA 218

Query: 273 VIGKVGHRIQKIREETRATIKI--ADAISRHEERVIIISSKDNDGTFCDAESALHQIVTL 446
           +IGK G  I+ I ++T++ I I   +     E+ + I S+ +     C       +I+  
Sbjct: 219 IIGKEGATIRNITKQTQSKIDIHRKENAGAAEKPITIHSTPEGCSAAC-------KIIME 271

Query: 447 ILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
           I++ +  + +  +     +P   ++ L   +  G LIG  G+N++ +   +   +T+
Sbjct: 272 IMQKEAQDTKFTE----EIP---LKILAHNNFVGRLIGKEGRNLKKIEQDTDTKITI 321



>pir|E84614|E84614 probable RNA-binding protein [imported] -
           Arabidopsis thaliana>gb:AC006340_1534064 Arabidopsis
           thaliana chromosome 2 clone T9I22 map CIC06C07, complete
           sequence.
          Length = 649

 Score = 42.7 bits (99), Expect = 0.005
 Identities = 34/151 (22%), Positives = 63/151 (41%), Gaps = 24/151 (15%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIII------------- 380
           R++  +  IG +IG  G+ + K+R ET   I     ++  +  V+ I             
Sbjct: 28  RVVCHASVIGGIIGSNGYVVSKLRRETGTKIHCESPVNGSDHWVVFIVGSTAVNQSILLT 87

Query: 381 -------SSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVR----FL 527
                    +  D   C+  +A   ++ ++  +    + A K G G V           L
Sbjct: 88  DRVGEFSGGEHEDWVTCEVSAAQTALIRVL--ERSWVVLAAKDGGGVVDGEDEEAYCGIL 145

Query: 528 IAGSQAGGLIGVSGQNIENLRISSGATVTVL 620
              +Q G ++G+ G+N+E +R +SGA + VL
Sbjct: 146 ADRNQIGAVLGLGGKNVEWMRRNSGAMIRVL 176



 Score = 42.0 bits (97), Expect = 0.008
 Identities = 22/67 (32%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDN-DGTF 407
           +V++II  S   G +IGK G  I+ ++ ET A+I +   +    ERV+ +S+++N +  +
Sbjct: 277 VVFKIIFTSVVAGGIIGKQGTIIRALQNETGASISVGAPLKVSGERVVTVSARENLESRY 336

Query: 408 CDAESAL 428
             A++AL
Sbjct: 337 SHAQNAL 343



>gb:BC054552_2101757 Mus musculus RIKEN cDNA C330012H03 gene, mRNA
           (cDNA clone MGC:62421 IMAGE:6409096), complete cds.
          Length = 545

 Score = 42.4 bits (98), Expect = 0.006
 Identities = 34/133 (25%), Positives = 65/133 (48%), Gaps = 3/133 (2%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI--ADAISRHEERVIIISSKDNDG 401
           D   RI+VP++ +G +IGK G  I+ I ++T++ + I   +     E+ V I ++ +   
Sbjct: 185 DFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTS 244

Query: 402 TFCDAESALHQIVTLILKD-DESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNI 578
             C        I+ ++ K+ DE+ +      A  VP   ++ L      G LIG  G+N+
Sbjct: 245 EAC------RMILEIMQKEADETKL------AEEVP---LKILAHNGFVGRLIGKEGRNL 289

Query: 579 ENLRISSGATVTV 617
           + +   +G  +T+
Sbjct: 290 KKIEHETGTKITI 302



 Score = 32.7 bits (73), Expect = 5.1
 Identities = 17/48 (35%), Positives = 30/48 (62%), Gaps = 1/48 (2%)
 Frame = +3

Query: 243 IIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRH-EERVIIIS 383
           + +P++ +G +IGK G  I+++     A+IKIA A      ER++II+
Sbjct: 424 LFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIIT 471



>gb:AY531659_2086245 Mus musculus insulin-like growth factor 2
           mRNA-binding protein 2 (Imp2) mRNA, complete cds.
          Length = 592

 Score = 42.4 bits (98), Expect = 0.006
 Identities = 34/133 (25%), Positives = 65/133 (48%), Gaps = 3/133 (2%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI--ADAISRHEERVIIISSKDNDG 401
           D   RI+VP++ +G +IGK G  I+ I ++T++ + I   +     E+ V I ++ +   
Sbjct: 186 DFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTS 245

Query: 402 TFCDAESALHQIVTLILKD-DESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNI 578
             C        I+ ++ K+ DE+ +      A  VP   ++ L      G LIG  G+N+
Sbjct: 246 EAC------RMILEIMQKEADETKL------AEEVP---LKILAHNGFVGRLIGKEGRNL 290

Query: 579 ENLRISSGATVTV 617
           + +   +G  +T+
Sbjct: 291 KKIEHETGTKITI 303



 Score = 34.3 bits (77), Expect = 1.8
 Identities = 29/125 (23%), Positives = 56/125 (44%)
 Frame = +3

Query: 243 IIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAES 422
           + +P++ +G +IGK G  I+++     A+IKIA A        ++I +   +  F     
Sbjct: 425 LFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITGPPEAQF----K 480

Query: 423 ALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSG 602
           A  +I   + +++  N +       H+        +  S AG +IG  G+ +  L+  + 
Sbjct: 481 AQGRIFGKLKEENFFNPKEEVKLEAHI-------RVPSSTAGRVIGKGGKTVNELQNLTS 533

Query: 603 ATVTV 617
           A V V
Sbjct: 534 AEVIV 538



>gb:AF117107_1884607 Homo sapiens IGF-II mRNA-binding protein 2
           (IMP-2) mRNA, complete cds.>gb:BC021290_1977479 Homo
           sapiens IGF-II mRNA-binding protein 2, mRNA (cDNA clone
           MGC:29539 IMAGE:5090334), complete cds.
          Length = 598

 Score = 42.4 bits (98), Expect = 0.006
 Identities = 33/133 (24%), Positives = 65/133 (48%), Gaps = 3/133 (2%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI--ADAISRHEERVIIISSKDNDG 401
           D   RI+VP++ +G +IGK G  I+ I ++T++ + I   +     E+ V I ++ +   
Sbjct: 192 DFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTS 251

Query: 402 TFCDAESALHQIVTLILKD-DESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNI 578
             C        I+ ++ K+ DE+ +      A  +P   ++ L      G LIG  G+N+
Sbjct: 252 EAC------RMILEIMQKEADETKL------AEEIP---LKILAHNGLVGRLIGKEGRNL 296

Query: 579 ENLRISSGATVTV 617
           + +   +G  +T+
Sbjct: 297 KKIEHETGTKITI 309



 Score = 35.4 bits (80), Expect = 0.79
 Identities = 32/131 (24%), Positives = 60/131 (45%)
 Frame = +3

Query: 225 QDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGT 404
           Q+IV  + +P++ +G +IGK G  I+++     A+IKIA A        ++I +   +  
Sbjct: 426 QEIV-NLFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITGPPEAQ 484

Query: 405 FCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIEN 584
           F     A  +I   + +++  N +       H+        +  S AG +IG  G+ +  
Sbjct: 485 F----KAQGRIFGKLKEENFFNPKEEVKLEAHI-------RVPSSTAGRVIGKGGKTVNE 533

Query: 585 LRISSGATVTV 617
           L+  + A V V
Sbjct: 534 LQNLTSAEVIV 544



>gb:AF057352_1879624 Homo sapiens hepatocellular carcinoma
           autoantigen (p62) mRNA, complete cds.
          Length = 556

 Score = 42.4 bits (98), Expect = 0.006
 Identities = 33/133 (24%), Positives = 65/133 (48%), Gaps = 3/133 (2%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI--ADAISRHEERVIIISSKDNDG 401
           D   RI+VP++ +G +IGK G  I+ I ++T++ + I   +     E+ V I ++ +   
Sbjct: 193 DFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTS 252

Query: 402 TFCDAESALHQIVTLILKD-DESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNI 578
             C        I+ ++ K+ DE+ +      A  +P   ++ L      G LIG  G+N+
Sbjct: 253 EAC------RMILEIMQKEADETKL------AEEIP---LKILAHNGLVGRLIGKEGRNL 297

Query: 579 ENLRISSGATVTV 617
           + +   +G  +T+
Sbjct: 298 KKIEHETGTKITI 310



 Score = 35.4 bits (80), Expect = 0.79
 Identities = 32/131 (24%), Positives = 60/131 (45%)
 Frame = +3

Query: 225 QDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGT 404
           Q+IV  + +P++ +G +IGK G  I+++     A+IKIA A        ++I +   +  
Sbjct: 384 QEIV-NLFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITGPPEAQ 442

Query: 405 FCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIEN 584
           F     A  +I   + +++  N +       H+        +  S AG +IG  G+ +  
Sbjct: 443 F----KAQGRIFGKLKEENFFNPKEEVKLEAHI-------RVPSSTAGRVIGKGGKTVNE 491

Query: 585 LRISSGATVTV 617
           L+  + A V V
Sbjct: 492 LQNLTSAEVIV 502



>gb:CR858786_1182937 Pongo pygmaeus mRNA; cDNA DKFZp468I2113 (from
           clone DKFZp468I2113).
          Length = 556

 Score = 42.4 bits (98), Expect = 0.006
 Identities = 33/133 (24%), Positives = 65/133 (48%), Gaps = 3/133 (2%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI--ADAISRHEERVIIISSKDNDG 401
           D   RI+VP++ +G +IGK G  I+ I ++T++ + I   +     E+ V I ++ +   
Sbjct: 193 DFPLRILVPTQFVGAIIGKEGLTIKNITKQTQSRVDIHRKENSGAAEKPVTIHATPEGTS 252

Query: 402 TFCDAESALHQIVTLILKD-DESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNI 578
             C        I+ ++ K+ DE+ +      A  +P   ++ L      G LIG  G+N+
Sbjct: 253 EAC------RMILEIMQKEADETKL------AEEIP---LKILAHNGLVGRLIGKEGRNL 297

Query: 579 ENLRISSGATVTV 617
           + +   +G  +T+
Sbjct: 298 KKIEHETGTKITI 310



 Score = 35.4 bits (80), Expect = 0.79
 Identities = 32/131 (24%), Positives = 60/131 (45%)
 Frame = +3

Query: 225 QDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGT 404
           Q+IV  + +P++ +G +IGK G  I+++     A+IKIA A        ++I +   +  
Sbjct: 384 QEIV-NLFIPTQAVGAIIGKKGAHIKQLARFAGASIKIAPAEGPDVSERMVIITGPPEAQ 442

Query: 405 FCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIEN 584
           F     A  +I   + +++  N +       H+        +  S AG +IG  G+ +  
Sbjct: 443 F----KAQGRIFGKLKEENFFNPKEEVKLEAHI-------RVPSSTAGRVIGKGGKTVNE 491

Query: 585 LRISSGATVTV 617
           L+  + A V V
Sbjct: 492 LQNLTSAEVIV 502



>sp|P38151|PBP2_YEAST PAB1-binding protein 2.>pir|S46109|S46109
           hnRNP complex protein homolog YBR233w - yeast
           (Saccharomyces cerevisiae)>gb:SCYBR232C_1711474
           S.cerevisiae chromosome II reading frame ORF YBR232c.
          Length = 413

 Score = 42.4 bits (98), Expect = 0.006
 Identities = 43/171 (25%), Positives = 68/171 (39%), Gaps = 10/171 (5%)
 Frame = +3

Query: 123 TAKRRRDEDAFEATDEAGTSAEVVPPLKKRV--------KVSQDIVYRIIVPSKQIGKVI 278
           T KR++ ED  E   EA      +                V  D+  R++   K    ++
Sbjct: 23  TLKRKKGEDTSEEQLEAEIKRVALKDADSHSDNDHDSPDNVPSDVHLRMLCLVKHASLIV 82

Query: 279 GKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKD 458
           G  G  I +I+ ET A I I++ I    ER++ +      GT  D   A   IV  +L++
Sbjct: 83  GHKGATISRIKSETSARINISNNIRGVPERIVYVR-----GTCDDVAKAYGMIVRALLEE 137

Query: 459 --DESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGA 605
             +E N E ++         S+  LI     G +IG  G  +  +   S A
Sbjct: 138 HGNEDNGEDIEI--------SINLLIPHHLMGCIIGKRGSRLREIEDLSAA 180



>gb:AP004020_1836484 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1119_A01.>gb:AP004878_1846479 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0474F11.
          Length = 343

 Score = 42.0 bits (97), Expect = 0.008
 Identities = 35/135 (25%), Positives = 63/135 (46%), Gaps = 6/135 (4%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHE------ERVIIISSKDNDG 401
           R +V +   G +IGK G  I + + ++ A I+++ +   HE      +R+I++S     G
Sbjct: 44  RFLVSNTAAGCIIGKGGSTINEFQSQSGARIQLSRS---HEFFPGTNDRIIMVS-----G 95

Query: 402 TFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIE 581
            F +   A+  I+  +L + E + EA            VR ++  S  GG+IG  G  I+
Sbjct: 96  LFDEVIKAMELILEKLLAEGEESNEAEARP-------KVRLVVPNSSCGGIIGKGGSTIK 148

Query: 582 NLRISSGATVTVLAQ 626
           +    S A + +  Q
Sbjct: 149 SFIEDSHAGIKISPQ 163



 Score = 32.3 bits (72), Expect = 6.7
 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 4/56 (7%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA----DAISRHEERVIIISSKDN 395
           R++VP+   G +IGK G  I+   E++ A IKI+    + +  H+  V +    D+
Sbjct: 128 RLVVPNSSCGGIIGKGGSTIKSFIEDSHAGIKISPQDNNFVGLHDRLVTVTGPLDH 183



>gb:CR380957_1652820 Candida glabrata strain CBS138 chromosome K
           complete sequence.
          Length = 460

 Score = 42.0 bits (97), Expect = 0.008
 Identities = 34/139 (24%), Positives = 59/139 (42%), Gaps = 11/139 (7%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDG 401
           SQDI  R++   KQ   ++G  G  I K++E+T   I ++  I    ERVI +      G
Sbjct: 78  SQDISLRMLCLVKQASIIVGPKGESINKLKEQTSTKINVSPNIRGVPERVIHVK-----G 132

Query: 402 TFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANS-----------VRFLIAGSQAG 548
           +  +   A  +I  +I++ D  N     + +    A+            +  LI+ +  G
Sbjct: 133 SCENVGKAFGKIARIIIEKDSKNNANQSSSSLDSEASQNSSDAEDTTLILNLLISHALMG 192

Query: 549 GLIGVSGQNIENLRISSGA 605
            +IG  G  +  +   S A
Sbjct: 193 SVIGKGGSQLREIEERSAA 211



>gb:AK088465_1175421 Mus musculus 2 days neonate thymus thymic cells
           cDNA, RIKEN full-length enriched library,
           clone:E430018F06 product:insulin-like growth factor 2,
           binding protein 3, full insert sequence.
          Length = 579

 Score = 42.0 bits (97), Expect = 0.008
 Identities = 32/152 (21%), Positives = 73/152 (48%), Gaps = 2/152 (1%)
 Frame = +3

Query: 168 EAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI--A 341
           + G+S +  P    + K   D+  R++VP++ +G +IGK G  I+ I ++T++ I +   
Sbjct: 176 QRGSSRQASPGSVSKQKPC-DLPLRLLVPTQFVGAIIGKEGATIRNITKQTQSKIDVHRK 234

Query: 342 DAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVR 521
           +     E+ + I+S+ +     C +       +  I+  +  +I+  +     +P   ++
Sbjct: 235 ENTGAAEKSITILSTPEGTSAACKS-------ILEIMHKEAQDIKFTE----EIP---LK 280

Query: 522 FLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
            L   +  G LIG  G+N++ +   +   +T+
Sbjct: 281 ILAHNNFVGRLIGKEGRNLKKIEQDTDTKITI 312



 Score = 37.4 bits (85), Expect = 0.21
 Identities = 35/152 (23%), Positives = 69/152 (45%), Gaps = 3/152 (1%)
 Frame = +3

Query: 171 AGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAI 350
           +G  + + PP  +  +   + V+ + +P+  +G +IGK G  I+++     A+IKIA A 
Sbjct: 387 SGPPSTLTPPYPQFEQSETETVH-LFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAE 445

Query: 351 SRHEERVIIISSKDNDGTFCDAESALHQIV---TLILKDDESNIEAMKAGAGHVPANSVR 521
           +   +  ++I +   +  F  A+  ++  +     +   +E  +EA      H+   S  
Sbjct: 446 APDAKVRMVIITGPPEAQF-KAQGRIYGKIKEENFVSPKEEVKLEA------HIRVPSF- 497

Query: 522 FLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
                  AG +IG  G+ +  L+  S A V V
Sbjct: 498 ------AAGRVIGKGGKTVNELQSLSSAEVVV 523



>gb:AK011689_1156543 Mus musculus 10 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2610036B18
           product:insulin-like growth factor 2, binding protein 3,
           full insert sequence.>gb:AB046173_2046039 Mus musculus
           mimp3 mRNA for igf2 mRNA-binding protein 3, complete
           cds.>gb:BC045138_2099071 Mus musculus insulin-like
           growth factor 2, binding protein 3, mRNA (cDNA clone
           MGC:54494 IMAGE:6306448), complete
           cds.>gb:BC049082_2099902 Mus musculus insulin-like
           growth factor 2, binding protein 3, mRNA (cDNA clone
           MGC:61294 IMAGE:5706238), complete cds.
          Length = 579

 Score = 42.0 bits (97), Expect = 0.008
 Identities = 32/152 (21%), Positives = 73/152 (48%), Gaps = 2/152 (1%)
 Frame = +3

Query: 168 EAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI--A 341
           + G+S +  P    + K   D+  R++VP++ +G +IGK G  I+ I ++T++ I +   
Sbjct: 176 QRGSSRQASPGSVSKQKPC-DLPLRLLVPTQFVGAIIGKEGATIRNITKQTQSKIDVHRK 234

Query: 342 DAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVR 521
           +     E+ + I+S+ +     C +       +  I+  +  +I+  +     +P   ++
Sbjct: 235 ENTGAAEKSITILSTPEGTSAACKS-------ILEIMHKEAQDIKFTE----EIP---LK 280

Query: 522 FLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
            L   +  G LIG  G+N++ +   +   +T+
Sbjct: 281 ILAHNNFVGRLIGKEGRNLKKIEQDTDTKITI 312



 Score = 37.4 bits (85), Expect = 0.21
 Identities = 35/152 (23%), Positives = 69/152 (45%), Gaps = 3/152 (1%)
 Frame = +3

Query: 171 AGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAI 350
           +G  + + PP  +  +   + V+ + +P+  +G +IGK G  I+++     A+IKIA A 
Sbjct: 387 SGPPSTLTPPYPQFEQSETETVH-LFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAE 445

Query: 351 SRHEERVIIISSKDNDGTFCDAESALHQIV---TLILKDDESNIEAMKAGAGHVPANSVR 521
           +   +  ++I +   +  F  A+  ++  +     +   +E  +EA      H+   S  
Sbjct: 446 APDAKVRMVIITGPPEAQF-KAQGRIYGKIKEENFVSPKEEVKLEA------HIRVPSF- 497

Query: 522 FLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
                  AG +IG  G+ +  L+  S A V V
Sbjct: 498 ------AAGRVIGKGGKTVNELQSLSSAEVVV 523



>gb:AF055923_2470970 Xenopus laevis RNA binding protein Vera mRNA,
           complete cds.>gb:AF064634_2471404 Xenopus laevis Vg1 RNA
           binding protein variant D mRNA, complete cds.
          Length = 594

 Score = 41.6 bits (96), Expect = 0.011
 Identities = 32/152 (21%), Positives = 72/152 (47%), Gaps = 2/152 (1%)
 Frame = +3

Query: 168 EAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI--A 341
           + G + +  P    R K   ++  R++VP++ +G +IGK G  I+ I ++T++ I I   
Sbjct: 185 QRGPARQGSPGAAARPKPQTEVPLRMLVPTQFVGAIIGKEGATIRNITKQTQSKIDIHRK 244

Query: 342 DAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVR 521
           +     E+ + I S+ +     C       +I+  I++ +  + +  +     +P   ++
Sbjct: 245 ENAGAAEKPITIHSTPEGCSAAC-------KIIMEIMQKEAQDTKFTE----EIP---LK 290

Query: 522 FLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
            L   +  G LIG  G+N++ +   +   +T+
Sbjct: 291 ILAHNNFVGRLIGKEGRNLKKIEQDTDTKITI 322



>gb:AF026527_2469215 Gallus gallus zipcode-binding protein (ZBP1)
           mRNA, complete cds.
          Length = 576

 Score = 41.2 bits (95), Expect = 0.014
 Identities = 40/184 (21%), Positives = 75/184 (40%), Gaps = 40/184 (21%)
 Frame = +3

Query: 186 EVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA---DAISR 356
           E++    K  K + ++  +I+  +  +G++IGK G  ++K+ ++T   I I+   D    
Sbjct: 262 EIMQKEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNLKKVEQDTETKITISSLQDLTLY 321

Query: 357 HEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMK-----------AGAGHV 503
           + ER I +  K +    C AE    +I+  + +  E+++ AM            A  G  
Sbjct: 322 NPERTITV--KGSIENCCKAEQ---EIMKKVREAYENDVAAMSLQSHLIPGLNLAAVGLF 376

Query: 504 PANS--------------------------VRFLIAGSQAGGLIGVSGQNIENLRISSGA 605
           PA+S                          V   I     G +IG  GQ+I+ L   + A
Sbjct: 377 PASSNAVPPPPSSVSGAAPYSSFMPPEQETVHVFIPAQAVGAIIGKKGQHIKQLSRFASA 436

Query: 606 TVTV 617
           ++ +
Sbjct: 437 SIKI 440



 Score = 41.2 bits (95), Expect = 0.014
 Identities = 32/132 (24%), Positives = 64/132 (48%), Gaps = 2/132 (1%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI--ADAISRHEERVIIISSKDNDG 401
           DI  R++VP++ +G +IGK G  I+ I ++T++ I +   +     E+ + I S+ +   
Sbjct: 195 DIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAAEKAISIHSTPEGCS 254

Query: 402 TFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIE 581
             C     + +I+    KD ++        A  VP   ++ L   +  G LIG  G+N++
Sbjct: 255 AAC---KMILEIMQKEAKDTKT--------ADEVP---LKILAHNNFVGRLIGKEGRNLK 300

Query: 582 NLRISSGATVTV 617
            +   +   +T+
Sbjct: 301 KVEQDTETKITI 312



 Score = 33.5 bits (75), Expect = 3.0
 Identities = 32/147 (21%), Positives = 62/147 (42%)
 Frame = +3

Query: 177 TSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISR 356
           +S     P    +   Q+ V+ + +P++ +G +IGK G  I+++     A+IKIA   + 
Sbjct: 388 SSVSGAAPYSSFMPPEQETVH-VFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPETP 446

Query: 357 HEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAG 536
             +  +++ +   +  F  A+  ++       K  E N      G            +  
Sbjct: 447 DSKVRMVVITGPPEAQF-KAQGRIYG------KLKEENF----FGPKEEVKLETHIRVPA 495

Query: 537 SQAGGLIGVSGQNIENLRISSGATVTV 617
           S AG +IG  G+ +  L+  + A V V
Sbjct: 496 SAAGRVIGKGGKTVNELQNLTAAEVVV 522



>gb:HSU69127_2025685 Human FUSE binding protein 3 (FBP3) mRNA,
           partial cds.
          Length = 600

 Score = 41.2 bits (95), Expect = 0.014
 Identities = 35/129 (27%), Positives = 61/129 (47%), Gaps = 5/129 (3%)
 Frame = +3

Query: 249 VPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAESAL 428
           VP K +G +IG+ G +I +I+ E+   I+IA   S   ER  +++      +   A+  L
Sbjct: 112 VPDKMVGFIIGRGGEQISRIQAESGCKIQIASESSGIPERPCVLTGTPE--SIEQAKRLL 169

Query: 429 HQIVTLILKDDESNIEAMKAGAG---HVPANSV--RFLIAGSQAGGLIGVSGQNIENLRI 593
            QIV           +  + G G    + +NS     LI  S+ G +IG  G+ I+ L+ 
Sbjct: 170 GQIV-----------DRCRNGPGFHNDIDSNSTIQEILIPASKVGLVIGRGGETIKQLQE 218

Query: 594 SSGATVTVL 620
            +G  + ++
Sbjct: 219 RTGVKMVMI 227



 Score = 36.6 bits (83), Expect = 0.35
 Identities = 28/138 (20%), Positives = 66/138 (47%), Gaps = 8/138 (5%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRA-TIKIADA-ISRHEERVIIISSKDN 395
           S   +  I++P+ ++G VIG+ G  I++++E T    + I D  +    ++ + I+    
Sbjct: 188 SNSTIQEILIPASKVGLVIGRGGETIKQLQERTGVKMVMIQDGPLPTGADKPLRIT---- 243

Query: 396 DGTFCDAESALHQIVTLILKDDESNIEAMKA------GAGHVPANSVRFLIAGSQAGGLI 557
            G     + A   ++ +I + D+++   ++       G G +  +  RF +     G +I
Sbjct: 244 -GDAFKVQQAREMVLEIIREKDQADFRGVRGDFNSRMGGGSIEVSVPRFAV-----GIVI 297

Query: 558 GVSGQNIENLRISSGATV 611
           G +G+ I+ ++  +G  +
Sbjct: 298 GRNGEMIKKIQNDAGVRI 315



 Score = 34.3 bits (77), Expect = 1.8
 Identities = 37/138 (26%), Positives = 56/138 (40%), Gaps = 15/138 (10%)
 Frame = +3

Query: 243 IIVPSKQIGKVIGKVGHRIQKIREET--RATIKIADAISRHEERVIIISSKDNDGTFCDA 416
           + VP   +G VIG+ G  I+KI+ +   R   K  D IS  E    ++   D        
Sbjct: 286 VSVPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGISP-ERAAQVMGPPDR------C 338

Query: 417 ESALHQIVTLILKDDESN-----IEAMKAGAGHVP--------ANSVRFLIAGSQAGGLI 557
           + A H I  LIL   E +       A   G G              + + +   + G +I
Sbjct: 339 QHAAHIISELILTAQERDGFGGLAAARGRGRGRGDWSVGAPGGVQEITYTVPADKCGLVI 398

Query: 558 GVSGQNIENLRISSGATV 611
           G  G+NI+++   SGA V
Sbjct: 399 GKGGENIKSINQQSGAHV 416



>gb:AL353695_1922945 Human DNA sequence from clone RP11-17L7 on
           chromosome 9 Contains the 5' end of the FUBP3 gene for
           far upstream element (FUSE) binding protein 3 (FBP3) and
           a CpG island, complete sequence.>gb:BC007874_1971059
           Homo sapiens far upstream element (FUSE) binding protein
           3, mRNA (cDNA clone MGC:14157 IMAGE:3957939), complete
           cds.
          Length = 261

 Score = 41.2 bits (95), Expect = 0.014
 Identities = 35/129 (27%), Positives = 61/129 (47%), Gaps = 5/129 (3%)
 Frame = +3

Query: 249 VPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAESAL 428
           VP K +G +IG+ G +I +I+ E+   I+IA   S   ER  +++      +   A+  L
Sbjct: 24  VPDKMVGFIIGRGGEQISRIQAESGCKIQIASESSGIPERPCVLTGTPE--SIEQAKRLL 81

Query: 429 HQIVTLILKDDESNIEAMKAGAG---HVPANSV--RFLIAGSQAGGLIGVSGQNIENLRI 593
            QIV           +  + G G    + +NS     LI  S+ G +IG  G+ I+ L+ 
Sbjct: 82  GQIV-----------DRCRNGPGFHNDIDSNSTIQEILIPASKVGLVIGRGGETIKQLQE 130

Query: 594 SSGATVTVL 620
            +G  + ++
Sbjct: 131 RTGVKMVMI 139



 Score = 36.6 bits (83), Expect = 0.35
 Identities = 28/138 (20%), Positives = 66/138 (47%), Gaps = 8/138 (5%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRA-TIKIADA-ISRHEERVIIISSKDN 395
           S   +  I++P+ ++G VIG+ G  I++++E T    + I D  +    ++ + I+    
Sbjct: 100 SNSTIQEILIPASKVGLVIGRGGETIKQLQERTGVKMVMIQDGPLPTGADKPLRIT---- 155

Query: 396 DGTFCDAESALHQIVTLILKDDESNIEAMKA------GAGHVPANSVRFLIAGSQAGGLI 557
            G     + A   ++ +I + D+++   ++       G G +  +  RF +     G +I
Sbjct: 156 -GDAFKVQQAREMVLEIIREKDQADFRGVRGDFNSRMGGGSIEVSVPRFAV-----GIVI 209

Query: 558 GVSGQNIENLRISSGATV 611
           G +G+ I+ ++  +G  +
Sbjct: 210 GRNGEMIKKIQNDAGVRI 227



>gb:AF117108_1884608 Homo sapiens IGF-II mRNA-binding protein 3
           (IMP-3) mRNA, complete cds.>gb:BC065269_1986795 Homo
           sapiens IGF-II mRNA-binding protein 3, mRNA (cDNA clone
           MGC:75347 IMAGE:6154021), complete cds.
          Length = 579

 Score = 41.2 bits (95), Expect = 0.014
 Identities = 28/132 (21%), Positives = 65/132 (49%), Gaps = 2/132 (1%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI--ADAISRHEERVIIISSKDNDG 401
           D+  R++VP++ +G +IGK G  I+ I ++T++ I +   +     E+ + I+S+ +   
Sbjct: 195 DLPLRLLVPTQFVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAAEKSITILSTPEGTS 254

Query: 402 TFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIE 581
             C +       +  I+  +  +I+  +     +P   ++ L   +  G LIG  G+N++
Sbjct: 255 AACKS-------ILEIMHKEAQDIKFTE----EIP---LKILAHNNFVGRLIGKEGRNLK 300

Query: 582 NLRISSGATVTV 617
            +   +   +T+
Sbjct: 301 KIEQDTDTKITI 312



 Score = 37.0 bits (84), Expect = 0.27
 Identities = 35/152 (23%), Positives = 69/152 (45%), Gaps = 3/152 (1%)
 Frame = +3

Query: 171 AGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAI 350
           +G  + + PP  +  +   + V+ + +P+  +G +IGK G  I+++     A+IKIA A 
Sbjct: 387 SGPPSAMTPPYPQFEQSETETVH-LFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAE 445

Query: 351 SRHEERVIIISSKDNDGTFCDAESALHQIV---TLILKDDESNIEAMKAGAGHVPANSVR 521
           +   +  ++I +   +  F  A+  ++  +     +   +E  +EA      H+   S  
Sbjct: 446 APDAKVRMVIITGPPEAQF-KAQGRIYGKIKEENFVSPKEEVKLEA------HIRVPSF- 497

Query: 522 FLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
                  AG +IG  G+ +  L+  S A V V
Sbjct: 498 ------AAGRVIGKGGKTVNELQNLSSAEVVV 523



>gb:AX397963_1467054 Sequence 1 from Patent
           WO0220036.>gb:HSU76705_2026060 Human putative RNA
           binding protein Koc1 mRNA, complete
           cds.>gb:HSU97188_2027825 Homo sapiens putative RNA
           binding protein KOC (koc) mRNA, complete cds.
          Length = 579

 Score = 41.2 bits (95), Expect = 0.014
 Identities = 28/132 (21%), Positives = 65/132 (49%), Gaps = 2/132 (1%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI--ADAISRHEERVIIISSKDNDG 401
           D+  R++VP++ +G +IGK G  I+ I ++T++ I +   +     E+ + I+S+ +   
Sbjct: 195 DLPLRLLVPTQFVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAAEKSITILSTPEGTS 254

Query: 402 TFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIE 581
             C +       +  I+  +  +I+  +     +P   ++ L   +  G LIG  G+N++
Sbjct: 255 AACKS-------ILEIMHKEAQDIKFTE----EIP---LKILAHNNFVGRLIGKEGRNLK 300

Query: 582 NLRISSGATVTV 617
            +   +   +T+
Sbjct: 301 KIEQDTDTKITI 312



 Score = 37.0 bits (84), Expect = 0.27
 Identities = 36/152 (23%), Positives = 69/152 (45%), Gaps = 3/152 (1%)
 Frame = +3

Query: 171 AGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAI 350
           +G  + + PP  +  +   + V++ I P+  +G +IGK G  I+++     A+IKIA A 
Sbjct: 387 SGPPSAMTPPYPQFEQSETETVHQFI-PALSVGAIIGKQGQHIKQLSRFAGASIKIAPAE 445

Query: 351 SRHEERVIIISSKDNDGTFCDAESALHQIV---TLILKDDESNIEAMKAGAGHVPANSVR 521
           +   +  ++I +   +  F  A+  ++  +     +   +E  +EA      H+   S  
Sbjct: 446 APDAKVRMVIITGPPEAQF-KAQGRIYGKIKEENFVSPKEEVKLEA------HIRVPSF- 497

Query: 522 FLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
                  AG +IG  G+ +  L+  S A V V
Sbjct: 498 ------AAGRVIGKGGKTVNELQNLSSAEVVV 523



>sp|Q96I24|FUB3_HUMAN Far upstream element binding protein 3 (FUSE
           binding protein 3).>gb:AL353695_1922944 Human DNA
           sequence from clone RP11-17L7 on chromosome 9 Contains
           the 5' end of the FUBP3 gene for far upstream element
           (FUSE) binding protein 3 (FBP3) and a CpG island,
           complete sequence.
          Length = 572

 Score = 41.2 bits (95), Expect = 0.014
 Identities = 35/129 (27%), Positives = 61/129 (47%), Gaps = 5/129 (3%)
 Frame = +3

Query: 249 VPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAESAL 428
           VP K +G +IG+ G +I +I+ E+   I+IA   S   ER  +++      +   A+  L
Sbjct: 84  VPDKMVGFIIGRGGEQISRIQAESGCKIQIASESSGIPERPCVLTGTPE--SIEQAKRLL 141

Query: 429 HQIVTLILKDDESNIEAMKAGAG---HVPANSV--RFLIAGSQAGGLIGVSGQNIENLRI 593
            QIV           +  + G G    + +NS     LI  S+ G +IG  G+ I+ L+ 
Sbjct: 142 GQIV-----------DRCRNGPGFHNDIDSNSTIQEILIPASKVGLVIGRGGETIKQLQE 190

Query: 594 SSGATVTVL 620
            +G  + ++
Sbjct: 191 RTGVKMVMI 199



 Score = 36.6 bits (83), Expect = 0.35
 Identities = 28/138 (20%), Positives = 66/138 (47%), Gaps = 8/138 (5%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRA-TIKIADA-ISRHEERVIIISSKDN 395
           S   +  I++P+ ++G VIG+ G  I++++E T    + I D  +    ++ + I+    
Sbjct: 160 SNSTIQEILIPASKVGLVIGRGGETIKQLQERTGVKMVMIQDGPLPTGADKPLRIT---- 215

Query: 396 DGTFCDAESALHQIVTLILKDDESNIEAMKA------GAGHVPANSVRFLIAGSQAGGLI 557
            G     + A   ++ +I + D+++   ++       G G +  +  RF +     G +I
Sbjct: 216 -GDAFKVQQAREMVLEIIREKDQADFRGVRGDFNSRMGGGSIEVSVPRFAV-----GIVI 269

Query: 558 GVSGQNIENLRISSGATV 611
           G +G+ I+ ++  +G  +
Sbjct: 270 GRNGEMIKKIQNDAGVRI 287



 Score = 34.3 bits (77), Expect = 1.8
 Identities = 37/138 (26%), Positives = 56/138 (40%), Gaps = 15/138 (10%)
 Frame = +3

Query: 243 IIVPSKQIGKVIGKVGHRIQKIREET--RATIKIADAISRHEERVIIISSKDNDGTFCDA 416
           + VP   +G VIG+ G  I+KI+ +   R   K  D IS  E    ++   D        
Sbjct: 258 VSVPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGISP-ERAAQVMGPPDR------C 310

Query: 417 ESALHQIVTLILKDDESN-----IEAMKAGAGHVP--------ANSVRFLIAGSQAGGLI 557
           + A H I  LIL   E +       A   G G              + + +   + G +I
Sbjct: 311 QHAAHIISELILTAQERDGFGGLAAARGRGRGRGDWSVGAPGGVQEITYTVPADKCGLVI 370

Query: 558 GVSGQNIENLRISSGATV 611
           G  G+NI+++   SGA V
Sbjct: 371 GKGGENIKSINQQSGAHV 388



>gb:AF541940_2067917 Rattus norvegicus b-actin zipcode binding
           protein 1 mRNA, complete cds.
          Length = 577

 Score = 40.8 bits (94), Expect = 0.019
 Identities = 31/132 (23%), Positives = 65/132 (49%), Gaps = 2/132 (1%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI--ADAISRHEERVIIISSKDNDG 401
           DI  R++VP++ +G +IGK G  I+ I ++T++ I +   +     E+ + + S+ +   
Sbjct: 195 DIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAAEKAISVHSTPEGCS 254

Query: 402 TFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIE 581
           + C     + +I+    KD ++        A  VP   ++ L   +  G LIG  G+N++
Sbjct: 255 SAC---KMILEIMHKEAKDTKT--------ADEVP---LKILAHNNFVGRLIGKEGRNLK 300

Query: 582 NLRISSGATVTV 617
            +   +   +T+
Sbjct: 301 KVEQDTETKITI 312



 Score = 40.0 bits (92), Expect = 0.032
 Identities = 45/217 (20%), Positives = 86/217 (39%), Gaps = 46/217 (21%)
 Frame = +3

Query: 105 DPYKSTTAKRRRDEDAFEATDEAGTSA-----EVVPPLKKRVKVSQDIVYRIIVPSKQIG 269
           D ++   A       +  +T E  +SA     E++    K  K + ++  +I+  +  +G
Sbjct: 230 DVHRKENAGAAEKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKILAHNNFVG 289

Query: 270 KVIGKVGHRIQKIREETRATIKIA---DAISRHEERVIIISSKDNDGTFCDAESALHQIV 440
           ++IGK G  ++K+ ++T   I I+   D    + ER I +     +   C AE    +I+
Sbjct: 290 RLIGKEGRNLKKVEQDTETKITISSLQDLTLYNPERTITVKGAIEN--CCRAEQ---EIM 344

Query: 441 TLILKDDESNIEAMK-----------AGAGHVPANS------------------------ 515
             + +  E+++ AM            A  G  PA+S                        
Sbjct: 345 KKVREAYENDVAAMSLQSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYGSFMQAPE 404

Query: 516 ---VRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
              V+  I     G +IG  GQ+I+ L   + A++ +
Sbjct: 405 QEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKI 441



 Score = 33.5 bits (75), Expect = 3.0
 Identities = 29/140 (20%), Positives = 60/140 (42%)
 Frame = +3

Query: 198 PLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVII 377
           P    ++  +  + ++ +P++ +G +IGK G  I+++     A+IKIA   +   +  ++
Sbjct: 395 PYGSFMQAPEQEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPETPDSKVRMV 454

Query: 378 ISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLI 557
           + +   +  F  A+  ++       K  E N      G            +  S AG +I
Sbjct: 455 VITGPPEAQF-KAQGRIYG------KLKEENF----FGPKEEVKLETHIRVPASAAGRVI 503

Query: 558 GVSGQNIENLRISSGATVTV 617
           G  G+ +  L+  + A V V
Sbjct: 504 GKGGKTVNELQNLTAAEVVV 523



>gb:AF117106_1884606 Homo sapiens IGF-II mRNA-binding protein 1
           (IMP-1) mRNA, complete cds.
          Length = 577

 Score = 40.8 bits (94), Expect = 0.019
 Identities = 31/132 (23%), Positives = 65/132 (49%), Gaps = 2/132 (1%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI--ADAISRHEERVIIISSKDNDG 401
           DI  R++VP++ +G +IGK G  I+ I ++T++ I +   +     E+ + + S+ +   
Sbjct: 195 DIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAAEKAISVHSTPEGCS 254

Query: 402 TFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIE 581
           + C     + +I+    KD ++        A  VP   ++ L   +  G LIG  G+N++
Sbjct: 255 SAC---KMILEIMHKEAKDTKT--------ADEVP---LKILAHNNFVGRLIGKEGRNLK 300

Query: 582 NLRISSGATVTV 617
            +   +   +T+
Sbjct: 301 KVEQDTETKITI 312



 Score = 40.0 bits (92), Expect = 0.032
 Identities = 45/217 (20%), Positives = 86/217 (39%), Gaps = 46/217 (21%)
 Frame = +3

Query: 105 DPYKSTTAKRRRDEDAFEATDEAGTSA-----EVVPPLKKRVKVSQDIVYRIIVPSKQIG 269
           D ++   A       +  +T E  +SA     E++    K  K + ++  +I+  +  +G
Sbjct: 230 DVHRKENAGAAEKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKILAHNNFVG 289

Query: 270 KVIGKVGHRIQKIREETRATIKIA---DAISRHEERVIIISSKDNDGTFCDAESALHQIV 440
           ++IGK G  ++K+ ++T   I I+   D    + ER I +     +   C AE    +I+
Sbjct: 290 RLIGKEGRNLKKVEQDTETKITISSLQDLTLYNPERTITVKGAIEN--CCRAEQ---EIM 344

Query: 441 TLILKDDESNIEAMK-----------AGAGHVPANS------------------------ 515
             + +  E+++ AM            A  G  PA+S                        
Sbjct: 345 KKVREAYENDVAAMSLQSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSFMQAPE 404

Query: 516 ---VRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
              V+  I     G +IG  GQ+I+ L   + A++ +
Sbjct: 405 QEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKI 441



 Score = 34.7 bits (78), Expect = 1.3
 Identities = 30/140 (21%), Positives = 60/140 (42%)
 Frame = +3

Query: 198 PLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVII 377
           P    ++  +  + ++ +P++ +G +IGK G  I+++     A+IKIA   +   +  ++
Sbjct: 395 PYSSFMQAPEQEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPETPDSKVRMV 454

Query: 378 ISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLI 557
           I +   +  F  A+  ++       K  E N      G            +  S AG +I
Sbjct: 455 IITGPPEAQF-KAQGRIYG------KLKEENF----FGPKEEVKLETHIRVPASAAGRVI 503

Query: 558 GVSGQNIENLRISSGATVTV 617
           G  G+ +  L+  + A V V
Sbjct: 504 GKGGKTVNELQNLTAAEVVV 523



>gb:AK044850_1167165 Mus musculus 9.5 days embryo parthenogenote
           cDNA, RIKEN full-length enriched library,
           clone:B130008A04 product:insulin-like growth factor 2,
           binding protein 1, full insert sequence.
          Length = 577

 Score = 40.8 bits (94), Expect = 0.019
 Identities = 31/132 (23%), Positives = 65/132 (49%), Gaps = 2/132 (1%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI--ADAISRHEERVIIISSKDNDG 401
           DI  R++VP++ +G +IGK G  I+ I ++T++ I +   +     E+ + + S+ +   
Sbjct: 195 DIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAAEKAISVHSTPEGCS 254

Query: 402 TFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIE 581
           + C     + +I+    KD ++        A  VP   ++ L   +  G LIG  G+N++
Sbjct: 255 SAC---KMILEIMHKEAKDTKT--------ADEVP---LKILAHNNFVGRLIGKEGRNLK 300

Query: 582 NLRISSGATVTV 617
            +   +   +T+
Sbjct: 301 KVEQDTETKITI 312



 Score = 40.0 bits (92), Expect = 0.032
 Identities = 45/217 (20%), Positives = 86/217 (39%), Gaps = 46/217 (21%)
 Frame = +3

Query: 105 DPYKSTTAKRRRDEDAFEATDEAGTSA-----EVVPPLKKRVKVSQDIVYRIIVPSKQIG 269
           D ++   A       +  +T E  +SA     E++    K  K + ++  +I+  +  +G
Sbjct: 230 DVHRKENAGAAEKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKILAHNNFVG 289

Query: 270 KVIGKVGHRIQKIREETRATIKIA---DAISRHEERVIIISSKDNDGTFCDAESALHQIV 440
           ++IGK G  ++K+ ++T   I I+   D    + ER I +     +   C AE    +I+
Sbjct: 290 RLIGKEGRNLKKVEQDTETKITISSLQDLTLYNPERTITVKGAIEN--CCRAEQ---EIM 344

Query: 441 TLILKDDESNIEAMK-----------AGAGHVPANS------------------------ 515
             + +  E+++ AM            A  G  PA+S                        
Sbjct: 345 KKVREAYENDVAAMSLQSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSFMQAPE 404

Query: 516 ---VRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
              V+  I     G +IG  GQ+I+ L   + A++ +
Sbjct: 405 QGMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKI 441



 Score = 33.9 bits (76), Expect = 2.3
 Identities = 29/140 (20%), Positives = 60/140 (42%)
 Frame = +3

Query: 198 PLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVII 377
           P    ++  +  + ++ +P++ +G +IGK G  I+++     A+IKIA   +   +  ++
Sbjct: 395 PYSSFMQAPEQGMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPETPDSKVRMV 454

Query: 378 ISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLI 557
           + +   +  F  A+  ++       K  E N      G            +  S AG +I
Sbjct: 455 VITGPPEAQF-KAQGRIYG------KLKEENF----FGPKEEVKLETHIRVPASAAGRVI 503

Query: 558 GVSGQNIENLRISSGATVTV 617
           G  G+ +  L+  + A V V
Sbjct: 504 GKGGKTVNELQNLTAAEVVV 523



>gb:AK013940_1157708 Mus musculus 13 days embryo head cDNA, RIKEN
           full-length enriched library, clone:3110001D23
           product:insulin-like growth factor 2, binding protein 1,
           full insert sequence.>gb:AF061569_2052880 Mus musculus
           coding region determinant binding protein mRNA, complete
           cds.
          Length = 577

 Score = 40.8 bits (94), Expect = 0.019
 Identities = 31/132 (23%), Positives = 65/132 (49%), Gaps = 2/132 (1%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI--ADAISRHEERVIIISSKDNDG 401
           DI  R++VP++ +G +IGK G  I+ I ++T++ I +   +     E+ + + S+ +   
Sbjct: 195 DIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAAEKAISVHSTPEGCS 254

Query: 402 TFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIE 581
           + C     + +I+    KD ++        A  VP   ++ L   +  G LIG  G+N++
Sbjct: 255 SAC---KMILEIMHKEAKDTKT--------ADEVP---LKILAHNNFVGRLIGKEGRNLK 300

Query: 582 NLRISSGATVTV 617
            +   +   +T+
Sbjct: 301 KVEQDTETKITI 312



 Score = 40.0 bits (92), Expect = 0.032
 Identities = 45/217 (20%), Positives = 86/217 (39%), Gaps = 46/217 (21%)
 Frame = +3

Query: 105 DPYKSTTAKRRRDEDAFEATDEAGTSA-----EVVPPLKKRVKVSQDIVYRIIVPSKQIG 269
           D ++   A       +  +T E  +SA     E++    K  K + ++  +I+  +  +G
Sbjct: 230 DVHRKENAGAAEKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKILAHNNFVG 289

Query: 270 KVIGKVGHRIQKIREETRATIKIA---DAISRHEERVIIISSKDNDGTFCDAESALHQIV 440
           ++IGK G  ++K+ ++T   I I+   D    + ER I +     +   C AE    +I+
Sbjct: 290 RLIGKEGRNLKKVEQDTETKITISSLQDLTLYNPERTITVKGAIEN--CCRAEQ---EIM 344

Query: 441 TLILKDDESNIEAMK-----------AGAGHVPANS------------------------ 515
             + +  E+++ AM            A  G  PA+S                        
Sbjct: 345 KKVREAYENDVAAMSLQSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSFMQAPE 404

Query: 516 ---VRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
              V+  I     G +IG  GQ+I+ L   + A++ +
Sbjct: 405 QEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKI 441



 Score = 34.3 bits (77), Expect = 1.8
 Identities = 29/140 (20%), Positives = 60/140 (42%)
 Frame = +3

Query: 198 PLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVII 377
           P    ++  +  + ++ +P++ +G +IGK G  I+++     A+IKIA   +   +  ++
Sbjct: 395 PYSSFMQAPEQEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPETPDSKVRMV 454

Query: 378 ISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLI 557
           + +   +  F  A+  ++       K  E N      G            +  S AG +I
Sbjct: 455 VITGPPEAQF-KAQGRIYG------KLKEENF----FGPKEEVKLETHIRVPASAAGRVI 503

Query: 558 GVSGQNIENLRISSGATVTV 617
           G  G+ +  L+  + A V V
Sbjct: 504 GKGGKTVNELQNLTAAEVVV 523



>gb:AP004589_1841981 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0556A11.
          Length = 441

 Score = 40.4 bits (93), Expect = 0.024
 Identities = 34/104 (32%), Positives = 55/104 (52%), Gaps = 4/104 (3%)
 Frame = +3

Query: 156 EATDEAGTSAEVVPPLKKRVKVSQD----IVYRIIVPSKQIGKVIGKVGHRIQKIREETR 323
           EATD+A  SA V   L  + K++ D    +  R++VP K IG +IGK G  +  +R +T+
Sbjct: 175 EATDDA-KSAAVEAVLLLQSKINDDNEGKMNLRLLVPGKVIGCLIGKGGSIVNDMRSKTK 233

Query: 324 ATIKIADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILK 455
           A I     IS+ E+     SS +    F + E+    +V ++L+
Sbjct: 234 AAI----YISKGEKPRKASSSDELVEVFGEVENLRDALVQIVLR 273



>gb:BT015219_1358296 Drosophila melanogaster RE39088 full insert
           cDNA.
          Length = 563

 Score = 40.4 bits (93), Expect = 0.024
 Identities = 25/84 (29%), Positives = 49/84 (58%), Gaps = 3/84 (3%)
 Frame = +3

Query: 225 QDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADA---ISRHEERVIIISSKDN 395
           +D   +I+VP+   G +IGK G  I++I+EE+ + ++I+     +S  E  + II  K+N
Sbjct: 212 RDKQVKILVPNSTAGMIIGKGGAFIKQIKEESGSYVQISQKPTDVSLQERCITIIGDKEN 271

Query: 396 DGTFCDAESALHQIVTLILKDDES 467
           +      ++A   I++ I++D +S
Sbjct: 272 N------KNACKMILSKIVEDPQS 289



 Score = 38.5 bits (88), Expect = 0.093
 Identities = 35/135 (25%), Positives = 63/135 (46%), Gaps = 9/135 (6%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA---DAISRHEERVIIISSKDNDGTFC 410
           +I+VP+   G +IGK G  I  ++++T A +K++   D      ERV +I+         
Sbjct: 124 KILVPAVASGAIIGKGGETIASLQKDTGARVKMSKSHDFYPGTTERVCLITG-------- 175

Query: 411 DAESALHQIVTLIL-----KDDESN-IEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQ 572
            +  A+  ++  I+     K D +N I    +         V+ L+  S AG +IG  G 
Sbjct: 176 -STEAIMVVMEFIMDKIREKPDLTNKIVDTDSKQTQERDKQVKILVPNSTAGMIIGKGGA 234

Query: 573 NIENLRISSGATVTV 617
            I+ ++  SG+ V +
Sbjct: 235 FIKQIKEESGSYVQI 249



>gb:BT001623_1356396 Drosophila melanogaster RE36563 full insert
           cDNA.
          Length = 605

 Score = 40.4 bits (93), Expect = 0.024
 Identities = 25/84 (29%), Positives = 49/84 (58%), Gaps = 3/84 (3%)
 Frame = +3

Query: 225 QDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADA---ISRHEERVIIISSKDN 395
           +D   +I+VP+   G +IGK G  I++I+EE+ + ++I+     +S  E  + II  K+N
Sbjct: 190 RDKQVKILVPNSTAGMIIGKGGAFIKQIKEESGSYVQISQKPTDVSLQERCITIIGDKEN 249

Query: 396 DGTFCDAESALHQIVTLILKDDES 467
           +      ++A   I++ I++D +S
Sbjct: 250 N------KNACKMILSKIVEDPQS 267



 Score = 38.5 bits (88), Expect = 0.093
 Identities = 35/135 (25%), Positives = 63/135 (46%), Gaps = 9/135 (6%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA---DAISRHEERVIIISSKDNDGTFC 410
           +I+VP+   G +IGK G  I  ++++T A +K++   D      ERV +I+         
Sbjct: 102 KILVPAVASGAIIGKGGETIASLQKDTGARVKMSKSHDFYPGTTERVCLITG-------- 153

Query: 411 DAESALHQIVTLIL-----KDDESN-IEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQ 572
            +  A+  ++  I+     K D +N I    +         V+ L+  S AG +IG  G 
Sbjct: 154 -STEAIMVVMEFIMDKIREKPDLTNKIVDTDSKQTQERDKQVKILVPNSTAGMIIGKGGA 212

Query: 573 NIENLRISSGATVTV 617
            I+ ++  SG+ V +
Sbjct: 213 FIKQIKEESGSYVQI 227



>gb:AY089247_1296903 Drosophila melanogaster AT03366 full insert
           cDNA.
          Length = 539

 Score = 40.4 bits (93), Expect = 0.024
 Identities = 25/84 (29%), Positives = 49/84 (58%), Gaps = 3/84 (3%)
 Frame = +3

Query: 225 QDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADA---ISRHEERVIIISSKDN 395
           +D   +I+VP+   G +IGK G  I++I+EE+ + ++I+     +S  E  + II  K+N
Sbjct: 124 RDKQVKILVPNSTAGMIIGKGGAFIKQIKEESGSYVQISQKPTDVSLQERCITIIGDKEN 183

Query: 396 DGTFCDAESALHQIVTLILKDDES 467
           +      ++A   I++ I++D +S
Sbjct: 184 N------KNACKMILSKIVEDPQS 201



 Score = 38.5 bits (88), Expect = 0.093
 Identities = 35/135 (25%), Positives = 63/135 (46%), Gaps = 9/135 (6%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA---DAISRHEERVIIISSKDNDGTFC 410
           +I+VP+   G +IGK G  I  ++++T A +K++   D      ERV +I+         
Sbjct: 36  KILVPAVASGAIIGKGGETIASLQKDTGARVKMSKSHDFYPGTTERVCLITG-------- 87

Query: 411 DAESALHQIVTLIL-----KDDESN-IEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQ 572
            +  A+  ++  I+     K D +N I    +         V+ L+  S AG +IG  G 
Sbjct: 88  -STEAIMVVMEFIMDKIREKPDLTNKIVDTDSKQTQERDKQVKILVPNSTAGMIIGKGGA 146

Query: 573 NIENLRISSGATVTV 617
            I+ ++  SG+ V +
Sbjct: 147 FIKQIKEESGSYVQI 161



>gb:AE014297_1138659 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003682_1220652 Drosophila melanogaster
           chromosome 3R, section 20 of 118 of the complete
           sequence.>gb:AF220423_1252331 Drosophila melanogaster
           PASILLA splice variant 4 (ps) mRNA, complete cds.
          Length = 561

 Score = 40.4 bits (93), Expect = 0.024
 Identities = 25/84 (29%), Positives = 49/84 (58%), Gaps = 3/84 (3%)
 Frame = +3

Query: 225 QDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADA---ISRHEERVIIISSKDN 395
           +D   +I+VP+   G +IGK G  I++I+EE+ + ++I+     +S  E  + II  K+N
Sbjct: 146 RDKQVKILVPNSTAGMIIGKGGAFIKQIKEESGSYVQISQKPTDVSLQERCITIIGDKEN 205

Query: 396 DGTFCDAESALHQIVTLILKDDES 467
           +      ++A   I++ I++D +S
Sbjct: 206 N------KNACKMILSKIVEDPQS 223



 Score = 38.5 bits (88), Expect = 0.093
 Identities = 35/135 (25%), Positives = 63/135 (46%), Gaps = 9/135 (6%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA---DAISRHEERVIIISSKDNDGTFC 410
           +I+VP+   G +IGK G  I  ++++T A +K++   D      ERV +I+         
Sbjct: 58  KILVPAVASGAIIGKGGETIASLQKDTGARVKMSKSHDFYPGTTERVCLITG-------- 109

Query: 411 DAESALHQIVTLIL-----KDDESN-IEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQ 572
            +  A+  ++  I+     K D +N I    +         V+ L+  S AG +IG  G 
Sbjct: 110 -STEAIMVVMEFIMDKIREKPDLTNKIVDTDSKQTQERDKQVKILVPNSTAGMIIGKGGA 168

Query: 573 NIENLRISSGATVTV 617
            I+ ++  SG+ V +
Sbjct: 169 FIKQIKEESGSYVQI 183



>gb:AE014297_1138658 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003682_1220651 Drosophila melanogaster
           chromosome 3R, section 20 of 118 of the complete
           sequence.
          Length = 583

 Score = 40.4 bits (93), Expect = 0.024
 Identities = 25/84 (29%), Positives = 49/84 (58%), Gaps = 3/84 (3%)
 Frame = +3

Query: 225 QDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADA---ISRHEERVIIISSKDN 395
           +D   +I+VP+   G +IGK G  I++I+EE+ + ++I+     +S  E  + II  K+N
Sbjct: 168 RDKQVKILVPNSTAGMIIGKGGAFIKQIKEESGSYVQISQKPTDVSLQERCITIIGDKEN 227

Query: 396 DGTFCDAESALHQIVTLILKDDES 467
           +      ++A   I++ I++D +S
Sbjct: 228 N------KNACKMILSKIVEDPQS 245



 Score = 38.5 bits (88), Expect = 0.093
 Identities = 35/135 (25%), Positives = 63/135 (46%), Gaps = 9/135 (6%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA---DAISRHEERVIIISSKDNDGTFC 410
           +I+VP+   G +IGK G  I  ++++T A +K++   D      ERV +I+         
Sbjct: 80  KILVPAVASGAIIGKGGETIASLQKDTGARVKMSKSHDFYPGTTERVCLITG-------- 131

Query: 411 DAESALHQIVTLIL-----KDDESN-IEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQ 572
            +  A+  ++  I+     K D +N I    +         V+ L+  S AG +IG  G 
Sbjct: 132 -STEAIMVVMEFIMDKIREKPDLTNKIVDTDSKQTQERDKQVKILVPNSTAGMIIGKGGA 190

Query: 573 NIENLRISSGATVTV 617
            I+ ++  SG+ V +
Sbjct: 191 FIKQIKEESGSYVQI 205



>gb:AE014297_1138657 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003682_1220650 Drosophila melanogaster
           chromosome 3R, section 20 of 118 of the complete
           sequence.>gb:AF220420_1252328 Drosophila melanogaster
           PASILLA splice variant 1 (ps) mRNA, complete
           cds.>gb:AF220421_1252329 Drosophila melanogaster PASILLA
           splice variant 2 (ps) mRNA, complete cds.
          Length = 475

 Score = 40.4 bits (93), Expect = 0.024
 Identities = 25/84 (29%), Positives = 49/84 (58%), Gaps = 3/84 (3%)
 Frame = +3

Query: 225 QDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADA---ISRHEERVIIISSKDN 395
           +D   +I+VP+   G +IGK G  I++I+EE+ + ++I+     +S  E  + II  K+N
Sbjct: 124 RDKQVKILVPNSTAGMIIGKGGAFIKQIKEESGSYVQISQKPTDVSLQERCITIIGDKEN 183

Query: 396 DGTFCDAESALHQIVTLILKDDES 467
           +      ++A   I++ I++D +S
Sbjct: 184 N------KNACKMILSKIVEDPQS 201



 Score = 38.5 bits (88), Expect = 0.093
 Identities = 35/135 (25%), Positives = 63/135 (46%), Gaps = 9/135 (6%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA---DAISRHEERVIIISSKDNDGTFC 410
           +I+VP+   G +IGK G  I  ++++T A +K++   D      ERV +I+         
Sbjct: 36  KILVPAVASGAIIGKGGETIASLQKDTGARVKMSKSHDFYPGTTERVCLITG-------- 87

Query: 411 DAESALHQIVTLIL-----KDDESN-IEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQ 572
            +  A+  ++  I+     K D +N I    +         V+ L+  S AG +IG  G 
Sbjct: 88  -STEAIMVVMEFIMDKIREKPDLTNKIVDTDSKQTQERDKQVKILVPNSTAGMIIGKGGA 146

Query: 573 NIENLRISSGATVTV 617
            I+ ++  SG+ V +
Sbjct: 147 FIKQIKEESGSYVQI 161



>gb:AE014297_1138656 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003682_1220649 Drosophila melanogaster
           chromosome 3R, section 20 of 118 of the complete
           sequence.>gb:AF220422_1252330 Drosophila melanogaster
           PASILLA splice variant 3 (ps) mRNA, complete cds.
          Length = 572

 Score = 40.4 bits (93), Expect = 0.024
 Identities = 25/84 (29%), Positives = 49/84 (58%), Gaps = 3/84 (3%)
 Frame = +3

Query: 225 QDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADA---ISRHEERVIIISSKDN 395
           +D   +I+VP+   G +IGK G  I++I+EE+ + ++I+     +S  E  + II  K+N
Sbjct: 157 RDKQVKILVPNSTAGMIIGKGGAFIKQIKEESGSYVQISQKPTDVSLQERCITIIGDKEN 216

Query: 396 DGTFCDAESALHQIVTLILKDDES 467
           +      ++A   I++ I++D +S
Sbjct: 217 N------KNACKMILSKIVEDPQS 234



 Score = 38.5 bits (88), Expect = 0.093
 Identities = 35/135 (25%), Positives = 63/135 (46%), Gaps = 9/135 (6%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA---DAISRHEERVIIISSKDNDGTFC 410
           +I+VP+   G +IGK G  I  ++++T A +K++   D      ERV +I+         
Sbjct: 69  KILVPAVASGAIIGKGGETIASLQKDTGARVKMSKSHDFYPGTTERVCLITG-------- 120

Query: 411 DAESALHQIVTLIL-----KDDESN-IEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQ 572
            +  A+  ++  I+     K D +N I    +         V+ L+  S AG +IG  G 
Sbjct: 121 -STEAIMVVMEFIMDKIREKPDLTNKIVDTDSKQTQERDKQVKILVPNSTAGMIIGKGGA 179

Query: 573 NIENLRISSGATVTV 617
            I+ ++  SG+ V +
Sbjct: 180 FIKQIKEESGSYVQI 194



>pir|T48439|T48439 probable RNA-binding protein - Arabidopsis
           thaliana>gb:ATT32M21_1555909 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T32M21 (ESSA
           project).>gb:AY086553_1571601 Arabidopsis thaliana clone
           25769 mRNA, complete sequence.>gb:BT000854_1635109
           Arabidopsis thaliana At5g04430/T32M21_30 mRNA, complete
           cds.>gb:AF375411_1792916 Arabidopsis thaliana
           AT5g04430/T32M21_30 mRNA, complete cds.
          Length = 313

 Score = 40.4 bits (93), Expect = 0.024
 Identities = 34/129 (26%), Positives = 59/129 (45%), Gaps = 3/129 (2%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA---DAISRHEERVIIISSKDNDGTFC 410
           R++VP+   G +IGK G  I+   EE++A IKI+   +      +R++ +S     GTF 
Sbjct: 124 RLVVPNSSCGGIIGKGGATIKSFIEESKAGIKISPLDNTFYGLSDRLVTLS-----GTFE 178

Query: 411 DAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENLR 590
           +   A+  I+  + +DD  +       +     NSV +   G         SG   +N +
Sbjct: 179 EQMRAIDLILAKLTEDDHYSQNVHSPYSYAAGYNSVNYAPNG---------SGGKYQNHK 229

Query: 591 ISSGATVTV 617
             +  TVT+
Sbjct: 230 EEASTTVTI 238



 Score = 38.1 bits (87), Expect = 0.12
 Identities = 37/133 (27%), Positives = 62/133 (46%), Gaps = 7/133 (5%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEE-------RVIIISSKDND 398
           R +V +   G VIGK G  I + + ++ A I++    SR++E       R+I+IS     
Sbjct: 38  RFLVSNAAAGSVIGKGGSTITEFQAKSGARIQL----SRNQEFFPGTTDRIIMIS----- 88

Query: 399 GTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNI 578
           G+  +  + L     LIL    S + A + G    P   +R ++  S  GG+IG  G  I
Sbjct: 89  GSIKEVVNGLE----LILDKLHSELHA-EDGNEVEPRRRIRLVVPNSSCGGIIGKGGATI 143

Query: 579 ENLRISSGATVTV 617
           ++    S A + +
Sbjct: 144 KSFIEESKAGIKI 156



>gb:BC085379_2564330 Danio rerio zgc:101598, mRNA (cDNA clone
           MGC:101598 IMAGE:7224029), complete cds.
          Length = 572

 Score = 40.0 bits (92), Expect = 0.032
 Identities = 28/128 (21%), Positives = 63/128 (49%), Gaps = 2/128 (1%)
 Frame = +3

Query: 234 VYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA--DAISRHEERVIIISSKDNDGTF 407
           V  I++P+ ++G VIGK G  I++++E T   + +   D +    ++ + IS     G  
Sbjct: 170 VQEILIPASKVGLVIGKGGDTIKQLQERTGVKMIMIQDDPMPTGSDKPLRIS-----GDP 224

Query: 408 CDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENL 587
              + A   +V +I + D+ +  + ++  G    +S+   +     G +IG +G+ I+ +
Sbjct: 225 YKVQQARELVVEIIREKDQGDFRSGRSDFGSRLGSSIDVAVPRFAVGIVIGRNGEMIKKI 284

Query: 588 RISSGATV 611
           +  +G  +
Sbjct: 285 QNDAGVRI 292



 Score = 33.1 bits (74), Expect = 3.9
 Identities = 31/124 (25%), Positives = 55/124 (44%)
 Frame = +3

Query: 249 VPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAESAL 428
           VP K +G +IG+ G +I +I+ E+   I+IA       +R   ++      +   A+  L
Sbjct: 90  VPDKMVGFIIGRGGEQITRIQLESNCKIQIAADSGGMMDRPCTLTGTPE--SIEQAKRLL 147

Query: 429 HQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGAT 608
            QIV      +     +   G+  V       LI  S+ G +IG  G  I+ L+  +G  
Sbjct: 148 GQIVDRC--RNGPGFHSQMDGSSAVQ----EILIPASKVGLVIGKGGDTIKQLQERTGVK 201

Query: 609 VTVL 620
           + ++
Sbjct: 202 MIMI 205



>gb:BC051679_2100822 Mus musculus insulin-like growth factor 2,
           binding protein 1, mRNA (cDNA clone MGC:60613
           IMAGE:30008106), complete cds.
          Length = 577

 Score = 40.0 bits (92), Expect = 0.032
 Identities = 31/132 (23%), Positives = 65/132 (49%), Gaps = 2/132 (1%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI--ADAISRHEERVIIISSKDNDG 401
           DI  R++VP++ +G +IGK G  I+ I ++T++ I +   +     E+ + + S+ +   
Sbjct: 195 DIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAAEKAISVHSTPEGCS 254

Query: 402 TFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIE 581
           + C     + +I+    KD ++        A  VP   ++ L   +  G LIG  G+N++
Sbjct: 255 SAC---KMILEIMHKEAKDTKT--------ADGVP---LKILAHNNFVGRLIGKEGRNLK 300

Query: 582 NLRISSGATVTV 617
            +   +   +T+
Sbjct: 301 KVEQDTETKITI 312



 Score = 38.9 bits (89), Expect = 0.071
 Identities = 45/217 (20%), Positives = 85/217 (39%), Gaps = 46/217 (21%)
 Frame = +3

Query: 105 DPYKSTTAKRRRDEDAFEATDEAGTSA-----EVVPPLKKRVKVSQDIVYRIIVPSKQIG 269
           D ++   A       +  +T E  +SA     E++    K  K +  +  +I+  +  +G
Sbjct: 230 DVHRKENAGAAEKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADGVPLKILAHNNFVG 289

Query: 270 KVIGKVGHRIQKIREETRATIKIA---DAISRHEERVIIISSKDNDGTFCDAESALHQIV 440
           ++IGK G  ++K+ ++T   I I+   D    + ER I +     +   C AE    +I+
Sbjct: 290 RLIGKEGRNLKKVEQDTETKITISSLQDLTLYNPERTITVKGAIEN--CCRAEQ---EIM 344

Query: 441 TLILKDDESNIEAMK-----------AGAGHVPANS------------------------ 515
             + +  E+++ AM            A  G  PA+S                        
Sbjct: 345 KKVREAYENDVAAMSLQSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSFMQAPE 404

Query: 516 ---VRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
              V+  I     G +IG  GQ+I+ L   + A++ +
Sbjct: 405 QEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKI 441



 Score = 34.3 bits (77), Expect = 1.8
 Identities = 29/140 (20%), Positives = 60/140 (42%)
 Frame = +3

Query: 198 PLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVII 377
           P    ++  +  + ++ +P++ +G +IGK G  I+++     A+IKIA   +   +  ++
Sbjct: 395 PYSSFMQAPEQEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPETPDSKVRMV 454

Query: 378 ISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLI 557
           + +   +  F  A+  ++       K  E N      G            +  S AG +I
Sbjct: 455 VITGPPEAQF-KAQGRIYG------KLKEENF----FGPKEEVKLETHIRVPASAAGRVI 503

Query: 558 GVSGQNIENLRISSGATVTV 617
           G  G+ +  L+  + A V V
Sbjct: 504 GKGGKTVNELQNLTAAEVVV 523



>gb:AF198254_1889669 Homo sapiens mRNA-binding protein CRDBP mRNA,
           complete cds.
          Length = 577

 Score = 40.0 bits (92), Expect = 0.032
 Identities = 31/132 (23%), Positives = 65/132 (49%), Gaps = 2/132 (1%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI--ADAISRHEERVIIISSKDNDG 401
           DI  R++VP++ +G +IGK G  I+ I ++T++ I +   +     E+ + + S+ +   
Sbjct: 195 DIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAAEKAISVHSTPEGCS 254

Query: 402 TFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIE 581
           + C     + +I+    KD ++        A  VP   ++ L   +  G LIG  G+N++
Sbjct: 255 SAC---KMILEIMHKEAKDTKT--------ADEVP---LKTLAHNNFVGRLIGKEGRNLK 300

Query: 582 NLRISSGATVTV 617
            +   +   +T+
Sbjct: 301 KVEQDTETKITI 312



 Score = 38.1 bits (87), Expect = 0.12
 Identities = 44/217 (20%), Positives = 85/217 (39%), Gaps = 46/217 (21%)
 Frame = +3

Query: 105 DPYKSTTAKRRRDEDAFEATDEAGTSA-----EVVPPLKKRVKVSQDIVYRIIVPSKQIG 269
           D ++   A       +  +T E  +SA     E++    K  K + ++  + +  +  +G
Sbjct: 230 DVHRKENAGAAEKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKTLAHNNFVG 289

Query: 270 KVIGKVGHRIQKIREETRATIKIA---DAISRHEERVIIISSKDNDGTFCDAESALHQIV 440
           ++IGK G  ++K+ ++T   I I+   D    + ER I +     +   C AE    +I+
Sbjct: 290 RLIGKEGRNLKKVEQDTETKITISSLQDLTLYNPERTITVKGAIEN--CCRAEQ---EIM 344

Query: 441 TLILKDDESNIEAMK-----------AGAGHVPANS------------------------ 515
             + +  E+++ AM            A  G  PA+S                        
Sbjct: 345 KKVREAYENDVAAMSLQSHLTPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSFMQAPE 404

Query: 516 ---VRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
              V+  I     G +IG  GQ+I+ L   + A++ +
Sbjct: 405 QEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKI 441



 Score = 34.7 bits (78), Expect = 1.3
 Identities = 30/140 (21%), Positives = 60/140 (42%)
 Frame = +3

Query: 198 PLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVII 377
           P    ++  +  + ++ +P++ +G +IGK G  I+++     A+IKIA   +   +  ++
Sbjct: 395 PYSSFMQAPEQEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPETPDSKVRMV 454

Query: 378 ISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLI 557
           I +   +  F  A+  ++       K  E N      G            +  S AG +I
Sbjct: 455 IITGPPEAQF-KAQGRIYG------KLKEENF----FGPKEEVKLETHIRVPASAAGRVI 503

Query: 558 GVSGQNIENLRISSGATVTV 617
           G  G+ +  L+  + A V V
Sbjct: 504 GKGGKTVNELQNLTAAEVVV 523



>gb:AE016819_1748818 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 392

 Score = 40.0 bits (92), Expect = 0.032
 Identities = 45/176 (25%), Positives = 73/176 (41%), Gaps = 5/176 (2%)
 Frame = +3

Query: 93  STEDDPYKSTTAKRRR---DEDAFEATDEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQ 263
           S  D    S  A +R+   DE A EA  +     +V+P      ++S  I  R++   K 
Sbjct: 2   SDSDVACDSPNALKRKPDDDEKALEAEIKRVALDDVLPGA---ARISDYIHMRMLCLVKD 58

Query: 264 IGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAESALHQIVT 443
              V+G  G RI +I+ ET   I +++ I    ERV+ +      G+  +   A  +I  
Sbjct: 59  ASMVVGHKGERISRIKLETGTRINVSENIKNVPERVVFLR-----GSCENVAKAFGKISR 113

Query: 444 LILKDD--ESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGA 605
            I  +D  ESN  ++          +V  L+     G +IG  G  +  +   S A
Sbjct: 114 AINDEDDRESNDRSLPL--------TVNLLVPHHLMGYVIGKQGSRLREIEDLSAA 161



 Score = 38.5 bits (88), Expect = 0.093
 Identities = 18/50 (36%), Positives = 29/50 (58%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIII 380
           +V  I +    +G VIG+ G  I +I+E T  +I+IAD +   +ER + I
Sbjct: 304 VVQEIFIEELMVGNVIGRGGKNITQIKESTGCSIQIADPVPGKDERKLTI 353



>gb:CEY59A8B_1370764 Caenorhabditis elegans YAC Y59A8B, complete
           sequence.
          Length = 413

 Score = 40.0 bits (92), Expect = 0.032
 Identities = 35/125 (28%), Positives = 54/125 (43%), Gaps = 5/125 (4%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHE-----ERVIIISSKDNDGT 404
           +I++P+   G VIGK G  I+ IRE+    I++       E     ERV+ ++  +    
Sbjct: 137 KIVMPNTSAGMVIGKSGANIKDIREQFGCQIQVYPKAGSVEAKTSLERVVTVAHDEASAL 196

Query: 405 FCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIEN 584
              A   L ++ +      E N E    G+G  P+ S     +G   GG  G  GQ+  N
Sbjct: 197 LQAASRVLEKVASDPHHASEINKEDFGKGSG--PSGSANSGPSGGGGGG--GGGGQSNNN 252

Query: 585 LRISS 599
              SS
Sbjct: 253 SSFSS 257



 Score = 38.9 bits (89), Expect = 0.071
 Identities = 27/138 (19%), Positives = 60/138 (43%), Gaps = 12/138 (8%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATI---KIADAISRHEERVIIISSKDNDGTFC 410
           +I++PS  +G +IGK G  ++ ++ +    +   K ++      ER+ ++  + N+    
Sbjct: 45  KILIPSNAVGAIIGKGGEAMRNLKNDNNCRVQMSKNSETYPGTSERICLVKGRLNN---- 100

Query: 411 DAESALHQIVTLILKDDESNIEAMKAGAGHVPA---------NSVRFLIAGSQAGGLIGV 563
                    +  +++  +  I    A  G   A           ++ ++  + AG +IG 
Sbjct: 101 ---------IMAVIESIQDKIREKCADQGGSDAFDHKNTSRGAEIKIVMPNTSAGMVIGK 151

Query: 564 SGQNIENLRISSGATVTV 617
           SG NI+++R   G  + V
Sbjct: 152 SGANIKDIREQFGCQIQV 169



>gb:AB014597_1864626 Homo sapiens mRNA for KIAA0697 protein, partial
            cds.
          Length = 2486

 Score = 39.7 bits (91), Expect = 0.042
 Identities = 34/118 (28%), Positives = 58/118 (49%), Gaps = 3/118 (2%)
 Frame = +3

Query: 204  KKRVKVSQDIVYR---IIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVI 374
            +KR +  +++V R   + VPS  I +VIG+ G  I  IRE T A I I     +  +R+I
Sbjct: 1597 QKREEGWKEVVRRSKKVSVPSTVISRVIGRGGCNINAIREFTGAHIDIDKQKDKTGDRII 1656

Query: 375  IISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAG 548
             I      GT  ++     Q++  ++KD +  I+ +      +P N ++   A S+ G
Sbjct: 1657 TI----RGGT--ESTRQATQLINALIKDPDKEIDEL------IPKNRLKSSSANSKIG 1702



>pir|T00353|T00353 hypothetical protein KIAA0697 - human (fragment)
          Length = 968

 Score = 39.7 bits (91), Expect = 0.042
 Identities = 34/118 (28%), Positives = 58/118 (49%), Gaps = 3/118 (2%)
 Frame = +3

Query: 204 KKRVKVSQDIVYR---IIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVI 374
           +KR +  +++V R   + VPS  I +VIG+ G  I  IRE T A I I     +  +R+I
Sbjct: 79  QKREEGWKEVVRRSKKVSVPSTVISRVIGRGGCNINAIREFTGAHIDIDKQKDKTGDRII 138

Query: 375 IISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAG 548
            I      GT  ++     Q++  ++KD +  I+ +      +P N ++   A S+ G
Sbjct: 139 TI----RGGT--ESTRQATQLINALIKDPDKEIDEL------IPKNRLKSSSANSKIG 184



>gb:AF533513_2499788 Xenopus laevis RNA-binding protein VgRBP71
           mRNA, complete cds.
          Length = 672

 Score = 39.3 bits (90), Expect = 0.055
 Identities = 37/150 (24%), Positives = 62/150 (41%), Gaps = 2/150 (1%)
 Frame = +3

Query: 177 TSAEVVPPLKKRVKV--SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAI 350
           T  E +PP    V    S  +     VP   +G +IG+ G +I KI++E+   ++I+   
Sbjct: 74  TQPESMPPQLAPVHPPRSSSMTEEYRVPDGMVGLIIGRGGEQINKIQQESGCKVQISPDS 133

Query: 351 SRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLI 530
               ER  I+S   N      A+  L  IV        S       G      +    +I
Sbjct: 134 GGMPER--IVSLTGNPDAVQKAKMLLDDIVLRGRGGPPSQFHDSSNGQN---GSLQEIMI 188

Query: 531 AGSQAGGLIGVSGQNIENLRISSGATVTVL 620
              +AG +IG  G+ I+ L+  +G  + ++
Sbjct: 189 PAGKAGLIIGKGGETIKQLQERAGVKMILI 218



>gb:AK129193_2069424 Mus musculus mRNA for mKIAA0697 protein.
          Length = 1119

 Score = 39.3 bits (90), Expect = 0.055
 Identities = 30/103 (29%), Positives = 50/103 (48%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAE 419
           ++ VPS  I +VIG+ G  I  IRE T A I I     +  +R+I I      GT  ++ 
Sbjct: 241 KVSVPSTVISRVIGRGGCNINAIRECTGAHIDIDKQKDKTGDRIITI----RGGT--EST 294

Query: 420 SALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAG 548
               Q++  ++KD +  I+ +      +P N ++   A S+ G
Sbjct: 295 RQATQLINALIKDPDKEIDEL------IPKNRLKSSTANSKIG 331



>gb:AX886111_1481564 Sequence 1974 from Patent EP1033401.
          Length = 92

 Score = 39.3 bits (90), Expect = 0.055
 Identities = 18/55 (32%), Positives = 34/55 (61%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDN 395
           +  R+++  K++G +IGK G  ++K+REE+ A I I++      ER+I ++   N
Sbjct: 14  LTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISE--GNCPERIITLAGPTN 66



 Score = 32.3 bits (72), Expect = 6.7
 Identities = 11/35 (31%), Positives = 23/35 (65%)
 Frame = +3

Query: 513 SVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
           ++R L+ G + G +IG  G++++ +R  SGA + +
Sbjct: 15  TIRLLMHGKEVGSIIGKKGESVKKMREESGARINI 49



>gb:CQ783746_1452609 Sequence 3886 from Patent EP1396543.
          Length = 319

 Score = 39.3 bits (90), Expect = 0.055
 Identities = 39/185 (21%), Positives = 75/185 (40%), Gaps = 41/185 (22%)
 Frame = +3

Query: 186 EVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA---DAISR 356
           E++    K  K + ++  +I+  +  +G++IGK G  ++K+ ++T   I I+   D    
Sbjct: 4   EIMHKEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNLKKVEQDTETKITISSLQDLTLY 63

Query: 357 HEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMK-----------AGAGHV 503
           + ER I +     +   C AE    +I+  + +  E+++ AM            A  G  
Sbjct: 64  NPERTITVKGAIEN--CCRAEQ---EIMKKVREAYENDVAAMSLQSHLIPGLNLAAVGLF 118

Query: 504 PANS---------------------------VRFLIAGSQAGGLIGVSGQNIENLRISSG 602
           PA+S                           V+  I     G +IG  GQ+I+ L   + 
Sbjct: 119 PASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAIIGKKGQHIKQLSRFAS 178

Query: 603 ATVTV 617
           A++ +
Sbjct: 179 ASIKI 183



 Score = 34.7 bits (78), Expect = 1.3
 Identities = 30/140 (21%), Positives = 60/140 (42%)
 Frame = +3

Query: 198 PLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVII 377
           P    ++  +  + ++ +P++ +G +IGK G  I+++     A+IKIA   +   +  ++
Sbjct: 137 PYSSFMQAPEQEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPETPDSKVRMV 196

Query: 378 ISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLI 557
           I +   +  F  A+  ++       K  E N      G            +  S AG +I
Sbjct: 197 IITGPPEAQF-KAQGRIYG------KLKEENF----FGPKEEVKLETHIRVPASAAGRVI 245

Query: 558 GVSGQNIENLRISSGATVTV 617
           G  G+ +  L+  + A V V
Sbjct: 246 GKGGKTVNELQNLTAAEVVV 265



>gb:BT001672_1356445 Drosophila melanogaster RE50346 full insert
           cDNA.
          Length = 315

 Score = 39.3 bits (90), Expect = 0.055
 Identities = 18/48 (37%), Positives = 30/48 (62%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           ++ +P +  G +IGK G RI++IR E+ A I I + +    +R+I IS
Sbjct: 246 QVTIPKELAGAIIGKGGGRIRRIRNESSAYITIDEPLPNSNDRIITIS 293



 Score = 32.7 bits (73), Expect = 5.1
 Identities = 16/41 (39%), Positives = 21/41 (51%)
 Frame = +3

Query: 495 GHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
           GH P NS +  I    AG +IG  G  I  +R  S A +T+
Sbjct: 238 GHDPNNSTQVTIPKELAGAIIGKGGGRIRRIRNESSAYITI 278



>gb:AY069684_1294414 Drosophila melanogaster LD45549 full length
           cDNA.
          Length = 238

 Score = 39.3 bits (90), Expect = 0.055
 Identities = 18/48 (37%), Positives = 30/48 (62%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           ++ +P +  G +IGK G RI++IR E+ A I I + +    +R+I IS
Sbjct: 166 QVTIPKELAGAIIGKGGGRIRRIRNESSAYITIDEPLPNSNDRIITIS 213



 Score = 32.7 bits (73), Expect = 5.1
 Identities = 16/41 (39%), Positives = 21/41 (51%)
 Frame = +3

Query: 495 GHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
           GH P NS +  I    AG +IG  G  I  +R  S A +T+
Sbjct: 158 GHDPNNSTQVTIPKELAGAIIGKGGGRIRRIRNESSAYITI 198



>gb:AE013599_1132959 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003791_1224731 Drosophila melanogaster
           chromosome 2R, section 59 of 74 of the complete
           sequence.
          Length = 315

 Score = 39.3 bits (90), Expect = 0.055
 Identities = 18/48 (37%), Positives = 30/48 (62%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           ++ +P +  G +IGK G RI++IR E+ A I I + +    +R+I IS
Sbjct: 246 QVTIPKELAGAIIGKGGGRIRRIRNESSAYITIDEPLPNSNDRIITIS 293



 Score = 32.7 bits (73), Expect = 5.1
 Identities = 16/41 (39%), Positives = 21/41 (51%)
 Frame = +3

Query: 495 GHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
           GH P NS +  I    AG +IG  G  I  +R  S A +T+
Sbjct: 238 GHDPNNSTQVTIPKELAGAIIGKGGGRIRRIRNESSAYITI 278



>gb:AE013599_1132958 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003791_1224730 Drosophila melanogaster
           chromosome 2R, section 59 of 74 of the complete
           sequence.
          Length = 413

 Score = 39.3 bits (90), Expect = 0.055
 Identities = 18/48 (37%), Positives = 30/48 (62%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           ++ +P +  G +IGK G RI++IR E+ A I I + +    +R+I IS
Sbjct: 341 QVTIPKELAGAIIGKGGGRIRRIRNESSAYITIDEPLPNSNDRIITIS 388



 Score = 32.7 bits (73), Expect = 5.1
 Identities = 16/41 (39%), Positives = 21/41 (51%)
 Frame = +3

Query: 495 GHVPANSVRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
           GH P NS +  I    AG +IG  G  I  +R  S A +T+
Sbjct: 333 GHDPNNSTQVTIPKELAGAIIGKGGGRIRRIRNESSAYITI 373



>gb:AJ719508_2501695 Gallus gallus mRNA for hypothetical protein,
           clone 2o21.
          Length = 539

 Score = 38.5 bits (88), Expect = 0.093
 Identities = 35/129 (27%), Positives = 59/129 (45%), Gaps = 5/129 (3%)
 Frame = +3

Query: 249 VPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAESAL 428
           VP K +G +IG+ G +I +I+ E+   I+IA       ER  +++      +   A+  L
Sbjct: 102 VPDKMVGFIIGRGGEQISRIQIESGCKIQIAPDSGGMPERPCVLTGTPE--SIEQAKRLL 159

Query: 429 HQIVTLILKDDESNIEAMKAGAG---HVPANSV--RFLIAGSQAGGLIGVSGQNIENLRI 593
            QIV           +  + G G    V  NS     LI  S+ G +IG  G+ I+ L+ 
Sbjct: 160 GQIV-----------DRCRNGPGFHNDVDGNSTIQEILIPASKVGLVIGKGGETIKQLQE 208

Query: 594 SSGATVTVL 620
            +G  + ++
Sbjct: 209 RTGVKMIMI 217



 Score = 36.2 bits (82), Expect = 0.46
 Identities = 29/134 (21%), Positives = 65/134 (48%), Gaps = 8/134 (5%)
 Frame = +3

Query: 234 VYRIIVPSKQIGKVIGKVGHRIQKIREETRA-TIKIADA-ISRHEERVIIISSKDNDGTF 407
           +  I++P+ ++G VIGK G  I++++E T    I I D  +    ++ + I+     G  
Sbjct: 182 IQEILIPASKVGLVIGKGGETIKQLQERTGVKMIMIQDGPMPTGADKPLRIT-----GDA 236

Query: 408 CDAESALHQIVTLILKDDESNIEAM------KAGAGHVPANSVRFLIAGSQAGGLIGVSG 569
              + A   ++ +I + D+++   +      + G G +  +  RF +     G +IG +G
Sbjct: 237 FKVQQAREMVLEIIREKDQADFRGVRNDFSSRMGGGSIEVSVPRFAV-----GIVIGRNG 291

Query: 570 QNIENLRISSGATV 611
           + I+ ++  +G  +
Sbjct: 292 EMIKKIQNDAGVRI 305



 Score = 34.3 bits (77), Expect = 1.8
 Identities = 34/136 (25%), Positives = 56/136 (41%), Gaps = 13/136 (9%)
 Frame = +3

Query: 243 IIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAES 422
           + VP   +G VIG+ G  I+KI+ +    I+         ERV  +    +       + 
Sbjct: 276 VSVPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGISPERVAQVMGLPDR-----CQH 330

Query: 423 ALHQIVTLILKDDESN---IEAMKAGAGHVPAN----------SVRFLIAGSQAGGLIGV 563
           A H I  LIL   E +     A+  G G    +           + + +   + G +IG 
Sbjct: 331 AAHIISELILTAQERDGFGSLAVARGRGRGRGDWSVGTPGGMQEITYTVPADKCGLVIGK 390

Query: 564 SGQNIENLRISSGATV 611
            G+NI+++   SGA V
Sbjct: 391 GGENIKSINQQSGAHV 406



>gb:HSM808636_1188017 Homo sapiens mRNA; cDNA DKFZp686F1078 (from
           clone DKFZp686F1078).
          Length = 198

 Score = 38.5 bits (88), Expect = 0.093
 Identities = 36/152 (23%), Positives = 70/152 (46%), Gaps = 3/152 (1%)
 Frame = +3

Query: 171 AGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAI 350
           +G  + + PP  +  +   + V+ + +P+  +G +IGK G  I+++     A+IKIA A 
Sbjct: 6   SGPPSAMTPPYPQFEQSETETVH-LFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAE 64

Query: 351 SRHEERVIIISSKDNDGTFCDAESALHQIV---TLILKDDESNIEAMKAGAGHVPANSVR 521
           +   +  ++I +   +  F  A+  ++  +     +   +E  +EA      H+ A S  
Sbjct: 65  APDAKVRMVIITGPPEAQF-KAQGRIYGKIKEENFVSPKEEVKLEA------HIRAPSF- 116

Query: 522 FLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
                  AG +IG  G+ +  L+  S A V V
Sbjct: 117 ------AAGRVIGKGGKTVNELQNLSSAEVVV 142



>gb:BC044277_2548610 Xenopus laevis far upstream element (FUSE)
           binding protein 1, mRNA (cDNA clone MGC:53183
           IMAGE:5543059), complete cds.
          Length = 653

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 42/179 (23%), Positives = 72/179 (40%), Gaps = 10/179 (5%)
 Frame = +3

Query: 105 DPYKSTTAKRRRDEDAFEATDEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGK 284
           DPYK   AK    E   E   + G   E+      R+  ++ I   + +P   +G VIG+
Sbjct: 228 DPYKVQQAK----EMVLELIRDQGGFREIRNEYGSRIGANEGI--DVPIPRFAVGIVIGR 281

Query: 285 VGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDE 464
            G  I+KI+ +    I+         ER+  I+    DG    AE  ++ ++  +   + 
Sbjct: 282 SGEMIKKIQNDAGVRIQFKPDDGSVPERIAQITGPQ-DGCQHAAE-IINDLLRSVQSGNA 339

Query: 465 SNIEAMKAGAGHVPAN----------SVRFLIAGSQAGGLIGVSGQNIENLRISSGATV 611
                   G G    N             F++   + G +IG  G+ I+N+  +SGA +
Sbjct: 340 GGPGPGGRGRGRGQGNWNMGPPGGLQEFNFVVPTVKTGLIIGKGGETIKNISQTSGARI 398



>gb:AY505473_1609843 Chlamydomonas reinhardtii circadian RNA-binding
           protein CHLAMY 1 subunit C1 mRNA, partial cds.
          Length = 488

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 46/190 (24%), Positives = 77/190 (40%), Gaps = 12/190 (6%)
 Frame = +3

Query: 84  GAPSTEDDPYKSTTAKRRRDEDAFEATDEAGTSAEVV-----------PPLKKRVKVSQD 230
           GA     DP   T  KR+ D+D +    ++   A +            PPL     V+ +
Sbjct: 45  GANVVPSDP---TGHKRKLDDDEYHDAPDSKRPASMAFGDGSGALPPPPPLGADAPVAME 101

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFC 410
               I+ P  ++G+VIG+ G  I+ +   T   I++ D  +  ++ V I    D      
Sbjct: 102 T---IMCPPDKVGRVIGRAGATIRDLEASTGTRIQV-DHKAPGDKPVTISGRAD------ 151

Query: 411 DAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFL-IAGSQAGGLIGVSGQNIENL 587
           + E A  Q++ L        I    + A   P  + + L       G +IG  G+ I  L
Sbjct: 152 EVERAKRQVLDL--------ISGHGSDAAPAPGEAQKTLECPQGIVGRVIGRGGETIRTL 203

Query: 588 RISSGATVTV 617
           + +SGA + V
Sbjct: 204 QQASGAHILV 213



>pir|T19217|T19217 hypothetical protein C12D8.1b - Caenorhabditis
           elegans>gb:CEC12D8_1360380 Caenorhabditis elegans cosmid
           C12D8, complete sequence.
          Length = 611

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 33/130 (25%), Positives = 57/130 (43%), Gaps = 9/130 (6%)
 Frame = +3

Query: 243 IIVPSKQIGKVIGKVGHRIQKIREETRATI--KIADAISRHEERVIIISSKDNDGTFCDA 416
           ++VP   +G +IGK G  I+++  ET   I  K  D  S  E   +I+ ++D        
Sbjct: 253 VVVPRSSVGIIIGKQGDTIKRLAMETGTKIQFKPDDDPSTPERCAVIMGTRD------QI 306

Query: 417 ESALHQIVTLILKDDESNIEAMKAGAGHV-------PANSVRFLIAGSQAGGLIGVSGQN 575
             A  +I  L+ K         + G G+V        A++    +  ++ G +IG  G+ 
Sbjct: 307 YRATERITELVKKS-----TMQQGGGGNVAGAMVSNEASTFYMSVPAAKCGLVIGKGGET 361

Query: 576 IENLRISSGA 605
           I+ +   SGA
Sbjct: 362 IKQINSESGA 371



>pir|T19216|T19216 hypothetical protein C12D8.1a - Caenorhabditis
           elegans>gb:CEC12D8_1360379 Caenorhabditis elegans cosmid
           C12D8, complete sequence.
          Length = 589

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 33/130 (25%), Positives = 57/130 (43%), Gaps = 9/130 (6%)
 Frame = +3

Query: 243 IIVPSKQIGKVIGKVGHRIQKIREETRATI--KIADAISRHEERVIIISSKDNDGTFCDA 416
           ++VP   +G +IGK G  I+++  ET   I  K  D  S  E   +I+ ++D        
Sbjct: 231 VVVPRSSVGIIIGKQGDTIKRLAMETGTKIQFKPDDDPSTPERCAVIMGTRD------QI 284

Query: 417 ESALHQIVTLILKDDESNIEAMKAGAGHV-------PANSVRFLIAGSQAGGLIGVSGQN 575
             A  +I  L+ K         + G G+V        A++    +  ++ G +IG  G+ 
Sbjct: 285 YRATERITELVKKS-----TMQQGGGGNVAGAMVSNEASTFYMSVPAAKCGLVIGKGGET 339

Query: 576 IENLRISSGA 605
           I+ +   SGA
Sbjct: 340 IKQINSESGA 349



>pir|T49942|T49942 hypothetical protein F17I14.250 - Arabidopsis
           thaliana>gb:ATF17I14_1548930 Arabidopsis thaliana DNA
           chromosome 5, BAC clone F17I14 (ESSA project).
          Length = 567

 Score = 38.1 bits (87), Expect = 0.12
 Identities = 36/153 (23%), Positives = 71/153 (46%), Gaps = 5/153 (3%)
 Frame = +3

Query: 177 TSAEVVPP--LKKRVKVSQDIVYRI---IVPSKQIGKVIGKVGHRIQKIREETRATIKIA 341
           TSA   PP  +K+ ++ S+D + ++   I+ S +   V+ K        R  T A+I + 
Sbjct: 292 TSASKNPPVTIKQPLQASKDDIRQVDLKILCSNESASVVIKT-------RSVTDASISVG 344

Query: 342 DAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVR 521
           D     +ER++ I++ +      D  S   + + L+  +   N  A    +G   + + R
Sbjct: 345 DRHPDCDERLVTITAFEKTK---DITSESQRALVLVFSNMYENATAKVLDSGLTSSITAR 401

Query: 522 FLIAGSQAGGLIGVSGQNIENLRISSGATVTVL 620
            ++  +Q   L+G  G+    ++  +GA +TVL
Sbjct: 402 LVVRSNQINCLLGEEGRIKTTIQQRTGAFITVL 434



>gb:BT012113_1641320 Arabidopsis thaliana At2g03110 gene, complete
           cds.>gb:BT012369_1641520 Arabidopsis thaliana At2g03110
           mRNA, complete cds.
          Length = 153

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 29/81 (35%), Positives = 43/81 (53%), Gaps = 8/81 (9%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI--------ADAISRHEERVIIISS 386
           +  R++VPS QIG +IGK G  IQ +R +T A I++        A A+S H+E + II  
Sbjct: 73  VTVRMLVPSDQIGYLIGKGGPIIQTLRNDTNAQIRVRNDNLPMCALALS-HDELLQII-- 129

Query: 387 KDNDGTFCDAESALHQIVTLI 449
               G       AL+Q+  L+
Sbjct: 130 ----GDPSAVREALYQVAFLL 146



>gb:AL589765_1929173 Human DNA sequence from clone RP11-98D18 on
           chromosome 1 Contains the 3' end of the SNX27 gene for
           sorting nexin family member 27, the TNRC4 gene for
           trinucleotide repeat containing 4, five novel genes, a
           ribosomal protein S11 (RPS11) pseudogene, the MRPL9 gene
           for mitochondrial ribosomal protein L9, the OAZ3 gene
           for ornithine decarboxylase antizyme 3, a novel gene
           (FLJ36032) the TDRKH gene for tudor and KH domain
           containing, the RORC gene for RAR-related orphan
           receptor C and four CpG islands, complete sequence.
          Length = 557

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 37/129 (28%), Positives = 62/129 (48%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTF 407
           DI   + VP + +  +IG+ G  I+    +T A I + D     +ERV++IS        
Sbjct: 52  DIEIEMRVPQEAVKLIIGRQGANIK----QTGARIDV-DTEDVGDERVLLISGFPVQ--V 104

Query: 408 CDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSGQNIENL 587
           C A++A+HQI+T     + + +    +    VP  SV         G +IG  G+ I ++
Sbjct: 105 CKAKAAIHQILT-----ENTPVSEQLS----VPQRSV---------GRIIGRGGETIRSI 146

Query: 588 RISSGATVT 614
             +SGA +T
Sbjct: 147 CKASGAKIT 155



>gb:AE016818_1748331 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 316

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 34/138 (24%), Positives = 59/138 (42%), Gaps = 3/138 (2%)
 Frame = +3

Query: 213 VKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADA-ISRHEERVIIISSK 389
           +KV Q    R+IV + Q+  +IG  G +I+K+ +   + + ++   +   ++R++ I   
Sbjct: 138 MKVKQIGNLRLIVTNSQVSSIIGTAGSKIKKLIDTHSSKLVVSKTFLPDSQDRILEIQGF 197

Query: 390 DNDGTFC--DAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGV 563
            N    C  D    L +   L  K+      +  +   HV A      I     G L+G 
Sbjct: 198 PNSIANCIKDISQTLIKDDVLDTKEKRYYPHSKHSKDIHVTATVA---IPAEYVGALLGH 254

Query: 564 SGQNIENLRISSGATVTV 617
            G  I NLR  +   +TV
Sbjct: 255 GGNRIANLRKYTRTKITV 272



>gb:OSJN00087_1694663 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0084K11, complete sequence.
          Length = 238

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 35/138 (25%), Positives = 56/138 (40%), Gaps = 18/138 (13%)
 Frame = +3

Query: 126 AKRRRDEDAFEATDEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQK 305
           A RRR+EDA +  + A   AE      +R+  ++        PSK   +   +VG    K
Sbjct: 48  AARRREEDAEKRAEAAARKAE-----NRRLAEAEAASASASAPSKTAARKASRVGAPAPK 102

Query: 306 IRE----------------ETRATIKIADAISRHE--ERVIIISSKDNDGTFCDAESALH 431
           + E                E  A  K A   +  E  ERV+++++ + D +  +A S   
Sbjct: 103 VTEAELARRREDERLRLEREPEAAKKRAARTAEEEEYERVVLVANTNRDDSIIEARSVDE 162

Query: 432 QIVTLILKDDESNIEAMK 485
            I  + L D E  + A K
Sbjct: 163 AIARMSLVDSEGALPADK 180



>pir|T02715|T02715 probable RNA-binding protein [imported] -
           Arabidopsis thaliana>gb:AC005313_1532556 Arabidopsis
           thaliana chromosome 2 clone T18E12 map CIC11A04,
           complete sequence.
          Length = 155

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 17/36 (47%), Positives = 25/36 (69%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKI 338
           +  R++VPS QIG +IGK G  IQ +R +T A I++
Sbjct: 73  VTVRMLVPSDQIGYLIGKGGPIIQTLRNDTNAQIRV 108



>gb:HSM806899_1187767 Homo sapiens mRNA; cDNA DKFZp686K2175 (from
           clone DKFZp686K2175).
          Length = 198

 Score = 37.0 bits (84), Expect = 0.27
 Identities = 35/152 (23%), Positives = 69/152 (45%), Gaps = 3/152 (1%)
 Frame = +3

Query: 171 AGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAI 350
           +G  + + PP  +  +   + V+ + +P+  +G +IGK G  I+++     A+IKIA A 
Sbjct: 6   SGPPSAMTPPYPQFEQSETETVH-LFIPALSVGAIIGKQGQHIKQLSRFAGASIKIAPAE 64

Query: 351 SRHEERVIIISSKDNDGTFCDAESALHQIV---TLILKDDESNIEAMKAGAGHVPANSVR 521
           +   +  ++I +   +  F  A+  ++  +     +   +E  +EA      H+   S  
Sbjct: 65  APDAKVRMVIITGPPEAQF-KAQGRIYGKIKEENFVSPKEEVKLEA------HIRVPSF- 116

Query: 522 FLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
                  AG +IG  G+ +  L+  S A V V
Sbjct: 117 ------AAGRVIGKGGKTVNELQNLSSAEVVV 142



>gb:BC060400_2552868 Xenopus laevis hypothetical protein MGC68532,
           mRNA (cDNA clone MGC:68532 IMAGE:4031000), complete cds.
          Length = 546

 Score = 36.6 bits (83), Expect = 0.35
 Identities = 28/129 (21%), Positives = 64/129 (49%), Gaps = 3/129 (2%)
 Frame = +3

Query: 234 VYRIIVPSKQIGKVIGKVGHRIQKIREETRA-TIKIADA-ISRHEERVIIISSKDNDGTF 407
           V  I++P+ ++G VIGK G  I++++E T    I I D  +    ++ + I+     G  
Sbjct: 165 VQEILIPASKVGLVIGKGGETIKQLQERTGVKMIMIQDGPLPTGADKPLRIT-----GDP 219

Query: 408 CDAESALHQIVTLILKDDESNIEAMKAG-AGHVPANSVRFLIAGSQAGGLIGVSGQNIEN 584
              + A   ++ +I + D+++   +++  +  +   SV   +     G +IG +G+ I+ 
Sbjct: 220 FKVQQARDLVLEIIREKDQADFRGIRSDFSSRIGGGSVEVSVPRFAVGIIIGRNGEMIKK 279

Query: 585 LRISSGATV 611
           ++  +G  +
Sbjct: 280 IQNDAGVRI 288



 Score = 36.2 bits (82), Expect = 0.46
 Identities = 33/129 (25%), Positives = 59/129 (45%), Gaps = 5/129 (3%)
 Frame = +3

Query: 249 VPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAESAL 428
           VP K +G +IG+ G +I +I+ E+   I+IA       ER  +++      +   A+  L
Sbjct: 85  VPDKMVGFIIGRGGEQISRIQAESGCKIQIAPDSGGMPERPCVLTGTPE--SIEQAKRLL 142

Query: 429 HQIVTLILKDDESNIEAMKAGAG---HVPANSV--RFLIAGSQAGGLIGVSGQNIENLRI 593
            QIV           +  + G G    +  +S     LI  S+ G +IG  G+ I+ L+ 
Sbjct: 143 GQIV-----------DRCRNGPGFHNDMDGSSTVQEILIPASKVGLVIGKGGETIKQLQE 191

Query: 594 SSGATVTVL 620
            +G  + ++
Sbjct: 192 RTGVKMIMI 200



 Score = 35.0 bits (79), Expect = 1.0
 Identities = 33/136 (24%), Positives = 56/136 (41%), Gaps = 13/136 (9%)
 Frame = +3

Query: 243 IIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAES 422
           + VP   +G +IG+ G  I+KI+ +    I+         ERV  +    +       + 
Sbjct: 259 VSVPRFAVGIIIGRNGEMIKKIQNDAGVRIQFKPDDGLSPERVAQVMGLPDR-----CQH 313

Query: 423 ALHQIVTLILKDDESNIE---AMKAGAGHVPAN----------SVRFLIAGSQAGGLIGV 563
           A H I  LIL   E +     ++  G G    +           + + +   + G +IG 
Sbjct: 314 AAHIINELILTAQERDGFGGLSLARGRGRSRGDWNLSTPGSMQEINYTVPADKCGLVIGK 373

Query: 564 SGQNIENLRISSGATV 611
            G+NI+N+   SGA V
Sbjct: 374 GGENIKNINQQSGAHV 389



>gb:AL354733_1923326 Human DNA sequence from clone RP11-575L7 on
           chromosome 9 Contains the 5' end of the gene for protein
           kinase anchoring protein GKAP42 (FKSG21), a novel gene
           (DKFZp43D0917), a novel gene (MGC10999), the HNRPK gene
           for heterogeneous nuclear ribonucleoprotein K (CSBP,
           TUNP, HNRNPK), three novel genes, the 5' UTR of a novel
           gene (FLJ12888) and six CpG islands, complete sequence.
          Length = 306

 Score = 36.6 bits (83), Expect = 0.35
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 1/62 (1%)
 Frame = +3

Query: 228 DIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHE-ERVIIISSKDNDGT 404
           D   R+++     G +IG  G +I+++RE T+ TIK+      H  +RV++I  K +   
Sbjct: 75  DCELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLIGGKPDRVV 134

Query: 405 FC 410
            C
Sbjct: 135 EC 136



>gb:AX880689_1478378 Sequence 15594 from Patent EP1074617.
          Length = 230

 Score = 36.6 bits (83), Expect = 0.35
 Identities = 17/54 (31%), Positives = 33/54 (61%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           +Q   + + +P+  IG +IG+ G +I +IR+ + A IKIA+ +    +R + I+
Sbjct: 150 AQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTIT 203



>gb:SSHNRNP_1445413 S.scrofa mRNA for heterogeneous nuclear
           ribonucleoprotein.
          Length = 135

 Score = 36.6 bits (83), Expect = 0.35
 Identities = 17/54 (31%), Positives = 33/54 (61%)
 Frame = +3

Query: 222 SQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIIS 383
           +Q   + + +P+  IG +IG+ G +I +IR+ + A IKIA+ +    +R + I+
Sbjct: 55  AQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTIT 108



>gb:AE012920_287116 Chlorobium tepidum TLS section 141 of 194 of the
           complete genome.>gb:AE006470_934284 Chlorobium tepidum
           TLS complete genome.
          Length = 733

 Score = 36.6 bits (83), Expect = 0.35
 Identities = 29/97 (29%), Positives = 44/97 (45%)
 Frame = +3

Query: 183 AEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHE 362
           AE +P  +  +      +  I +P   IG VIGK G  I+ I EET A I I D      
Sbjct: 555 AEAIPESRADIGKYAPRLTTIQIPVDAIGMVIGKGGETIRSITEETGAEINIDD------ 608

Query: 363 ERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNI 473
           +  + I+    + T    ++A+  I TL+ K +   I
Sbjct: 609 DGTVTIACSSPEAT----KAAVETIKTLVSKPEVGTI 641



>pir|T25832|T25832 hypothetical protein M01A10.1 - Caenorhabditis
           elegans>gb:U88174_1406659 Caenorhabditis elegans cosmid
           M01A10, complete sequence.
          Length = 680

 Score = 36.6 bits (83), Expect = 0.35
 Identities = 32/126 (25%), Positives = 55/126 (43%), Gaps = 1/126 (0%)
 Frame = +3

Query: 213 VKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVI-IISSK 389
           V  S  +   I +P+ + G +IGK G +++K+R  T       D I   E  +   +   
Sbjct: 237 VSNSSKVTIIIPIPANKCGAIIGKKGEQMRKLRSWTN-----CDFILIQENNIADSVKPL 291

Query: 390 DNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAGGLIGVSG 569
              G   + E A   +  ++   DE     M AG   V A S++  +  S  G ++G+ G
Sbjct: 292 QITGQPKEVEHAKALVADILDGFDECPPAGM-AGNSPVAAMSLQVKVPRSTVGAIMGLQG 350

Query: 570 QNIENL 587
            NI+ +
Sbjct: 351 SNIKKI 356



>gb:BC070981_2555855 Xenopus laevis cDNA clone MGC:78835
           IMAGE:3402728, complete cds.
          Length = 653

 Score = 36.2 bits (82), Expect = 0.46
 Identities = 42/180 (23%), Positives = 70/180 (38%), Gaps = 11/180 (6%)
 Frame = +3

Query: 105 DPYKSTTAKRRRDEDAFEATDEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGK 284
           DPYK   AK    E   E   + G   EV      R+  ++ I   + +P   +G VIG+
Sbjct: 228 DPYKVQQAK----EMVLELICDQGGFREVRNEYGSRIGGNEGI--DVPIPRFAVGIVIGR 281

Query: 285 VGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCD-AESALHQIVTLILKDD 461
            G  I+KI+ +    I+         ERV  I+   +    C  A   ++ ++  +   +
Sbjct: 282 NGEMIKKIQNDAGVRIQFKPDDGSTPERVAQITGPQDR---CQHAAEIVNDLLRSVQSGN 338

Query: 462 ESNIEAMKAGAGHVPAN----------SVRFLIAGSQAGGLIGVSGQNIENLRISSGATV 611
                    G G    N             F++   + G +IG  G+ I+N+   SGA +
Sbjct: 339 AGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFVVPSVKTGLIIGKGGETIKNISQQSGARI 398



>gb:AE017349_1758721 Cryptococcus neoformans var. neoformans JEC21
            chromosome 9, complete sequence.
          Length = 1289

 Score = 36.2 bits (82), Expect = 0.46
 Identities = 36/144 (25%), Positives = 60/144 (41%)
 Frame = +3

Query: 171  AGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAI 350
            A   AE++       +  Q+  ++  VPSK + +++GK G  I  I+ +T A I I    
Sbjct: 824  AAAKAELLEAAAFETESRQEATFK--VPSKAVAQIVGKGGATINAIKNDTGAQIDIER-- 879

Query: 351  SRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLI 530
               E++   I+ + +      A+ A+  +V  I   DE  +E                 I
Sbjct: 880  EGGEDKQTTITVRGDKQAIAAAKEAVLNVVKEI--GDEITVE---------------LTI 922

Query: 531  AGSQAGGLIGVSGQNIENLRISSG 602
                   LIG  GQN+ +L  S+G
Sbjct: 923  EQKYHRNLIGQGGQNLRDLIASAG 946



>gb:AE014187_938616 Plasmodium falciparum 3D7 chromosome 14 complete
           sequence.>gb:AE014818_1227692 Plasmodium falciparum 3D7
           chromosome 14 section 3 of 13 of the complete sequence.
          Length = 337

 Score = 36.2 bits (82), Expect = 0.46
 Identities = 21/73 (28%), Positives = 37/73 (50%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAE 419
           RI+VP   +  +IGK G +I+++++ T + I+I+       ER+I I      G+F    
Sbjct: 113 RIVVPKSAVSAIIGKGGQQIKQLQDSTGSKIQISSREDGLNERIITII-----GSFESIR 167

Query: 420 SALHQIVTLILKD 458
               ++   I KD
Sbjct: 168 DTALKVANSIQKD 180



>gb:U80444_1406263 Caenorhabditis elegans cosmid F26B1, complete
           sequence.
          Length = 380

 Score = 35.8 bits (81), Expect = 0.60
 Identities = 26/119 (21%), Positives = 51/119 (42%), Gaps = 11/119 (9%)
 Frame = +3

Query: 186 EVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEE 365
           +V+P L+           R++V     G +IG+ G +I+++RE+  A +KI    +    
Sbjct: 93  DVLPRLEDNFSERDPCEVRMLVHQSHAGALIGRNGSKIKELREKCSARLKIFTGCAPGST 152

Query: 366 RVIIISSKDNDGTFCDAESALHQIVTLILKD-----------DESNIEAMKAGAGHVPA 509
             ++I+S +        E  + ++  + +K            D SNI       G++PA
Sbjct: 153 DRVLITSGEQKNVLGIIEEVMKELKEIPIKGSATPYLPAFNYDPSNISDYGGFPGNMPA 211



 Score = 33.5 bits (75), Expect = 3.0
 Identities = 21/67 (31%), Positives = 35/67 (52%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAE 419
           ++ +PS   G +IG+ G RI +IR+E+ A I +  +  + E    II+ K  +     A+
Sbjct: 303 QVTIPSDLGGTIIGRGGERIARIRQESGAQITLEQSNGQPER---IITIKGTEQQIHSAQ 359

Query: 420 SALHQIV 440
             L Q V
Sbjct: 360 YLLQQCV 366



 Score = 32.0 bits (71), Expect = 8.7
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = +3

Query: 516 VRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
           VR L++   AG +IG  G+NI+ LR    A V V
Sbjct: 35  VRLLVSSKSAGAIIGKGGENIKRLRAEFNAHVQV 68



>gb:CR861335_1185338 Pongo pygmaeus mRNA; cDNA DKFZp459K2011 (from
           clone DKFZp459K2011).
          Length = 275

 Score = 35.8 bits (81), Expect = 0.60
 Identities = 29/104 (27%), Positives = 48/104 (46%), Gaps = 1/104 (0%)
 Frame = +3

Query: 258 KQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAESALHQI 437
           KQ G+V    GHR QK +E  R   +  +A +R +  ++  SS  +    CD+ ++    
Sbjct: 163 KQNGRVAKVKGHRSQKHKERIRLLRQKREAAARKKYNLLQDSSTSDSDLTCDSSTSSSD- 221

Query: 438 VTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQAG-GLIGVS 566
                 DDE    + K     +P     +++   QAG GL+G+S
Sbjct: 222 ------DDEEVSGSSKTITAEIPETGFCYVV---QAGLGLLGLS 256



>pir|T30168|T30168 hypothetical protein F26B1.2 - Caenorhabditis
           elegans>gb:U80444_1406261 Caenorhabditis elegans cosmid
           F26B1, complete sequence.
          Length = 397

 Score = 35.8 bits (81), Expect = 0.60
 Identities = 26/119 (21%), Positives = 51/119 (42%), Gaps = 11/119 (9%)
 Frame = +3

Query: 186 EVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEE 365
           +V+P L+           R++V     G +IG+ G +I+++RE+  A +KI    +    
Sbjct: 110 DVLPRLEDNFSERDPCEVRMLVHQSHAGALIGRNGSKIKELREKCSARLKIFTGCAPGST 169

Query: 366 RVIIISSKDNDGTFCDAESALHQIVTLILKD-----------DESNIEAMKAGAGHVPA 509
             ++I+S +        E  + ++  + +K            D SNI       G++PA
Sbjct: 170 DRVLITSGEQKNVLGIIEEVMKELKEIPIKGSATPYLPAFNYDPSNISDYGGFPGNMPA 228



 Score = 33.5 bits (75), Expect = 3.0
 Identities = 21/67 (31%), Positives = 35/67 (52%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAE 419
           ++ +PS   G +IG+ G RI +IR+E+ A I +  +  + E    II+ K  +     A+
Sbjct: 320 QVTIPSDLGGTIIGRGGERIARIRQESGAQITLEQSNGQPER---IITIKGTEQQIHSAQ 376

Query: 420 SALHQIV 440
             L Q V
Sbjct: 377 YLLQQCV 383



 Score = 32.0 bits (71), Expect = 8.7
 Identities = 15/34 (44%), Positives = 20/34 (58%)
 Frame = +3

Query: 516 VRFLIAGSQAGGLIGVSGQNIENLRISSGATVTV 617
           VR L++   AG +IG  G+NI+ LR    A V V
Sbjct: 52  VRLLVSSKSAGAIIGKGGENIKRLRAEFNAHVQV 85



>gb:BC063902_2553605 Xenopus tropicalis hypothetical protein
           MGC75632, mRNA (cDNA clone MGC:75632 IMAGE:5379441),
           complete cds.
          Length = 653

 Score = 35.4 bits (80), Expect = 0.79
 Identities = 40/180 (22%), Positives = 70/180 (38%), Gaps = 11/180 (6%)
 Frame = +3

Query: 105 DPYKSTTAKRRRDEDAFEATDEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGK 284
           DPYK   AK    E   E   + G   E+      R+  ++ I   + +P   +G VIG+
Sbjct: 228 DPYKVQQAK----EMVLELIRDQGGFREIRNEYGSRIGGNEGI--DVPIPRFAVGIVIGR 281

Query: 285 VGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCD-AESALHQIVTLILKDD 461
            G  I+KI+ +    I+         ER+  I+   +    C  A   ++ ++  +   +
Sbjct: 282 NGEMIKKIQNDAGVRIQFKPDDGSTPERIAQITGPQDR---CQHAAEIINDLLRSVQSGN 338

Query: 462 ESNIEAMKAGAGHVPAN----------SVRFLIAGSQAGGLIGVSGQNIENLRISSGATV 611
                    G G    N             F++   + G +IG  G+ I+N+   SGA +
Sbjct: 339 AGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFVVPTVKTGLIIGKGGETIKNISQQSGARI 398



>gb:AX876322_1476475 Sequence 11227 from Patent EP1074617.
          Length = 243

 Score = 35.4 bits (80), Expect = 0.79
 Identities = 13/31 (41%), Positives = 23/31 (74%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIREETR 323
           +  R+++P+ Q G +IGK G +I++IRE T+
Sbjct: 25  VTLRLVIPASQCGSLIGKAGTKIKEIREVTK 55



 Score = 34.7 bits (78), Expect = 1.3
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = +3

Query: 189 VVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEER 368
           VVP L    + S       +VP+  IG VIG+ G +I +IR+ + A IKI +      ER
Sbjct: 71  VVPGLDPGTQTSSQ---EFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGAGER 127

Query: 369 VIIIS 383
            + I+
Sbjct: 128 HVTIT 132



>sp|Q58928|YF33_METJA Hypothetical protein MJ1533.>pir|D64491|D64491
           hypothetical protein homolog MJ1533 - Methanococcus
           jannaschii>gb:U67594_207652 Methanocaldococcus
           jannaschii DSM 2661 section 136 of 150 of the complete
           genome.>gb:L77117_1100410 Methanocaldococcus jannaschii
           DSM 2661, complete genome.
          Length = 642

 Score = 35.0 bits (79), Expect = 1.0
 Identities = 19/54 (35%), Positives = 27/54 (50%)
 Frame = +3

Query: 204 KKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEE 365
           K  VKV+ D    +IVP K IG +IGK G  I K+ +     I + +     E+
Sbjct: 502 KPMVKVTGDNSIDLIVPEKYIGAIIGKGGKEISKLEDMLGLKISVKEKEKEEEK 555



>gb:AF257770_1893221 Homo sapiens RNA binding protein MCG10 mRNA,
           complete cds, alternatively spliced.>gb:AF257772_1893223
           Homo sapiens RNA binding protein MCG10 gene, complete
           cds, alternatively spliced.
          Length = 424

 Score = 34.7 bits (78), Expect = 1.3
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = +3

Query: 189 VVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEER 368
           VVP L    + S       +VP+  IG VIG+ G +I +IR+ + A IKI +      ER
Sbjct: 252 VVPGLDPGTQTSSQ---EFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGAGER 308

Query: 369 VIIIS 383
            + I+
Sbjct: 309 HVTIT 313



 Score = 33.5 bits (75), Expect = 3.0
 Identities = 12/28 (42%), Positives = 21/28 (75%)
 Frame = +3

Query: 231 IVYRIIVPSKQIGKVIGKVGHRIQKIRE 314
           +  R+++P+ Q G +IGK G +I++IRE
Sbjct: 68  VTLRLVIPASQCGSLIGKAGTKIKEIRE 95



>gb:AF141340_1885886 Homo sapiens LYST-interacting protein LIP4
           mRNA, partial cds.
          Length = 276

 Score = 34.7 bits (78), Expect = 1.3
 Identities = 23/65 (35%), Positives = 34/65 (52%)
 Frame = +3

Query: 189 VVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEER 368
           VVP L    + S       +VP+  IG VIG+ G +I +IR+ + A IKI +      ER
Sbjct: 74  VVPGLDPGTQTSSQ---EFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEGAGER 130

Query: 369 VIIIS 383
            + I+
Sbjct: 131 HVTIT 135



>gb:AF305618_2062275 Rattus norvegicus nuclear RNA binding protein
           SLM-1 mRNA, complete cds.
          Length = 349

 Score = 34.3 bits (77), Expect = 1.8
 Identities = 21/93 (22%), Positives = 45/93 (48%), Gaps = 6/93 (6%)
 Frame = +3

Query: 207 KRVKVSQDIVYRIIVPSKQ------IGKVIGKVGHRIQKIREETRATIKIADAISRHEER 368
           K +K+S+    R+++P KQ      +GK++G  G+ +++++EET A + I    S  ++ 
Sbjct: 56  KNIKLSE----RVLIPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKA 111

Query: 369 VIIISSKDNDGTFCDAESALHQIVTLILKDDES 467
                 K  +  +      LH ++ +     E+
Sbjct: 112 KEEELRKSGEAKYAHLSDELHVLIEVFAPPGEA 144



>gb:AF098796_2054420 Mus musculus SLM-1 (Slm1) mRNA, complete cds.
          Length = 349

 Score = 34.3 bits (77), Expect = 1.8
 Identities = 21/93 (22%), Positives = 45/93 (48%), Gaps = 6/93 (6%)
 Frame = +3

Query: 207 KRVKVSQDIVYRIIVPSKQ------IGKVIGKVGHRIQKIREETRATIKIADAISRHEER 368
           K +K+S+    R+++P KQ      +GK++G  G+ +++++EET A + I    S  ++ 
Sbjct: 56  KNIKLSE----RVLIPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKT 111

Query: 369 VIIISSKDNDGTFCDAESALHQIVTLILKDDES 467
                 K  +  +      LH ++ +     E+
Sbjct: 112 KEEELRKSGEAKYAHLSDELHVLIEVFAPPGEA 144



>gb:U05040_2042606 Homo sapiens FUSE binding protein mRNA, complete
           cds.
          Length = 644

 Score = 34.3 bits (77), Expect = 1.8
 Identities = 42/183 (22%), Positives = 71/183 (38%), Gaps = 14/183 (7%)
 Frame = +3

Query: 105 DPYKSTTAKRRRDEDAFEATDEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGK 284
           DPYK   AK    E   E   + G   EV      R+  ++ I   + +P   +G VIG+
Sbjct: 240 DPYKVQQAK----EMVLELIRDQGGFREVRNEYGSRIGGNEGI--DVPIPRFAVGIVIGR 293

Query: 285 VGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDE 464
            G  I+KI+ +    I+         ER+  I+         D      +I+T +L+  +
Sbjct: 294 NGEMIKKIQNDAGVRIQFKPDDGTTPERIAQITGPP------DRCQHAAEIITDLLRSVQ 347

Query: 465 SNIEAMKA----GAGHVPAN----------SVRFLIAGSQAGGLIGVSGQNIENLRISSG 602
           +           G G    N             F++   + G +IG  G+ I+++   SG
Sbjct: 348 AGNPGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIGKGGETIKSISQQSG 407

Query: 603 ATV 611
           A +
Sbjct: 408 ARI 410



>gb:BC034043_1981185 Homo sapiens KH domain containing, RNA binding,
           signal transduction associated 2, mRNA (cDNA clone
           MGC:26664 IMAGE:4796658), complete cds.
          Length = 349

 Score = 34.3 bits (77), Expect = 1.8
 Identities = 21/93 (22%), Positives = 45/93 (48%), Gaps = 6/93 (6%)
 Frame = +3

Query: 207 KRVKVSQDIVYRIIVPSKQ------IGKVIGKVGHRIQKIREETRATIKIADAISRHEER 368
           K +K+S+    R+++P KQ      +GK++G  G+ +++++EET A + I    S  ++ 
Sbjct: 56  KNIKLSE----RVLIPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKA 111

Query: 369 VIIISSKDNDGTFCDAESALHQIVTLILKDDES 467
                 K  +  +      LH ++ +     E+
Sbjct: 112 KEEELRKSGEAKYAHLSDELHVLIEVFAPPGEA 144



>gb:BC017247_1975988 Homo sapiens far upstream element (FUSE)
           binding protein 1, mRNA (cDNA clone MGC:29580
           IMAGE:4891583), complete cds.
          Length = 653

 Score = 34.3 bits (77), Expect = 1.8
 Identities = 42/183 (22%), Positives = 71/183 (38%), Gaps = 14/183 (7%)
 Frame = +3

Query: 105 DPYKSTTAKRRRDEDAFEATDEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGK 284
           DPYK   AK    E   E   + G   EV      R+  ++ I   + +P   +G VIG+
Sbjct: 239 DPYKVQQAK----EMVLELIRDQGGFREVRNEYGSRIGGNEGI--DVPIPRFAVGIVIGR 292

Query: 285 VGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDE 464
            G  I+KI+ +    I+         ER+  I+         D      +I+T +L+  +
Sbjct: 293 NGEMIKKIQNDAGVRIQFKPDDGTTPERIAQITGPP------DRCQHAAEIITDLLRSVQ 346

Query: 465 SNIEAMKA----GAGHVPAN----------SVRFLIAGSQAGGLIGVSGQNIENLRISSG 602
           +           G G    N             F++   + G +IG  G+ I+++   SG
Sbjct: 347 AGNPGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIGKGGETIKSISQQSG 406

Query: 603 ATV 611
           A +
Sbjct: 407 ARI 409



>gb:BC001325_1967489 Homo sapiens, clone IMAGE:3456579, mRNA,
           partial cds.
          Length = 372

 Score = 34.3 bits (77), Expect = 1.8
 Identities = 37/138 (26%), Positives = 56/138 (40%), Gaps = 15/138 (10%)
 Frame = +3

Query: 243 IIVPSKQIGKVIGKVGHRIQKIREET--RATIKIADAISRHEERVIIISSKDNDGTFCDA 416
           + VP   +G VIG+ G  I+KI+ +   R   K  D IS  E    ++   D        
Sbjct: 14  VSVPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGISP-ERAAQVMGPPDR------C 66

Query: 417 ESALHQIVTLILKDDESN-----IEAMKAGAGHVP--------ANSVRFLIAGSQAGGLI 557
           + A H I  LIL   E +       A   G G              + + +   + G +I
Sbjct: 67  QHAAHIISELILTAQERDGFGGLAAARGRGRGRGDWSVGAPGGVQEITYTVPADKCGLVI 126

Query: 558 GVSGQNIENLRISSGATV 611
           G  G+NI+++   SGA V
Sbjct: 127 GKGGENIKSINQQSGAHV 144



>gb:AL138882_1920053 Human DNA sequence from clone RP1-195K21 on
           chromosome 6 Contains part of the KHDRBS2 gene for KH
           domain containing RNA binding signal transduction
           associated protein 2, complete
           sequence.>gb:AL355347_1923788 Human DNA sequence from
           clone RP11-506N21 on chromosome 6 Contains part of the
           KHDRBS2 gene for KH domain containing RNA binding signal
           transduction associated protein 2, complete
           sequence.>gb:AL360220_1926070 Human DNA sequence from
           clone RP11-173B15 on chromosome 6 Contains part of the
           KHDRBS2 gene for KH domain containing RNA binding signal
           transduction associated protein 2, complete
           sequence.>gb:AL391644_1926972 Human DNA sequence from
           clone RP11-535F17 on chromosome 6 Contains part of the
           KHDRBS2 gene for KH domain containing RNA binding signal
           transduction associated protein 2, complete
           sequence.>gb:HS516C23_1998963 Human DNA sequence from
           clone RP3-516C23 on chromosome 6q12 Contains the 5' end
           of the KHDRBS2 gene for KH domain containing RNA binding
           signal transduction associated protein 2, complete
           sequence.>gb:HSDJ240B8_2011985 Human DNA sequence from
           clone RP1-240B8 on chromosome 6 Contains the 3' end of
           the KHDRBS2 gene for KH domain containing RNA binding
           signal transduction associated protein 2 and a novel
           gene, complete sequence.
          Length = 349

 Score = 34.3 bits (77), Expect = 1.8
 Identities = 21/93 (22%), Positives = 45/93 (48%), Gaps = 6/93 (6%)
 Frame = +3

Query: 207 KRVKVSQDIVYRIIVPSKQ------IGKVIGKVGHRIQKIREETRATIKIADAISRHEER 368
           K +K+S+    R+++P KQ      +GK++G  G+ +++++EET A + I    S  ++ 
Sbjct: 56  KNIKLSE----RVLIPVKQYPKFNFVGKLLGPRGNSLKRLQEETGAKMSILGKGSMRDKA 111

Query: 369 VIIISSKDNDGTFCDAESALHQIVTLILKDDES 467
                 K  +  +      LH ++ +     E+
Sbjct: 112 KEEELRKSGEAKYAHLSDELHVLIEVFAPPGEA 144



>gb:CR382129_1661401 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 380

 Score = 34.3 bits (77), Expect = 1.8
 Identities = 24/89 (26%), Positives = 44/89 (49%), Gaps = 2/89 (2%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAE 419
           R+I+P   +G VIG+ G  I+++RE + A I +    S H+++ ++     +      A 
Sbjct: 293 RLIIPDHMVGTVIGRGGANIKQLRENSGAFISLK---SDHDKKSVVQIVAQDQANVTQAI 349

Query: 420 SALHQIVTLILKDDES--NIEAMKAGAGH 500
             L Q++      D+S   IE +   AG+
Sbjct: 350 VELKQLLEQEWYSDKSLEEIEKIFLRAGY 378



>gb:CEM88_1366349 Caenorhabditis elegans cosmid M88, complete
           sequence.
          Length = 704

 Score = 34.3 bits (77), Expect = 1.8
 Identities = 35/132 (26%), Positives = 60/132 (45%), Gaps = 1/132 (0%)
 Frame = +3

Query: 225 QDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGT 404
           +D   R +V  K    +IG  G  I+ I   TR  +   D ++  ++   ++ + D   T
Sbjct: 185 KDWPIRCVVEGKYHAVIIGPNGSTIKDIASSTRCRV---DFVNLSKKERTVLGNNDRILT 241

Query: 405 FCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQ-AGGLIGVSGQNIE 581
                    + V  IL  D    EA+K    +V A++V  + A +Q  G LIG +G +I+
Sbjct: 242 VHGVAEQATKAVARIL--DVIQSEAVKDDV-NVGADTVLRMRAHNQLCGRLIGKAGSSIK 298

Query: 582 NLRISSGATVTV 617
            +   +G  +TV
Sbjct: 299 EIMQKTGTNITV 310



>gb:CEM88_1366348 Caenorhabditis elegans cosmid M88, complete
           sequence.
          Length = 828

 Score = 34.3 bits (77), Expect = 1.8
 Identities = 35/132 (26%), Positives = 60/132 (45%), Gaps = 1/132 (0%)
 Frame = +3

Query: 225 QDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGT 404
           +D   R +V  K    +IG  G  I+ I   TR  +   D ++  ++   ++ + D   T
Sbjct: 309 KDWPIRCVVEGKYHAVIIGPNGSTIKDIASSTRCRV---DFVNLSKKERTVLGNNDRILT 365

Query: 405 FCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQ-AGGLIGVSGQNIE 581
                    + V  IL  D    EA+K    +V A++V  + A +Q  G LIG +G +I+
Sbjct: 366 VHGVAEQATKAVARIL--DVIQSEAVKDDV-NVGADTVLRMRAHNQLCGRLIGKAGSSIK 422

Query: 582 NLRISSGATVTV 617
            +   +G  +TV
Sbjct: 423 EIMQKTGTNITV 434



>pir|T23837|T23837 hypothetical protein M88.5 - Caenorhabditis
           elegans
          Length = 854

 Score = 34.3 bits (77), Expect = 1.8
 Identities = 35/132 (26%), Positives = 60/132 (45%), Gaps = 1/132 (0%)
 Frame = +3

Query: 225 QDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGT 404
           +D   R +V  K    +IG  G  I+ I   TR  +   D ++  ++   ++ + D   T
Sbjct: 309 KDWPIRCVVEGKYHAVIIGPNGSTIKDIASSTRCRV---DFVNLSKKERTVLGNNDRILT 365

Query: 405 FCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSVRFLIAGSQ-AGGLIGVSGQNIE 581
                    + V  IL  D    EA+K    +V A++V  + A +Q  G LIG +G +I+
Sbjct: 366 VHGVAEQATKAVARIL--DVIQSEAVKDDV-NVGADTVLRMRAHNQLCGRLIGKAGSSIK 422

Query: 582 NLRISSGATVTV 617
            +   +G  +TV
Sbjct: 423 EIMQKTGTNITV 434



>pir|A53184|A53184 myc far upstream element-binding protein - human
          Length = 644

 Score = 34.3 bits (77), Expect = 1.8
 Identities = 42/183 (22%), Positives = 71/183 (38%), Gaps = 14/183 (7%)
 Frame = +3

Query: 105 DPYKSTTAKRRRDEDAFEATDEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGK 284
           DPYK   AK    E   E   + G   EV      R+  ++ I   + +P   +G VIG+
Sbjct: 240 DPYKVQQAK----EMVLELIRDQGGFREVRNEYGSRIGGNEGI--DVPIPRFAVGIVIGR 293

Query: 285 VGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDE 464
            G  I+KI+ +    I+         ER+  I+         D      +I+T +L+  +
Sbjct: 294 NGEMIKKIQNDAGVRIQFKPDDGTTPERIAQITGPP------DRCQHAAEIITDLLRSVQ 347

Query: 465 SNIEAMKA----GAGHVPAN----------SVRFLIAGSQAGGLIGVSGQNIENLRISSG 602
           +           G G    N             F++   + G +IG  G+ I+++   SG
Sbjct: 348 AGNPGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIGKGGETIKSISQQSG 407

Query: 603 ATV 611
           A +
Sbjct: 408 ARI 410



>sp|Q96AE4|FUB1_HUMAN Far upstream element binding protein 1 (FUSE
           binding protein 1) (FBP) (DNA helicase V) (HDH V).
          Length = 643

 Score = 34.3 bits (77), Expect = 1.8
 Identities = 42/183 (22%), Positives = 71/183 (38%), Gaps = 14/183 (7%)
 Frame = +3

Query: 105 DPYKSTTAKRRRDEDAFEATDEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGK 284
           DPYK   AK    E   E   + G   EV      R+  ++ I   + +P   +G VIG+
Sbjct: 239 DPYKVQQAK----EMVLELIRDQGGFREVRNEYGSRIGGNEGI--DVPIPRFAVGIVIGR 292

Query: 285 VGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDE 464
            G  I+KI+ +    I+         ER+  I+         D      +I+T +L+  +
Sbjct: 293 NGEMIKKIQNDAGVRIQFKPDDGTTPERIAQITGPP------DRCQHAAEIITDLLRSVQ 346

Query: 465 SNIEAMKA----GAGHVPAN----------SVRFLIAGSQAGGLIGVSGQNIENLRISSG 602
           +           G G    N             F++   + G +IG  G+ I+++   SG
Sbjct: 347 AGNPGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIGKGGETIKSISQQSG 406

Query: 603 ATV 611
           A +
Sbjct: 407 ARI 409



>gb:BC067711_2554878 Danio rerio zgc:85948, mRNA (cDNA clone
           MGC:85948 IMAGE:6964815), complete cds.
          Length = 352

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 6/84 (7%)
 Frame = +3

Query: 207 KRVKVSQDIVYRIIVPSKQ------IGKVIGKVGHRIQKIREETRATIKIADAISRHEER 368
           K +K+ +    RI++P KQ      +GK++G  G+ I++++EET A I +    S  ++ 
Sbjct: 55  KNIKLKE----RILIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKN 110

Query: 369 VIIISSKDNDGTFCDAESALHQIV 440
                 K+ +  +      LH  +
Sbjct: 111 KEEELRKNGEPKYAHLSMELHVFI 134



>gb:BC046731_2549720 Xenopus laevis similar to neuro-oncological
           ventral antigen 1, mRNA (cDNA clone MGC:53786
           IMAGE:5537475), complete cds.
          Length = 315

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 2/54 (3%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIAD--AISRHEERVIIISSKDN 395
           ++IVP+   G +IGK G  ++ I EE+ A ++++   A     ERV+ +S + N
Sbjct: 37  KLIVPNTTAGLIIGKGGATVRNIMEESGAWVQLSQKPAGPNLHERVVTVSGEPN 90



>gb:AF440570_2255861 Shrimp white spot syndrome virus, complete
           genome.
          Length = 245

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 31/108 (28%), Positives = 50/108 (46%), Gaps = 15/108 (13%)
 Frame = +3

Query: 117 STTAKRRRDEDAFEATDEAGTSAEVVPPLKKRVKVSQDIVY---------RIIVPSKQIG 269
           S T  +R+ ED  E T+E   S E  PP  K  +V +D VY         +I+  S ++ 
Sbjct: 21  SPTTSKRKAEDLTEGTEEEEESVETHPP-SKLPRVDEDEVYIDENVDGDVQILASSIEVA 79

Query: 270 KV----IGKVGHRIQKIREETRATIKIADAISR--HEERVIIISSKDN 395
           ++    + +   R  KI EE  AT    +  SR  ++E V ++   +N
Sbjct: 80  RMERERLAEAMVRDIKIEEEKAATEARKEIASRLIYKEMVYLLPQLEN 127



>gb:AF332093_2236699 White spot syndrome virus, complete genome.
          Length = 245

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 31/108 (28%), Positives = 50/108 (46%), Gaps = 15/108 (13%)
 Frame = +3

Query: 117 STTAKRRRDEDAFEATDEAGTSAEVVPPLKKRVKVSQDIVY---------RIIVPSKQIG 269
           S T  +R+ ED  E T+E   S E  PP  K  +V +D VY         +I+  S ++ 
Sbjct: 21  SPTTSKRKAEDLTEGTEEEEESVETHPP-SKLPRVDEDEVYIDENVDGDVQILASSIEVA 79

Query: 270 KV----IGKVGHRIQKIREETRATIKIADAISR--HEERVIIISSKDN 395
           ++    + +   R  KI EE  AT    +  SR  ++E V ++   +N
Sbjct: 80  RMERERLAEAMVRDIKIEEEKAATEARKEIASRLIYKEMVYLLPQLEN 127



>gb:BC014305_1974524 Homo sapiens high density lipoprotein binding
           protein (vigilin), mRNA (cDNA clone IMAGE:4099438),
           partial cds.
          Length = 898

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 45/148 (30%), Positives = 63/148 (42%), Gaps = 5/148 (3%)
 Frame = +3

Query: 174 GTSAEVVPPLKKRVKVSQDIV---YRIIVPS-KQIGK-VIGKVGHRIQKIREETRATIKI 338
           G   EV    K   K+  D+V   Y I VP  KQ  K +IGK G  I+KIREE+   I +
Sbjct: 188 GPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDL 247

Query: 339 ADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSV 518
             A + + E +II   + N       E+A  +I  L ++ D +NI              V
Sbjct: 248 -PAENSNSETIIITGKRAN------CEAARSRI--LSIQKDLANIA------------EV 286

Query: 519 RFLIAGSQAGGLIGVSGQNIENLRISSG 602
              I       LIG  G+ I ++    G
Sbjct: 287 EVSIPAKLHNSLIGTKGRLIRSIMEECG 314



>gb:AK131375_1917915 Homo sapiens cDNA FLJ16432 fis, clone
           BRACE3010076, highly similar to Vigilin.
          Length = 577

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 45/148 (30%), Positives = 63/148 (42%), Gaps = 5/148 (3%)
 Frame = +3

Query: 174 GTSAEVVPPLKKRVKVSQDIV---YRIIVPS-KQIGK-VIGKVGHRIQKIREETRATIKI 338
           G   EV    K   K+  D+V   Y I VP  KQ  K +IGK G  I+KIREE+   I +
Sbjct: 55  GPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDL 114

Query: 339 ADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSV 518
             A + + E +II   + N       E+A  +I  L ++ D +NI              V
Sbjct: 115 -PAENSNSETIIITGKRAN------CEAARSRI--LSIQKDLANIA------------EV 153

Query: 519 RFLIAGSQAGGLIGVSGQNIENLRISSG 602
              I       LIG  G+ I ++    G
Sbjct: 154 EVSIPAKLHNSLIGTKGRLIRSIMEECG 181



>gb:AK127833_1916921 Homo sapiens cDNA FLJ45936 fis, clone
           PLACE7004103, highly similar to Vigilin.
          Length = 847

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 45/148 (30%), Positives = 63/148 (42%), Gaps = 5/148 (3%)
 Frame = +3

Query: 174 GTSAEVVPPLKKRVKVSQDIV---YRIIVPS-KQIGK-VIGKVGHRIQKIREETRATIKI 338
           G   EV    K   K+  D+V   Y I VP  KQ  K +IGK G  I+KIREE+   I +
Sbjct: 241 GPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDL 300

Query: 339 ADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSV 518
             A + + E +II   + N       E+A  +I  L ++ D +NI              V
Sbjct: 301 -PAENSNSETIIITGKRAN------CEAARSRI--LSIQKDLANIA------------EV 339

Query: 519 RFLIAGSQAGGLIGVSGQNIENLRISSG 602
              I       LIG  G+ I ++    G
Sbjct: 340 EVSIPAKLHNSLIGTKGRLIRSIMEECG 367



>gb:CR382127_1660195 Yarrowia lipolytica chromosome A of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 385

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 28/106 (26%), Positives = 45/106 (42%), Gaps = 8/106 (7%)
 Frame = +3

Query: 99  EDDPYKSTTAKRRRDEDAFEATD--------EAGTSAEVVPPLKKRVKVSQDIVYRIIVP 254
           ED  Y S    R R +D    TD        + G  AE +         S   V   I+P
Sbjct: 252 EDKEYVSFAGYRGRHQDGGSDTDTDREATVSDHGGDAEALSS-------SDACVQSTIIP 304

Query: 255 SKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKD 392
           +   G +IG+ G  I+++R+ + A I I+    R  ER +++   +
Sbjct: 305 ASFAGYIIGRRGDNIRELRKRSGAAISISSEYER--ERTLLMRGSE 348



>gb:CR380958_1653342 Candida glabrata strain CBS138 chromosome L
           complete sequence.
          Length = 481

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 2/52 (3%)
 Frame = +3

Query: 243 IIVPSKQIGKVIGKVGHRIQKIREETRATIKIADAISRHEE--RVIIISSKD 392
           I++P   +G+++GK G R+  +R+ TR  I I +  S+ E   R   I+S D
Sbjct: 387 ILIPEGYVGRLVGKGGSRLANLRKFTRTKILIDERGSKDESKYRKFTITSSD 438



 Score = 33.5 bits (75), Expect = 3.0
 Identities = 23/80 (28%), Positives = 43/80 (53%), Gaps = 1/80 (1%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIAD-AISRHEERVIIISSKDNDGTFCDA 416
           R++V +  + KV+G  GHRI  +R++    +K +   +S+  +RV  I     +G   + 
Sbjct: 152 RMLVSNTNLSKVLGSEGHRIADLRDKYDLRMKASKYKLSQSTDRVFEI-----EGLAQNI 206

Query: 417 ESALHQIVTLILKDDESNIE 476
             AL +I  +IL++  +N E
Sbjct: 207 IEALVEINNIILREKTTNSE 226



>gb:CR861421_1185416 Pongo pygmaeus mRNA; cDNA DKFZp459P222 (from
           clone DKFZp459P222).
          Length = 1268

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 45/148 (30%), Positives = 63/148 (42%), Gaps = 5/148 (3%)
 Frame = +3

Query: 174 GTSAEVVPPLKKRVKVSQDIV---YRIIVPS-KQIGK-VIGKVGHRIQKIREETRATIKI 338
           G   EV    K   K+  D+V   Y I VP  KQ  K +IGK G  I+KIREE+   I +
Sbjct: 558 GPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDL 617

Query: 339 ADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSV 518
             A + + E +II   + N       E+A  +I  L ++ D +NI              V
Sbjct: 618 -PAENSNSETIIITGKRAN------CEAARSRI--LSIQKDLANIA------------EV 656

Query: 519 RFLIAGSQAGGLIGVSGQNIENLRISSG 602
              I       LIG  G+ I ++    G
Sbjct: 657 EVSIPAKLHNSLIGTKGRLIRSIMEECG 684



>gb:CR859426_1183543 Pongo pygmaeus mRNA; cDNA DKFZp469M026 (from
           clone DKFZp469M026).
          Length = 1268

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 45/148 (30%), Positives = 63/148 (42%), Gaps = 5/148 (3%)
 Frame = +3

Query: 174 GTSAEVVPPLKKRVKVSQDIV---YRIIVPS-KQIGK-VIGKVGHRIQKIREETRATIKI 338
           G   EV    K   K+  D+V   Y I VP  KQ  K +IGK G  I+KIREE+   I +
Sbjct: 558 GPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDL 617

Query: 339 ADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSV 518
             A + + E +II   + N       E+A  +I  L ++ D +NI              V
Sbjct: 618 -PAENSNSETIIITGKRAN------CEAARSRI--LSIQKDLANIA------------EV 656

Query: 519 RFLIAGSQAGGLIGVSGQNIENLRISSG 602
              I       LIG  G+ I ++    G
Sbjct: 657 EVSIPAKLHNSLIGTKGRLIRSIMEECG 684



>gb:CR858804_1182954 Pongo pygmaeus mRNA; cDNA DKFZp459O137 (from
           clone DKFZp459O137).
          Length = 1268

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 45/148 (30%), Positives = 63/148 (42%), Gaps = 5/148 (3%)
 Frame = +3

Query: 174 GTSAEVVPPLKKRVKVSQDIV---YRIIVPS-KQIGK-VIGKVGHRIQKIREETRATIKI 338
           G   EV    K   K+  D+V   Y I VP  KQ  K +IGK G  I+KIREE+   I +
Sbjct: 558 GPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDL 617

Query: 339 ADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSV 518
             A + + E +II   + N       E+A  +I  L ++ D +NI              V
Sbjct: 618 -PAENSNSETIIITGKRAN------CEAARSRI--LSIQKDLANIA------------EV 656

Query: 519 RFLIAGSQAGGLIGVSGQNIENLRISSG 602
              I       LIG  G+ I ++    G
Sbjct: 657 EVSIPAKLHNSLIGTKGRLIRSIMEECG 684



>gb:AP006840_568272 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 635

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 20/80 (25%), Positives = 39/80 (48%)
 Frame = +3

Query: 114 KSTTAKRRRDEDAFEATDEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGH 293
           ++ T + R  E+    +  A  +A+V    ++R + +  +V R +   +Q+G V+G    
Sbjct: 352 EAATRQVRMAEELQRMSASAAGTAQVALQTEQRARAAAAVVERALREIEQVGAVVGTSAD 411

Query: 294 RIQKIREETRATIKIADAIS 353
           RIQ++   +     I D IS
Sbjct: 412 RIQELDRLSEQVGSITDVIS 431



>pir|T41389|T41389 rna binding protein - fission yeast
            (Schizosaccharomyces pombe)>gb:SPCC550_1721390 S.pombe
            chromosome III cosmid c550.
          Length = 1279

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 29/117 (24%), Positives = 48/117 (41%), Gaps = 4/117 (3%)
 Frame = +3

Query: 99   EDDPYKSTTAKRRRDEDAFEATDEAGTS--AEVVPPLKKRVKVSQDIVYR--IIVPSKQI 266
            EDD   ST  +  +     E     G    A     L +  +  + I Y   I +PSK +
Sbjct: 835  EDDSSNSTGNELMKPTSPDEVVIRGGKKSVAAAKQELLELYEYEKSIAYTSTIDIPSKAV 894

Query: 267  GKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAESALHQI 437
             +V+G+ G  ++ IR +    I I D  +     V +  +K       D E+A+ +I
Sbjct: 895  SRVVGRNGSTVENIRTQFDVKIDIGDVSTEETTPVSVRGAK------ADVENAIKEI 945



>pir|S42933|S42933 hypothetical protein 1087 -
           maize>gb:ZMTS1087_1732052 Z.mays mRNA Transcribed
           Sequence 1087.
          Length = 228

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 4/56 (7%)
 Frame = +3

Query: 240 RIIVPSKQIGKVIGKVGHRIQKIREETRATIKIA----DAISRHEERVIIISSKDN 395
           R +VP+   G +IGK G  I+   EE+ A IKI+    + +  H+  V I  + DN
Sbjct: 12  RPVVPNSSCGGIIGKGGATIKSFIEESHAGIKISPQDNNYVGLHDRLVTITGTFDN 67



>sp|Q8VDJ3|VGLN_MOUSE Vigilin (High density lipoprotein-binding
           protein) (HDL-binding protein).>gb:BC021765_2093617 Mus
           musculus high density lipoprotein (HDL) binding protein,
           mRNA (cDNA clone MGC:8000 IMAGE:3585871), complete
           cds.>gb:BC023806_2094264 Mus musculus high density
           lipoprotein (HDL) binding protein, mRNA (cDNA clone
           MGC:36446 IMAGE:5354293), complete
           cds.>gb:BC025648_2095126 Mus musculus high density
           lipoprotein (HDL) binding protein, mRNA (cDNA clone
           MGC:36421 IMAGE:5324951), complete
           cds.>gb:BC027779_2096108 Mus musculus high density
           lipoprotein (HDL) binding protein, mRNA (cDNA clone
           MGC:36445 IMAGE:5354010), complete
           cds.>gb:BC027788_2096113 Mus musculus high density
           lipoprotein (HDL) binding protein, mRNA (cDNA clone
           MGC:36435 IMAGE:5346979), complete
           cds.>gb:BC035301_2097826 Mus musculus high density
           lipoprotein (HDL) binding protein, mRNA (cDNA clone
           MGC:25462 IMAGE:4458160), complete
           cds.>gb:BC088624_2565752 Xenopus laevis hypothetical
           LOC496186, mRNA (cDNA clone MGC:98139 IMAGE:7200678),
           complete cds.
          Length = 1268

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 45/148 (30%), Positives = 63/148 (42%), Gaps = 5/148 (3%)
 Frame = +3

Query: 174 GTSAEVVPPLKKRVKVSQDIV---YRIIVPS-KQIGK-VIGKVGHRIQKIREETRATIKI 338
           G   EV    K   K+  D+V   Y I VP  KQ  K +IGK G  I+KIREE+   I +
Sbjct: 558 GPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDL 617

Query: 339 ADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSV 518
             A + + E +II   + N       E+A  +I  L ++ D +NI              V
Sbjct: 618 -PAENSNSETIIITGKRAN------CEAARSRI--LSIQKDLANIA------------EV 656

Query: 519 RFLIAGSQAGGLIGVSGQNIENLRISSG 602
              I       LIG  G+ I ++    G
Sbjct: 657 EVSIPAKLHNSLIGTKGRLIRSIMEECG 684



>sp|Q00341|VGLN_HUMAN Vigilin (High density lipoprotein-binding
           protein) (HDL-binding protein).>pir|A44125|A44125 high
           density lipoprotein-binding protein, 110K -
           human>gb:CQ834792_1454062 Sequence 663 from Patent
           WO2004058805.>gb:BC001179_1967360 Homo sapiens high
           density lipoprotein binding protein (vigilin), mRNA
           (cDNA clone MGC:2301 IMAGE:3528704), complete
           cds.>gb:HUMHBP_2031839 Human high density lipoprotein
           binding protein (HBP) mRNA, complete cds.
          Length = 1268

 Score = 33.9 bits (76), Expect = 2.3
 Identities = 45/148 (30%), Positives = 63/148 (42%), Gaps = 5/148 (3%)
 Frame = +3

Query: 174 GTSAEVVPPLKKRVKVSQDIV---YRIIVPS-KQIGK-VIGKVGHRIQKIREETRATIKI 338
           G   EV    K   K+  D+V   Y I VP  KQ  K +IGK G  I+KIREE+   I +
Sbjct: 558 GPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDL 617

Query: 339 ADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSV 518
             A + + E +II   + N       E+A  +I  L ++ D +NI              V
Sbjct: 618 -PAENSNSETIIITGKRAN------CEAARSRI--LSIQKDLANIA------------EV 656

Query: 519 RFLIAGSQAGGLIGVSGQNIENLRISSG 602
              I       LIG  G+ I ++    G
Sbjct: 657 EVSIPAKLHNSLIGTKGRLIRSIMEECG 684



>gb:AF533514_2499789 Xenopus laevis FUSE binding protein-like
           protein mRNA, complete cds.
          Length = 610

 Score = 33.5 bits (75), Expect = 3.0
 Identities = 41/180 (22%), Positives = 69/180 (38%), Gaps = 11/180 (6%)
 Frame = +3

Query: 105 DPYKSTTAKRRRDEDAFEATDEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGK 284
           DPYK   AK    E   E   + G   EV      R+  ++ I +  +     +G VIG+
Sbjct: 228 DPYKVQQAK----EMVLELICDQGGFREVRNEYGSRIGGNEGIDF--LYHDVAVGIVIGR 281

Query: 285 VGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCD-AESALHQIVTLILKDD 461
            G  I+KI+ +    I+         ERV  I+   +    C  A   ++ ++  +   +
Sbjct: 282 NGEMIKKIQNDAGVRIQFKPDDGSTPERVAQITGPQDR---CQHAAEIVNDLLRSVQSGN 338

Query: 462 ESNIEAMKAGAGHVPAN----------SVRFLIAGSQAGGLIGVSGQNIENLRISSGATV 611
                    G G    N             F++   + G +IG  G+ I+N+   SGA +
Sbjct: 339 AGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFVVPSVKTGLIIGKGGETIKNISQQSGARI 398



>gb:DME238847_1378935 Drosophila melanogaster mRNA for drosophila
           dodeca-satellite protein 1 (DDP-1).
          Length = 1301

 Score = 33.5 bits (75), Expect = 3.0
 Identities = 28/67 (41%), Positives = 37/67 (55%), Gaps = 2/67 (2%)
 Frame = +3

Query: 201 LKKRVKVSQDIVYRIIVPS-KQIGK-VIGKVGHRIQKIREETRATIKIADAISRHEERVI 374
           L K VK  Q+  + I VP  KQ  K VIGK G  I+KIR+ET+  I +  A     E ++
Sbjct: 585 LLKLVKEIQESSHIIEVPIFKQFHKFVIGKGGANIKKIRDETQTKIDL-PAEGDTNEVIV 643

Query: 375 IISSKDN 395
           I   K+N
Sbjct: 644 ITGKKEN 650



>gb:AF132167_1243579 Drosophila melanogaster clone LD21383 unknown
           mRNA.
          Length = 897

 Score = 33.5 bits (75), Expect = 3.0
 Identities = 28/67 (41%), Positives = 37/67 (55%), Gaps = 2/67 (2%)
 Frame = +3

Query: 201 LKKRVKVSQDIVYRIIVPS-KQIGK-VIGKVGHRIQKIREETRATIKIADAISRHEERVI 374
           L K VK  Q+  + I VP  KQ  K VIGK G  I+KIR+ET+  I +  A     E ++
Sbjct: 181 LLKLVKEIQESSHIIEVPIFKQFHKFVIGKGGANIKKIRDETQTKIDL-PAEGDTNEVIV 239

Query: 375 IISSKDN 395
           I   K+N
Sbjct: 240 ITGKKEN 246



>gb:AE013599_1132624 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE013599_1132625 Drosophila melanogaster
           chromosome 2R, complete sequence.>gb:AE013599_1132626
           Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE013599_1132627 Drosophila melanogaster
           chromosome 2R, complete sequence.>gb:AE013599_1132628
           Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE013599_1132629 Drosophila melanogaster
           chromosome 2R, complete sequence.>gb:AE003799_1225049
           Drosophila melanogaster chromosome 2R, section 51 of 74
           of the complete sequence.>gb:AE003799_1225050 Drosophila
           melanogaster chromosome 2R, section 51 of 74 of the
           complete sequence.>gb:AE003799_1225051 Drosophila
           melanogaster chromosome 2R, section 51 of 74 of the
           complete sequence.>gb:AE003799_1225052 Drosophila
           melanogaster chromosome 2R, section 51 of 74 of the
           complete sequence.>gb:AE003799_1225053 Drosophila
           melanogaster chromosome 2R, section 51 of 74 of the
           complete sequence.>gb:AE003799_1225054 Drosophila
           melanogaster chromosome 2R, section 51 of 74 of the
           complete sequence.>gb:AF132179_1243591 Drosophila
           melanogaster clone LD21677 unknown mRNA.
          Length = 1301

 Score = 33.5 bits (75), Expect = 3.0
 Identities = 28/67 (41%), Positives = 37/67 (55%), Gaps = 2/67 (2%)
 Frame = +3

Query: 201 LKKRVKVSQDIVYRIIVPS-KQIGK-VIGKVGHRIQKIREETRATIKIADAISRHEERVI 374
           L K VK  Q+  + I VP  KQ  K VIGK G  I+KIR+ET+  I +  A     E ++
Sbjct: 585 LLKLVKEIQESSHIIEVPIFKQFHKFVIGKGGANIKKIRDETQTKIDL-PAEGDTNEVIV 643

Query: 375 IISSKDN 395
           I   K+N
Sbjct: 644 ITGKKEN 650



>gb:BA000021_686968 Wigglesworthia glossinidia endosymbiont of
           Glossina brevipalpis DNA, complete genome.
          Length = 705

 Score = 33.5 bits (75), Expect = 3.0
 Identities = 16/53 (30%), Positives = 32/53 (60%)
 Frame = +3

Query: 186 EVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIREETRATIKIAD 344
           +V+   K  + +    +Y+I +  ++I  VIGK G  I+ + E+T+++I+I D
Sbjct: 539 KVIKKPKNEISIFAPRIYKIKINPEKIKDVIGKGGSVIRMLTEKTKSSIEIED 591



>sp|Q9Z1A6|VGLN_RAT Vigilin (High density lipoprotein-binding
           protein) (HDL-binding protein).>gb:RNU90725_2137902
           Rattus norvegicus lipoprotein-binding protein mRNA,
           complete cds.
          Length = 1268

 Score = 33.5 bits (75), Expect = 3.0
 Identities = 44/148 (29%), Positives = 63/148 (42%), Gaps = 5/148 (3%)
 Frame = +3

Query: 174 GTSAEVVPPLKKRVKVSQDIV---YRIIVPS-KQIGK-VIGKVGHRIQKIREETRATIKI 338
           G   EV    K   K+  D+V   Y I VP  KQ  K +IGK G  I+KIREE+   I +
Sbjct: 558 GPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKGGANIKKIREESNTKIDL 617

Query: 339 ADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDESNIEAMKAGAGHVPANSV 518
             A + + E ++I   + N       E+A  +I  L ++ D +NI              V
Sbjct: 618 -PAENSNSETIVITGKRAN------CEAARSRI--LSIQKDLANIA------------EV 656

Query: 519 RFLIAGSQAGGLIGVSGQNIENLRISSG 602
              I       LIG  G+ I ++    G
Sbjct: 657 EVSIPAKLHNSLIGTKGRLIRSIMEECG 684



>sp|P51115|FXR1_XENLA Fragile X mental retardation syndrome related
           protein 1.>gb:XLU25163_2583291 Xenopus laevis fragile X
           mental retardation protein 1 homolog FXR1 mRNA, complete
           cds.
          Length = 648

 Score = 33.5 bits (75), Expect = 3.0
 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 6/64 (9%)
 Frame = +3

Query: 150 AFEATDEAGT------SAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGKVGHRIQKIR 311
           A E  +++GT      SAE V   +  ++  +D +    VP   +GKVIGK G  IQ+I 
Sbjct: 252 AIELDEDSGTFRIYGESAEAVKKARSYLEFVEDFIQ---VPRNLVGKVIGKNGKVIQEIV 308

Query: 312 EETR 323
           +++R
Sbjct: 309 DKSR 312



>gb:BC044314_2548627 Xenopus laevis high density lipoprotein binding
           protein (vigilin), mRNA (cDNA clone MGC:52662
           IMAGE:4681587), complete cds.
          Length = 1281

 Score = 33.1 bits (74), Expect = 3.9
 Identities = 26/67 (38%), Positives = 35/67 (52%), Gaps = 2/67 (2%)
 Frame = +3

Query: 201 LKKRVKVSQDIVYRIIVPS-KQIGK-VIGKVGHRIQKIREETRATIKIADAISRHEERVI 374
           L+K V    +  Y I VP  KQ  K +IGK G  I+KIREE    I +  A + + E ++
Sbjct: 569 LQKMVSELVENSYSISVPIFKQFHKNIIGKGGANIKKIREECNTKIDL-PAENSNSEMIV 627

Query: 375 IISSKDN 395
           I   K N
Sbjct: 628 ITGKKSN 634



>gb:AY057837_2510221 Gallus gallus Maxi-KH type RNA binding protein
           Sam68 (Sam68) mRNA, complete cds.
          Length = 433

 Score = 33.1 bits (74), Expect = 3.9
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 6/73 (8%)
 Frame = +3

Query: 240 RIIVPSKQ------IGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDG 401
           R+++P KQ      +GK++G  G+ I++++EET A I +    S  ++       K  D 
Sbjct: 142 RVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDP 201

Query: 402 TFCDAESALHQIV 440
            +      LH  +
Sbjct: 202 KYAHLNMDLHVFI 214



>gb:AF305619_2062276 Rattus norvegicus nuclear RNA binding protein
           Sam68 mRNA, complete cds.>gb:AF393783_2064781 Rattus
           norvegicus src associated in mitosis SAM68 mRNA,
           complete cds.>gb:BC061987_2104764 Rattus norvegicus src
           associated in mitosis, 68 kDa, mRNA (cDNA clone
           MGC:72326 IMAGE:5599491), complete cds.
          Length = 443

 Score = 33.1 bits (74), Expect = 3.9
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 6/73 (8%)
 Frame = +3

Query: 240 RIIVPSKQ------IGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDG 401
           R+++P KQ      +GK++G  G+ I++++EET A I +    S  ++       K  D 
Sbjct: 159 RVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDP 218

Query: 402 TFCDAESALHQIV 440
            +      LH  +
Sbjct: 219 KYAHLNMDLHVFI 231



>gb:BC010132_1972506 Homo sapiens KH domain containing, RNA binding,
           signal transduction associated 1, mRNA (cDNA clone
           MGC:19537 IMAGE:3956853), complete cds.
          Length = 381

 Score = 33.1 bits (74), Expect = 3.9
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 6/73 (8%)
 Frame = +3

Query: 240 RIIVPSKQ------IGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDG 401
           R+++P KQ      +GK++G  G+ I++++EET A I +    S  ++       K  D 
Sbjct: 159 RVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDP 218

Query: 402 TFCDAESALHQIV 440
            +      LH  +
Sbjct: 219 KYAHLNMDLHVFI 231



>gb:AK091346_1913459 Homo sapiens cDNA FLJ34027 fis, clone
           FCBBF2003549, highly similar to GAP-associated tyrosine
           phosphoprotein p62 (Sam68).
          Length = 418

 Score = 33.1 bits (74), Expect = 3.9
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 6/73 (8%)
 Frame = +3

Query: 240 RIIVPSKQ------IGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDG 401
           R+++P KQ      +GK++G  G+ I++++EET A I +    S  ++       K  D 
Sbjct: 134 RVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDP 193

Query: 402 TFCDAESALHQIV 440
            +      LH  +
Sbjct: 194 KYAHLNMDLHVFI 206



>gb:AK050520_1169351 Mus musculus adult pancreas islet cells cDNA,
           RIKEN full-length enriched library, clone:C820007D01
           product:src associated in mitosis, 68 kDa, full insert
           sequence.>gb:BC002051_2088826 Mus musculus KH domain
           containing, RNA binding, signal transduction associated
           1, mRNA (cDNA clone MGC:6063 IMAGE:3490667), complete
           cds.
          Length = 443

 Score = 33.1 bits (74), Expect = 3.9
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 6/73 (8%)
 Frame = +3

Query: 240 RIIVPSKQ------IGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDG 401
           R+++P KQ      +GK++G  G+ I++++EET A I +    S  ++       K  D 
Sbjct: 159 RVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDP 218

Query: 402 TFCDAESALHQIV 440
            +      LH  +
Sbjct: 219 KYAHLNMDLHVFI 231



>pir|I49140|I49140 p62 ras-GAP associated phosphoprotein -
           mouse>gb:MMU17046_2118592 Mus musculus p62 ras-GAP
           associated phosphoprotein mRNA, complete cds.
          Length = 443

 Score = 33.1 bits (74), Expect = 3.9
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 6/73 (8%)
 Frame = +3

Query: 240 RIIVPSKQ------IGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDG 401
           R+++P KQ      +GK++G  G+ I++++EET A I +    S  ++       K  D 
Sbjct: 159 RVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDP 218

Query: 402 TFCDAESALHQIV 440
            +      LH  +
Sbjct: 219 KYAHLNMDLHVFI 231



>pir|A38219|A38219 GAP-associated tyrosine phosphoprotein p62 -
           human>gb:A58790_1449866 Sequence 1 from Patent
           WO9638556.>gb:AL139249_1920479 Human DNA sequence from
           clone RP4-604L7 on chromosome 1p34.1-34.3 Contains the
           5' end of the KHDRBS1 gene for KH domain containing RNA
           binding signal transduction associated 1 and a CpG
           island, complete sequence.>gb:AL445248_1927500 Human DNA
           sequence from clone RP11-277A4 on chromosome 1 Contains
           the 3' end of the KHDRBS1 gene for KH domain containing
           RNA binding signal transduction associated 1, a novel
           gene, a novel gene (FLJ10315), the 5' end of the KPNA6
           gene for karyopherin alpha 6 (importin alpha 7) and a
           CpG island, complete sequence.>gb:BC000717_1966970 Homo
           sapiens KH domain containing, RNA binding, signal
           transduction associated 1, mRNA (cDNA clone MGC:1286
           IMAGE:3505275), complete cds.>gb:BC019109_1976748 Homo
           sapiens KH domain containing, RNA binding, signal
           transduction associated 1, mRNA (cDNA clone MGC:29538
           IMAGE:5094155), complete cds.>gb:HUMP62_2035409 Human
           p62 mRNA, complete cds.
          Length = 443

 Score = 33.1 bits (74), Expect = 3.9
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 6/73 (8%)
 Frame = +3

Query: 240 RIIVPSKQ------IGKVIGKVGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDG 401
           R+++P KQ      +GK++G  G+ I++++EET A I +    S  ++       K  D 
Sbjct: 159 RVLIPVKQYPKFNFVGKILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDP 218

Query: 402 TFCDAESALHQIV 440
            +      LH  +
Sbjct: 219 KYAHLNMDLHVFI 231



>sp|Q91WJ8|FUB1_MOUSE Far upstream element binding protein 1 (FUSE
           binding protein 1) (FBP).>gb:BC014763_2092012 Mus
           musculus far upstream element (FUSE) binding protein 1,
           mRNA (cDNA clone MGC:25679 IMAGE:4511225), complete cds.
          Length = 651

 Score = 33.1 bits (74), Expect = 3.9
 Identities = 41/183 (22%), Positives = 71/183 (38%), Gaps = 14/183 (7%)
 Frame = +3

Query: 105 DPYKSTTAKRRRDEDAFEATDEAGTSAEVVPPLKKRVKVSQDIVYRIIVPSKQIGKVIGK 284
           DPYK   AK    E   E   + G   EV      R+  ++ I   + +P   +G VIG+
Sbjct: 236 DPYKVQQAK----EMVLELIRDQGGFREVRNEYGSRIGGNEGI--DVPIPRFAVGIVIGR 289

Query: 285 VGHRIQKIREETRATIKIADAISRHEERVIIISSKDNDGTFCDAESALHQIVTLILKDDE 464
            G  I+KI+ +    I+         +R+  I+         D      +I+T +L+  +
Sbjct: 290 NGEMIKKIQNDAGVRIQFKPDDGTTPDRIAQITGPP------DRCQHAAEIITDLLRSVQ 343

Query: 465 SNIEAMKA----GAGHVPAN----------SVRFLIAGSQAGGLIGVSGQNIENLRISSG 602
           +           G G    N             F++   + G +IG  G+ I+++   SG
Sbjct: 344 AGNPGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIGKGGETIKSISQQSG 403

Query: 603 ATV 611
           A +
Sbjct: 404 ARI 406


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 581,764,285
Number of Sequences: 1806583
Number of extensions: 10739527
Number of successful extensions: 41277
Number of sequences better than 10.0: 281
Number of HSP's better than 10.0 without gapping: 39706
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 41104
length of database: 581,917,975
effective HSP length: 119
effective length of database: 366,934,598
effective search space used: 32657179222
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)