BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig5102
         (637 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T47595|T47595 RING finger protein T12E18.50 - Arabidopsis th...   152   3e-36   Arabidopsis thaliana [mouse-ear cress]
gb:AP002818_1822875 Oryza sativa (japonica cultivar-group) genom...   124   1e-27   
gb:AP004094_1837610 Oryza sativa (japonica cultivar-group) genom...   114   2e-24   
gb:BC064721_2553889 Xenopus tropicalis hypothetical protein MGC7...    64   2e-09   
gb:BC089260_2566141 Xenopus laevis cDNA clone MGC:85038 IMAGE:63...    55   1e-06   
gb:AL772284_1932818 Human DNA sequence from clone RP13-347D8 on ...    52   8e-06   
gb:AL772284_1932816 Human DNA sequence from clone RP13-347D8 on ...    52   8e-06   
gb:AK091777_1913560 Homo sapiens cDNA FLJ34458 fis, clone HLUNG2...    52   8e-06   
gb:AK026265_1910575 Homo sapiens cDNA: FLJ22612 fis, clone HSI04...    52   8e-06   
gb:AB097555_1872458 Macaca fascicularis brain cDNA clone:QmoA-15...    52   8e-06   
gb:BC087162_2110049 Rattus norvegicus checkpoint with forkhead a...    50   4e-05   
gb:BC012072_1973415 Homo sapiens checkpoint with forkhead and ri...    50   4e-05   
gb:AX877222_1476895 Sequence 12127 from Patent EP1074617.>gb:AK0...    50   4e-05   
gb:AX877194_1476881 Sequence 12099 from Patent EP1074617.>gb:AK0...    50   4e-05   
gb:AX405642_1467570 Sequence 57 from Patent WO0222660.                 50   4e-05   
gb:CR857284_1181528 Pongo pygmaeus mRNA; cDNA DKFZp469H0121 (fro...    50   4e-05   
gb:AK077629_1171963 Mus musculus 8 days embryo whole body cDNA, ...    50   4e-05   
sp|Q810L3|CHFR_MOUSE|CHFR_MOUSE Ubiquitin ligase protein CHFR (EC 6.3.2.-) ...    50   4e-05   Mus musculus [mouse]
sp|Q96EP1|CHFR_HUMAN|CHFR_HUMAN Ubiquitin ligase protein CHFR (EC 6.3.2.-) ...    50   4e-05   Homo sapiens [man]
gb:AK016522_1158757 Mus musculus adult male testis cDNA, RIKEN f...    45   8e-04   
gb:BC053151_2550543 Danio rerio B lymphoma Mo-MLV insertion regi...    45   0.001   
gb:BC029501_1979523 Homo sapiens ring finger protein 151, mRNA (...    45   0.001   
gb:AP004053_1836980 Oryza sativa (japonica cultivar-group) genom...    45   0.001   
gb:BC049423_2550233 Danio rerio B lymphoma Mo-MLV insertion regi...    45   0.001   
gb:AB074153_2463268 Danio rerio psc1 gene, complete cds.               45   0.001   
gb:BC082694_2562838 Xenopus laevis hypothetical LOC494698, mRNA ...    44   0.002   
gb:BC072892_2556816 Xenopus laevis xbmi-1 protein, mRNA (cDNA cl...    44   0.002   
gb:AY616032_2540541 Gallus gallus BMI1 mRNA, complete cds.             44   0.002   
gb:BT019449_2151365 Synthetic construct Homo sapiens B lymphoma ...    44   0.002   
gb:MUSBMI1B_2125268 Mouse zinc finger protein (bmi-1) gene, comp...    44   0.002   
gb:S62198S1_2040705 Homo sapiens flvi-2/bmi-1 (flvi-2/bmi-1) mRN...    44   0.002   
gb:CR456911_1993118 Homo sapiens full open reading frame cDNA cl...    44   0.002   
gb:BT019450_1991072 Homo sapiens B lymphoma Mo-MLV insertion reg...    44   0.002   
gb:AL158211_1921451 Human DNA sequence from clone RP11-573G6 on ...    44   0.002   
gb:AL158211_1921450 Human DNA sequence from clone RP11-573G6 on ...    44   0.002   
gb:AL158211_1921449 Human DNA sequence from clone RP11-573G6 on ...    44   0.002   
gb:AL158211_1921448 Human DNA sequence from clone RP11-573G6 on ...    44   0.002   
pir|I54339|I54339 proto-oncogene bmi-1 - human>gb:HUMBMI1X_20296...    44   0.002   Homo sapiens [man]
pir|I51694|I51694 transforming protein bmi1 - African clawed fro...    44   0.002   Xenopus laevis [clawed frog]
sp|P25916|BMI1_MOUSE|BMI1_MOUSE Polycomb complex protein BMI-1.>pir|A39523|...    44   0.002   Mus musculus [mouse]
sp|P35226|BMI1_HUMAN|BMI1_HUMAN Polycomb complex protein BMI-1.>gb:CR859740...    44   0.002   Homo sapiens [man]
sp|Q9TST0|BMI1_FELCA|BMI1_FELCA Polycomb complex protein BMI-1.>gb:FDO13201...    44   0.002   Felis catus [cat]
gb:BC068930_2555424 Xenopus laevis hypothetical protein MGC83173...    44   0.002   
gb:BC068725_2555226 Xenopus laevis hypothetical protein MGC81178...    44   0.002   
gb:AY261359_2319423 Bovine herpesvirus 5 strain SV507/99, comple...    44   0.002   
gb:BT007960_2150892 Synthetic construct Homo sapiens zinc finger...    44   0.002   
sp|P23798|ME18_MOUSE|ME18_MOUSE DNA-binding protein Mel-18 (RING finger pro...    44   0.002   Mus musculus [mouse]
sp|P35227|ME18_HUMAN|ME18_HUMAN DNA-binding protein Mel-18 (RING finger pro...    44   0.002   Homo sapiens [man]
sp|P29836|ICP0_BHV1K|ICP0_BHV1K Trans-acting transcriptional protein ICP0 (...    44   0.002   
sp|P29128|ICP0_BHV1J|ICP0_BHV1J Trans-acting transcriptional protein ICP0 (...    44   0.002   
gb:TBBCHR1A3_1398818 Trypanosoma brucei DNA chromosome 1, segmen...    43   0.004   
gb:AE014134_1129561 Drosophila melanogaster chromosome 2L, compl...    43   0.004   
gb:CP000001_851400 Bacillus cereus ZK, complete genome.                43   0.004   
gb:AE017027_381112 Bacillus anthracis str. Ames section 4 of 18 ...    42   0.007   
gb:AY454396_2533412 Hippoglossus hippoglossus recombination acti...    42   0.009   
gb:EHU81154_2400802 Equine herpesvirus 1 transcriptional protein...    41   0.015   
gb:AB158517_2173656 Equine herpesvirus 1 ORF63 gene for transact...    41   0.015   
gb:AK005850_1153263 Mus musculus adult male testis cDNA, RIKEN f...    41   0.015   
sp|P09309|ICP0_VZVD|ICP0_VZVD Trans-acting transcriptional protein ICP0.>p...    41   0.015   Human alphaherpesvirus 3
sp|P28990|ICP0_EHV1B|ICP0_EHV1B Trans-acting transcriptional protein ICP0.>...    41   0.015   Equid alphaherpesvirus 1
gb:BC051845_1984700 Homo sapiens polycomb group ring finger 5, m...    40   0.033   
gb:AE016818_1748261 Ashbya gossypii (= Eremothecium gossypii) AT...    40   0.033   
gb:SCCYP1_1707467 Yeast CYP1 gene.                                     40   0.033   
gb:AX405728_1467656 Sequence 143 from Patent WO0222660.>gb:AX405...    40   0.033   
gb:AK017984_1159402 Mus musculus adult male thymus cDNA, RIKEN f...    40   0.033   
gb:AK002387_1151165 Mus musculus adult male kidney cDNA, RIKEN f...    40   0.033   
sp|P12351|CYP1_YEAST|CYP1_YEAST CYP1 activatory protein.>pir|S59400|RGBYH1 ...    40   0.033   Saccharomyces cerevisiae [brewer's yeast]
gb:PPI297298_1701334 Pinus pinaster partial mRNA for putative RI...    40   0.043   
gb:AE016818_1748533 Ashbya gossypii (= Eremothecium gossypii) AT...    39   0.056   
gb:AC145780_1744493 Oryza sativa chromosome 3 BAC OSJNBb0069P02 ...    39   0.056   
gb:CR380959_1654025 Candida glabrata strain CBS138 chromosome M ...    39   0.056   
gb:AY249876_1427999 Tupaia tana recombination activating protein...    39   0.056   
gb:AE017000_375830 Bacillus cereus ATCC 14579 section 3 of 18 of...    39   0.056   
pir|T42606|T42606 probable transcription activator - equine herp...    39   0.056   Equid alphaherpesvirus 4
gb:HSDJ568F9_2012245 Human DNA sequence from clone RP4-568F9 on ...    39   0.074   
gb:HSDJ568F9_2012244 Human DNA sequence from clone RP4-568F9 on ...    39   0.074   
gb:BC001887_1967933 Homo sapiens zinc finger protein 133 (clone ...    39   0.074   
gb:AC096855_1736362 Oryza sativa chromosome 3 BAC OJ1365_D05 gen...    39   0.074   
gb:YSCHAP1_1729295 Yeast (S.cerevisiae) activator protein HAP1 g...    39   0.074   
gb:AY160104_1305302 Dictyostelium discoideum nucleotide exchange...    39   0.074   
gb:CR858677_1182834 Pongo pygmaeus mRNA; cDNA DKFZp468M0413 (fro...    39   0.074   
sp|P52736|Z133_HUMAN|Z133_HUMAN Zinc finger protein 133.>pir|A57785|A57785 ...    39   0.074   Homo sapiens [man]
gb:BC065679_2554124 Danio rerio myosin regulatory light chain in...    39   0.096   
gb:BC054692_2551089 Danio rerio zgc:66368, mRNA (cDNA clone MGC:...    39   0.096   
gb:AY434450_2532412 Danio rerio myosin regulatory light chain-in...    39   0.096   
gb:AY423020_2532106 Danio rerio myosin regulatory light chain in...    39   0.096   
gb:AL831789_2504570 Zebrafish DNA sequence from clone CH211-207O...    39   0.096   
gb:BC046775_2099357 Mus musculus RIKEN cDNA 3110001E11 gene, mRN...    39   0.096   
gb:BC028560_2096261 Mus musculus nervous system polycomb 1, mRNA...    39   0.096   
gb:AY662670_2087498 Rattus norvegicus Nspc1-like protein (Nspc1)...    39   0.096   
gb:AJ421479_2068272 Mus musculus X-inactivation center region; s...    39   0.096   
gb:HSM803889_2017732 Homo sapiens mRNA; cDNA DKFZp451F1716 (from...    39   0.096   
gb:BC004952_1969471 Homo sapiens polycomb group ring finger 1, m...    39   0.096   
gb:AF087884_1881898 Homo sapiens RNF3A-2 mRNA, complete cds.           39   0.096   
gb:AX886036_1481489 Sequence 1899 from Patent EP1033401.               39   0.096   
gb:AY239187_1427661 Phoca vitulina recombination activating prot...    39   0.096   
gb:AY239182_1427656 Sus scrofa recombination activating protein ...    39   0.096   
gb:AB091392_1409521 Sus scrofa RAG-1 gene for recombination acti...    39   0.096   
gb:CR859012_1183152 Pongo pygmaeus mRNA; cDNA DKFZp469J021 (from...    39   0.096   
gb:AK013941_1157709 Mus musculus 13 days embryo head cDNA, RIKEN...    39   0.096   
gb:AY294954_2081733 Phodopus sungorus recombination activating g...    38   0.13    
gb:AK127467_1916760 Homo sapiens cDNA FLJ45559 fis, clone BRTHA3...    38   0.13    
gb:CR382123_1655854 Kluyveromyces lactis strain NRRL Y-1140 chro...    38   0.13    
gb:AY045618_1561209 Arabidopsis thaliana At2g30580/T6B20.7 mRNA,...    38   0.13    
pir|B84710|B84710 probable C3HC4 zinc finger protein [imported] ...    38   0.13    Arabidopsis thaliana [mouse-ear cress]
gb:BC073117_2557022 Xenopus laevis MGC83623 protein, mRNA (cDNA ...    38   0.16    
gb:AY423858_2532141 Ictalurus punctatus recombination activating...    38   0.16    
gb:AY319982_2526711 Eremopterix australis recombination activati...    38   0.16    
gb:AF329846_2487919 Gallus gallus ring finger protein (arkadia) ...    38   0.16    
gb:BT007862_2150794 Synthetic construct Homo sapiens STRIN prote...    38   0.16    
gb:BC083820_2108885 Rattus norvegicus cDNA clone MGC:94892 IMAGE...    38   0.16    
gb:BC069835_2106126 Mus musculus ring finger 111, mRNA (cDNA clo...    38   0.16    
gb:BC054842_2101871 Mus musculus ring finger 111, mRNA (cDNA clo...    38   0.16    
gb:AK172991_2069925 Mus musculus mRNA for mKIAA0646 protein.           38   0.16    
gb:AF330197_2063382 Mus musculus Arkadia (Arkadia) mRNA, complet...    38   0.16    
gb:AB047007_2046073 Mus musculus mMBLR mRNA, complete cds.>gb:BC...    38   0.16    
gb:HSM806331_2018289 Homo sapiens mRNA; cDNA DKFZp686H1966 (from...    38   0.16    
gb:BC060862_1985760 Homo sapiens ring finger protein 111, mRNA (...    38   0.16    
gb:BC020984_1977329 Homo sapiens ring finger protein 111, mRNA (...    38   0.16    
gb:BC018107_1976414 Homo sapiens ring finger protein 138, transc...    38   0.16    
gb:BC007602_1970846 Homo sapiens polycomb group ring finger 6, m...    38   0.16    
gb:AL591408_1930057 Human DNA sequence from clone RP11-792D24 on...    38   0.16    
gb:AL591408_1930056 Human DNA sequence from clone RP11-792D24 on...    38   0.16    
gb:AK131488_1918022 Homo sapiens cDNA FLJ16671 fis, clone THYMU3...    38   0.16    
gb:AK131304_1917860 Homo sapiens cDNA FLJ16278 fis, clone NT2RI3...    38   0.16    
gb:AK122906_1915281 Homo sapiens cDNA FLJ16581 fis, clone TESTI2...    38   0.16    
gb:AK095327_1914343 Homo sapiens cDNA FLJ38008 fis, clone CTONG2...    38   0.16    
gb:AF162680_1887102 Homo sapiens HSD-4 protein (HSD-4) mRNA, com...    38   0.16    
gb:AB047006_1867505 Homo sapiens hMBLR mRNA, complete cds.>gb:BC...    38   0.16    
gb:AE017349_1758900 Cryptococcus neoformans var. neoformans JEC2...    38   0.16    
gb:AY136340_1581841 Arabidopsis thaliana putative protein (At5g2...    38   0.16    
gb:ATAC012395_1543479 Arabidopsis thaliana chromosome III BAC T1...    38   0.16    
gb:AB006708_1510055 Arabidopsis thaliana genomic DNA, chromosome...    38   0.16    
gb:AX881027_1478514 Sequence 15932 from Patent EP1074617.>gb:AK0...    38   0.16    
gb:AX405832_1467760 Sequence 247 from Patent WO0222660.                38   0.16    
gb:HSM802460_1186708 Homo sapiens mRNA; cDNA DKFZp761D081 (from ...    38   0.16    
gb:CR861381_1185379 Pongo pygmaeus mRNA; cDNA DKFZp459A112 (from...    38   0.16    
gb:AK048110_1168293 Mus musculus 16 days embryo head cDNA, RIKEN...    38   0.16    
gb:AK036351_1164439 Mus musculus 16 days neonate cerebellum cDNA...    38   0.16    
pir|T46904|T46904 hypothetical protein DKFZp761D081.1 - human>gb...    38   0.16    Homo sapiens [man]
pir|E86326|E86326 protein F18O14.3 [imported] - Arabidopsis thal...    38   0.16    Arabidopsis thaliana [mouse-ear cress]
sp|Q8VC56|RNF8_MOUSE|RNF8_MOUSE Ubiquitin ligase protein RNF8 (EC 6.3.2.-) ...    38   0.16    Mus musculus [mouse]
sp|O13033|RAG1_BRARE|RAG1_BRARE V(D)J recombination activating protein 1 (R...    38   0.16    Danio rerio [leopard danio]
gb:AF275348_2225683 Cercopithecine herpesvirus 7, complete genome.     37   0.21    
gb:AY249879_2080744 Hystrix africaeaustralis recombination activ...    37   0.21    
gb:AY249878_2080743 Dolichotis patagonum recombination activatin...    37   0.21    
gb:AY241472_2080417 Glaucomys volans RAG1 protein (RAG1) gene, p...    37   0.21    
gb:AF315468_2062620 Rattus norvegicus RSD-4 mRNA, complete cds.>...    37   0.21    
gb:AB025011_2044350 Mus musculus mRNA for Trif-d, complete cds.        37   0.21    
gb:AB025010_2044349 Mus musculus mRNA for Trif, complete cds.>gb...    37   0.21    
gb:BT001981_1635584 Arabidopsis thaliana expressed protein (At1g...    37   0.21    
gb:AY085998_1571059 Arabidopsis thaliana clone 205719 mRNA, comp...    37   0.21    
gb:AY249883_1428003 Tenrec ecaudatus recombination activating pr...    37   0.21    
gb:AY249871_1427995 Erinaceus europaeus recombination activating...    37   0.21    
gb:U67953_1405932 Caenorhabditis elegans cosmid ZC13, complete s...    37   0.21    
gb:CPU48717_1374796 Cryptosporidium parvum zinc finger protein g...    37   0.21    
gb:AK013419_1157508 Mus musculus 10, 11 days embryo whole body c...    37   0.21    
gb:AK004238_1152284 Mus musculus 18-day embryo whole body cDNA, ...    37   0.21    
gb:AE014298_1126147 Drosophila melanogaster chromosome X, comple...    37   0.21    
gb:AE014298_1126146 Drosophila melanogaster chromosome X, comple...    37   0.21    
pir|T25935|T25935 hypothetical protein ZC13.1 - Caenorhabditis e...    37   0.21    Caenorhabditis elegans [roundworm]
pir|S53414|S53414 probable membrane protein YLR427w - yeast (Sac...    33   0.23    Saccharomyces cerevisiae [brewer's yeast]
gb:BC074706_2558199 Xenopus tropicalis ribosome binding protein ...    37   0.28    
gb:AY241458_2080403 Dendromus mesomelas RAG1 protein (RAG1) gene...    37   0.28    
gb:CR380956_1652189 Candida glabrata strain CBS138 chromosome J ...    37   0.28    
gb:AY239195_1427669 Elephas maximus recombination activating pro...    37   0.28    
pir|T15742|T15742 hypothetical protein C32D5.11 - Caenorhabditis...    37   0.28    Caenorhabditis elegans [roundworm]
gb:BC081009_2561919 Xenopus laevis MGC81562 protein, mRNA (cDNA ...    37   0.37    
gb:BC070603_2555582 Xenopus laevis cDNA clone MGC:81253 IMAGE:66...    37   0.37    
gb:AF329847_2487920 Xenopus laevis ring finger-H2 protein (arkad...    37   0.37    
gb:HSRNF3A_2020116 Homo sapiens mRNA for RNF3A (DONG1) ring fing...    37   0.37    
gb:AL158211_1921452 Human DNA sequence from clone RP11-573G6 on ...    37   0.37    
gb:AY102110_1577718 Arabidopsis thaliana At1g19870/F6F9_18 mRNA,...    37   0.37    
gb:AY084918_1570000 Arabidopsis thaliana clone 121418 mRNA, comp...    37   0.37    
gb:AY249874_1427998 Uropsilus soricipes recombination activating...    37   0.37    
gb:AY239192_1427666 Procavia capensis recombination activating p...    37   0.37    
gb:AY070592_1294737 Drosophila melanogaster RE69393 full length ...    37   0.37    
gb:AK089091_1175796 Mus musculus 2 days neonate thymus thymic ce...    37   0.37    
gb:AK033609_1163433 Mus musculus adult male cecum cDNA, RIKEN fu...    37   0.37    
gb:AE014296_1137025 Drosophila melanogaster chromosome 3L, compl...    37   0.37    
gb:AE014296_1136454 Drosophila melanogaster chromosome 3L, compl...    37   0.37    
gb:AE016959_1023235 Oryza sativa (japonica cultivar-group) chrom...    37   0.37    
pir|A86332|A86332 F6F9.8 protein - Arabidopsis thaliana>gb:AE005...    37   0.37    Arabidopsis thaliana [mouse-ear cress]
sp|Q00940|PEXA_PICAN|PEXA_PICAN Peroxisome assembly protein PER8 (Peroxin-1...    37   0.37    
gb:BC084067_2563473 Xenopus laevis hypothetical LOC494986, mRNA ...    36   0.48    
gb:AY443301_2532915 Microeca papuana recombination activating pr...    36   0.48    
gb:AY294959_2081738 Neotoma floridana recombination activating g...    36   0.48    
gb:AY241459_2080404 Beamys hindei RAG1 protein (RAG1) gene, part...    36   0.48    
gb:HSRINGG_2020012 Homo sapiens RFB30 gene for RING finger protein.    36   0.48    
gb:AL669914_1932066 Human DNA sequence from clone XXbac-250I8 on...    36   0.48    
gb:AK094385_1914156 Homo sapiens cDNA FLJ37066 fis, clone BRACE2...    36   0.48    
gb:AF220123_1890723 Homo sapiens tripartite motif protein TRIM10...    36   0.48    
gb:AB088089_1872100 Homo sapiens RNF9, ZNFB7 genes for tripartit...    36   0.48    
gb:MDU51897_1440959 Monodelphis domestica recombination-activati...    36   0.48    
gb:AY249872_1427996 Scalopus aquaticus recombination activating ...    36   0.48    
gb:AY449458_1327285 Oikopleura dioica clone BACOIKO002 4xj18, co...    36   0.48    
gb:AK006700_1153685 Mus musculus adult male testis cDNA, RIKEN f...    36   0.48    
gb:AE014296_1136610 Drosophila melanogaster chromosome 3L, compl...    36   0.48    
gb:AE014186_938207 Plasmodium falciparum 3D7 chromosome 11 compl...    36   0.48    
gb:AY188989_595912 Bacillus circulans endo-beta-N-acetylglucosam...    36   0.48    
pir|JC4296|JC4296 ring finger protein - fruit fly (Drosophila me...    36   0.48    Drosophila melanogaster
pir|T03093|T03093 probable apoptosis inhibitor - Chilo iridescen...    36   0.48    Invertebrate iridescent virus 6
sp|Q7YR32|TRMA_PANTR|TRMA_PANTR Tripartite motif protein 10 (RING finger pr...    36   0.48    Pan troglodytes
sp|Q9UDY6|TRMA_HUMAN|TRMA_HUMAN Tripartite motif protein 10 (RING finger pr...    36   0.48    Homo sapiens [man]
sp|P29129|ICP0_PRVIF|ICP0_PRVIF Trans-acting transcriptional protein ICP0 (...    36   0.48    Suid alphaherpesvirus 1
sp|Q80V91|DTX3_MOUSE|DTX3_MOUSE Deltex protein 3 (Deltex-3) (Deltex3) (mDTX...    36   0.48    Mus musculus [mouse]
sp|Q8N9I9|DTX3_HUMAN|DTX3_HUMAN Deltex protein 3 (Deltex-3) (Deltex3).>gb:C...    36   0.48    Homo sapiens [man]
gb:AY662590_2542580 Phrynosoma mcallii recombination activating ...    36   0.62    
gb:AJ719385_2501572 Gallus gallus mRNA for hypothetical protein,...    36   0.62    
gb:AF022391_2180250 Feline herpesvirus 1 immediate early protein...    36   0.62    
gb:AY294956_2081735 Cricetulus migratorius recombination activat...    36   0.62    
gb:AY294952_2081731 Clethrionomys gapperi recombination activati...    36   0.62    
gb:AY294936_2081715 Cricetomys gambianus recombination activatin...    36   0.62    
gb:AY241499_2080444 Paraxerus ochraceus RAG1 protein (RAG1) gene...    36   0.62    
gb:AY241498_2080443 Paraxerus cepapi RAG1 protein (RAG1) gene, p...    36   0.62    
gb:AY155439_2076911 Mus musculus goliath-related E3 ubiquitin li...    36   0.62    
gb:AY249877_1940254 Tarsius syrichta recombination activating pr...    36   0.62    
gb:AC105773_1738245 Oryza sativa (japonica cultivar-group) chrom...    36   0.62    
gb:MCI250998_1685755 Mucor circinelloides crgA gene for caroteno...    36   0.62    
gb:AY249885_1428005 Choloepus hoffmanni recombination activating...    36   0.62    
gb:AY249884_1428004 Macroscelides proboscideus recombination act...    36   0.62    
gb:AY249882_1428002 Amblysomus hottentotus recombination activat...    36   0.62    
gb:AY249881_1428001 Ochotona princeps recombination activating p...    36   0.62    
gb:AY249873_1427997 Talpa europaea recombination activating prot...    36   0.62    
gb:AY239194_1427668 Trichechus manatus recombination activating ...    36   0.62    
gb:AY239193_1427667 Dugong dugon recombination activating protei...    36   0.62    
gb:AY239189_1427663 Uncia uncia recombination activating protein...    36   0.62    
gb:AY239188_1427662 Ailurus fulgens recombination activating pro...    36   0.62    
gb:AY239179_1427653 Lagenorhynchus obscurus recombination activa...    36   0.62    
gb:BT001903_1356676 Drosophila melanogaster SD22693 full insert ...    36   0.62    
gb:AE014296_1135210 Drosophila melanogaster chromosome 3L, compl...    36   0.62    
pir|T39456|T39456 zinc finger protein - fission yeast (Schizosac...    36   0.62    Schizosaccharomyces pombe
sp|Q9PU36|PCLO_CHICK|PCLO_CHICK Piccolo protein (Aczonin) (Fragment).>gb:GG...    36   0.62    Gallus gallus [bantam]
gb:BC072221_2556479 Xenopus laevis hypothetical protein MGC81405...    35   0.81    
gb:AY461402_2533751 Herpetotheres cachinnans recombination activ...    35   0.81    
gb:AY442926_2532647 Lepidosiren paradoxa RAG1 (Rag1) gene, parti...    35   0.81    
gb:AY057000_2510138 Lanius ludovicianus recombination activating...    35   0.81    
gb:AY056978_2510116 Alauda arvensis recombination activating pro...    35   0.81    
gb:AJ719505_2501692 Gallus gallus mRNA for hypothetical protein,...    35   0.81    
gb:AJ719450_2501637 Gallus gallus mRNA for hypothetical protein,...    35   0.81    
gb:AF329945_2487929 Takifugu rubripes SUN-like 1 (SUNL1), chromo...    35   0.81    
gb:FSU22375_2403462 Feldmannia sp. virus Orf1, Orf2, and Orf3 ge...    35   0.81    
gb:AY509253_2354441 Ostreid herpesvirus 1, complete genome.            35   0.81    
gb:AF539999_2273354 Mamestra configurata nucleopolyhedrovirus A ...    35   0.81    
gb:AY294961_2081740 Rhipidomys mastacalis recombination activati...    35   0.81    
gb:AY294960_2081739 Akodon boliviensis recombination activating ...    35   0.81    
gb:AY294958_2081737 Reithrodontomys fulvescens recombination act...    35   0.81    
gb:AY294955_2081734 Mesocricetus auratus recombination activatin...    35   0.81    
gb:AY294953_2081732 Ondatra zibethicus recombination activating ...    35   0.81    
gb:AY241497_2080442 Funisciurus carruthersi RAG1 protein (RAG1) ...    35   0.81    
gb:AY241496_2080441 Protoxerus stangeri RAG1 protein (RAG1) gene...    35   0.81    
gb:AY241495_2080440 Heliosciurus undulatus RAG1 protein (RAG1) g...    35   0.81    
gb:AY241493_2080438 Marmota sibirica RAG1 protein (RAG1) gene, p...    35   0.81    
gb:AY241491_2080436 Tamias ruficaudus RAG1 protein (RAG1) gene, ...    35   0.81    
gb:AY241490_2080435 Tamias amoenus RAG1 protein (RAG1) gene, par...    35   0.81    
gb:AY241489_2080434 Tamias sibiricus RAG1 protein (RAG1) gene, p...    35   0.81    
gb:AY241488_2080433 Sciurotamias davidianus RAG1 protein (RAG1) ...    35   0.81    
gb:AY241483_2080428 Sundasciurus philippinensis RAG1 protein (RA...    35   0.81    
gb:AY241482_2080427 Dremomys pernyi RAG1 protein (RAG1) gene, pa...    35   0.81    
gb:AY241480_2080425 Callosciurus prevostii RAG1 protein (RAG1) g...    35   0.81    
gb:AY241479_2080424 Callosciurus erythraeus RAG1 protein (RAG1) ...    35   0.81    
gb:AY241478_2080423 Microsciurus flaviventer RAG1 protein (RAG1)...    35   0.81    
gb:AY241476_2080421 Sciurus stramineus RAG1 protein (RAG1) gene,...    35   0.81    
gb:AY241474_2080419 Tamiasciurus hudsonicus RAG1 protein (RAG1) ...    35   0.81    
gb:AY241471_2080416 Sciurillus pusillus RAG1 protein (RAG1) gene...    35   0.81    
gb:AY241470_2080415 Ratufa sp. LSUMZ M3476 RAG1 protein (RAG1) g...    35   0.81    
gb:AY241469_2080414 Ratufa bicolor RAG1 protein (RAG1) gene, par...    35   0.81    
gb:AY241466_2080411 Phyllotis xanthopygus chilensis RAG1 protein...    35   0.81    
gb:AY241464_2080409 Microtus irene RAG1 protein (RAG1) gene, par...    35   0.81    
gb:AY241463_2080408 Microtus pennsylvanicus RAG1 protein (RAG1) ...    35   0.81    
gb:BC037344_1982183 Homo sapiens recombination activating gene 1...    35   0.81    
gb:AY249875_1940253 Cynocephalus volans recombination activating...    35   0.81    
gb:AK127206_1916651 Homo sapiens cDNA FLJ45273 fis, clone BRHIP2...    35   0.81    
gb:AE017347_1757678 Cryptococcus neoformans var. neoformans JEC2...    35   0.81    
gb:CR382126_1658894 Kluyveromyces lactis strain NRRL Y-1140 chro...    35   0.81    
gb:BT020956_1436314 Bos taurus tripartite motif-containing 10 (T...    35   0.81    
gb:AY249886_1428006 Dasypus novemcinctus recombination activatin...    35   0.81    
gb:AY249880_1428000 Sylvilagus sp. PPW-2003 recombination activa...    35   0.81    
gb:AY249870_1427994 Nyctimene albiventer recombination activatin...    35   0.81    
gb:AY249869_1427993 Rhinolophus creaghi recombination activating...    35   0.81    
gb:AY249867_1427991 Manis pentadactyla recombination activating ...    35   0.81    
gb:AY239196_1427670 Cyclopes didactylus recombination activating...    35   0.81    
gb:AY239190_1427664 Manis sp. JG-2003 recombination activating p...    35   0.81    
gb:AY239186_1427660 Tapirus indicus recombination activating pro...    35   0.81    
gb:AY239185_1427659 Diceros bicornis recombination activating pr...    35   0.81    
gb:AY239184_1427658 Equus grevyi recombination activating protei...    35   0.81    
gb:AY239183_1427657 Camelus dromedarius recombination activating...    35   0.81    
gb:AY239181_1427655 Hexaprotodon liberiensis recombination activ...    35   0.81    
gb:AY239180_1427654 Balaenoptera physalus recombination activati...    35   0.81    
gb:AY239177_1427651 Ovis canadensis recombination activating pro...    35   0.81    
gb:AY223085_1176550 Schistosoma japonicum clone ZZD132 mRNA sequ...    35   0.81    
pir|S42511|S42511 RAG-1 protein - rabbit                               35   0.81    
pir|A40505|A40505 early protein EP0 - suid herpesvirus 1 (strain...    35   0.81    
sp|P34088|RAG1_RABIT|RAG1_RABIT V(D)J recombination activating protein 1 (R...    35   0.81    
sp|P15918|RAG1_HUMAN|RAG1_HUMAN V(D)J recombination activating protein 1 (R...    35   0.81    
gb:BC077164_2559882 Danio rerio zgc:91888, mRNA (cDNA clone MGC:...    35   1.1     
gb:AY662620_2542610 Aspidoscelis tigris recombination activating...    35   1.1     
gb:AY228793_2520938 Pluvianellus socialis recombination activati...    35   1.1     
gb:AY056996_2510134 Garrulax milleti recombination activating pr...    35   1.1     
gb:AY126275_2298530 Mamestra configurata nucleopolyhedrovirus B,...    35   1.1     
gb:BC088425_2110548 Rattus norvegicus tripartite motif protein 1...    35   1.1     
gb:BC050796_2100449 Mus musculus RIKEN cDNA 0610013E23 gene, mRN...    35   1.1     
gb:AY294934_2081713 Graphiurus murinus recombination activating ...    35   1.1     
gb:AY241487_2080432 Spermophilopsis leptodactylus RAG1 protein (...    35   1.1     
gb:AY241468_2080413 Aplodontia rufa RAG1 protein (RAG1) gene, pa...    35   1.1     
gb:AY033602S4_2074183 Mus musculus putative transcription factor...    35   1.1     
gb:AF302839_2062132 Mus musculus putative tumor suppressor LEU5/...    35   1.1     
gb:AF220129_2059589 Mus musculus tripartite motif protein TRIM13...    35   1.1     
gb:HSU64805_2025481 Homo sapiens Brca1-delta11b (Brca1) mRNA, co...    35   1.1     
gb:HSM806647_2018387 Homo sapiens mRNA; cDNA DKFZp686G1376 (from...    35   1.1     
gb:BC085615_1989924 Homo sapiens breast cancer 1, early onset, m...    35   1.1     
gb:BC072418_1988987 Homo sapiens breast cancer 1, early onset, m...    35   1.1     
gb:BC032328_1980402 Homo sapiens ring finger protein 149, mRNA (...    35   1.1     
gb:BC005084_1969585 Homo sapiens ring finger protein 135, transc...    35   1.1     
gb:AY764035_1961875 Homo sapiens candidate tumor suppressor RFP2...    35   1.1     
gb:AY751490_1961698 Homo sapiens breast and ovarian cancer susce...    35   1.1     
gb:AY598332_1957287 Homo sapiens L13 mRNA, complete cds.>gb:HSA4...    35   1.1     
gb:AY589042_1957236 Gorilla gorilla breast cancer type 1 (BRCA1)...    35   1.1     
gb:AY589040_1957234 Pongo pygmaeus breast cancer type 1 (BRCA1) ...    35   1.1     
gb:AY365046_1948079 Pan troglodytes BRCA1 (BRCA1) gene, complete...    35   1.1     
gb:AY354539_1946931 Homo sapiens IRIS mRNA, complete cds; altern...    35   1.1     
gb:AL137060_1919394 Human DNA sequence from clone RP11-34F20 on ...    35   1.1     
gb:AL137060_1919393 Human DNA sequence from clone RP11-34F20 on ...    35   1.1     
gb:AK074234_1912433 Homo sapiens cDNA FLJ23654 fis, clone COL10108.    35   1.1     
gb:AF279660_1894511 Homo sapiens CAR (RFP2) gene, complete cds; ...    35   1.1     
gb:AF220128_1890726 Homo sapiens tripartite motif protein TRIM13...    35   1.1     
gb:AF207822_1889989 Pan troglodytes BRCA1 (BRCA1) mRNA, partial ...    35   1.1     
gb:AF071593_1880830 Homo sapiens MMSET type II (WHSC1) mRNA, com...    35   1.1     
gb:AB128049_1873988 Macaca mulatta genes, MHC class I region, pa...    35   1.1     
gb:AF289544_1783574 Oryza sativa copI gene, complete cds.>gb:AP0...    35   1.1     
gb:YLI012084_1727905 Yarrowia lipolytica pex10 gene for peroxin 10.    35   1.1     
gb:PSA276592_1701946 Pisum sativum lip1 mutant cop1 gene for con...    35   1.1     
gb:PSA276591_1701945 Pisum sativum cop1 gene for constitutively ...    35   1.1     
gb:CR382132_1665814 Yarrowia lipolytica chromosome F of strain C...    35   1.1     
gb:CR380947_1649136 Candida glabrata strain CBS138 chromosome A ...    35   1.1     
gb:AY557788_1614015 Saccharomyces cerevisiae clone FLH002064.01X...    35   1.1     
gb:AY084366_1569457 Arabidopsis thaliana clone 105564 mRNA, comp...    35   1.1     
gb:AB040053_1519436 Oryza sativa (japonica cultivar-group) rCOP1...    35   1.1     
gb:AB036770_1519049 Yarrowia lipolytica gene for PEX10, complete...    35   1.1     
gb:AB004537_1509114 Schizosaccharomyces pombe 37 kb genomic DNA,...    35   1.1     
gb:CQ783204_1452350 Sequence 3344 from Patent EP1396543.>gb:AK07...    35   1.1     
gb:CQ782963_1452235 Sequence 3103 from Patent EP1396543.>gb:AX08...    35   1.1     
gb:AY249868_1427992 Myotis velifer recombination activating prot...    35   1.1     
gb:AY239191_1427665 Orycteropus afer recombination activating pr...    35   1.1     
gb:AY239178_1427652 Okapia johnstoni recombination activating pr...    35   1.1     
gb:AY077732_1424730 Bos taurus breast and ovarian cancer suscept...    35   1.1     
gb:AF479649_1420917 Bos taurus breast and ovarian cancer suscept...    35   1.1     
gb:AF479648_1420916 Bos taurus breast and ovarian cancer suscept...    35   1.1     
gb:CR858483_1182656 Pongo pygmaeus mRNA; cDNA DKFZp468E119 (from...    35   1.1     
gb:AK013959_1157722 Mus musculus 13 days embryo head cDNA, RIKEN...    35   1.1     
gb:AK002624_1151338 Mus musculus adult male kidney cDNA, RIKEN f...    35   1.1     
gb:AE014296_1135211 Drosophila melanogaster chromosome 3L, compl...    35   1.1     
gb:AE017267_422191 Bacillus cereus ATCC 10987, section 4 of 18 o...    35   1.1     
pir|T39702|T39702 probable peroxisome assembly protein - fission...    35   1.1     
pir|G96695|G96695 hypothetical protein F5A8.9 [imported] - Arabi...    35   1.1     
pir|T45956|T45956 hypothetical protein F7J8.140 - Arabidopsis th...    35   1.1     
sp|Q9CYB0|RPF2_MOUSE|RPF2_MOUSE Ret finger protein 2 (Putative tumor suppre...    35   1.1     
sp|O60858|RPF2_HUMAN|RPF2_HUMAN Ret finger protein 2 (Leukemia associated p...    35   1.1     
sp|Q91829|RAG1_XENLA|RAG1_XENLA V(D)J recombination activating protein 1 (R...    35   1.1     
sp|Q05568|PEXA_YEAST|PEXA_YEAST Peroxisome assembly protein PEX10 (Peroxin-...    35   1.1     
sp|Q9GKK8|BRC1_PANTR|BRC1_PANTR Breast cancer type 1 susceptibility protein...    35   1.1     
sp|P38398|BRC1_HUMAN|BRC1_HUMAN Breast cancer type 1 susceptibility protein...    35   1.1     
sp|Q95153|BRC1_CANFA|BRC1_CANFA Breast cancer type 1 susceptibility protein...    35   1.1     
gb:BC066378_2554269 Danio rerio zgc:77306, mRNA (cDNA clone MGC:...    35   1.4     
gb:BC045329_2549172 Danio rerio zgc:55389, mRNA (cDNA clone MGC:...    35   1.4     
gb:AY662643_2542633 Cordylus polyzonus recombination activating ...    35   1.4     
gb:AY443285_2532899 Ephthianura tricolor recombination activatin...    35   1.4     
gb:AY443279_2532893 Culicicapa ceylonensis recombination activat...    35   1.4     
gb:AY443260_2532874 Ailuroedus melanotis recombination activatin...    35   1.4     
gb:AY319990_2526719 Myadestes unicolor recombination activating ...    35   1.4     
gb:AY319985_2526714 Liocichla steeri recombination activating pr...    35   1.4     
gb:AY319976_2526705 Bleda syndactyla recombination activating pr...    35   1.4     
gb:AY307202_2526228 Oenanthe deserti recombination-activating pr...    35   1.4     
gb:AY057031_2510169 Smithornis rufolateralis recombination activ...    35   1.4     
gb:AY057018_2510156 Philepitta castanea recombination activating...    35   1.4     
gb:AF334030_2236939 Helicoverpa zea single nucleocapsid nucleopo...    35   1.4     
gb:AF303045_2231309 Helicoverpa armigera nuclear polyhedrosis vi...    35   1.4     
gb:AF271059_2225070 Heliocoverpa armigera nucleopolyhedrovirus G...    35   1.4     
gb:BT007783_2150715 Synthetic construct Homo sapiens myosin regu...    35   1.4     
gb:BC087718_2110183 Rattus norvegicus ring finger protein 135 (p...    35   1.4     
gb:AY294950_2081729 Lophuromys flavopunctatus recombination acti...    35   1.4     
gb:AY241481_2080426 Tamiops swinhoei RAG1 protein (RAG1) gene, p...    35   1.4     
gb:BC002860_1968473 Homo sapiens myosin regulatory light chain i...    35   1.4     
gb:AF214680_1890389 Homo sapiens C3HC4-like zinc finger protein ...    35   1.4     
gb:AF187016_1888655 Homo sapiens myosin regulatory light chain i...    35   1.4     
gb:AF006003_1875990 Homo sapiens band 4.1 superfamily member BZF...    35   1.4     
gb:AF111709_1768975 Oryza sativa subsp. indica Retrosat 1 retrot...    35   1.4     
gb:AE017344_1756296 Cryptococcus neoformans var. neoformans JEC2...    35   1.4     
gb:AC096688_1736257 Oryza sativa chromosome 3 BAC OSJNBa0015N08 ...    35   1.4     
gb:CR382136_1668933 Debaryomyces hansenii chromosome D of strain...    35   1.4     
gb:AY081328_1568674 Arabidopsis thaliana unknown protein (At4g21...    35   1.4     
gb:ATF7J7_1550958 Arabidopsis thaliana DNA chromosome 4, BAC clo...    35   1.4     
gb:AB011475_1511369 Arabidopsis thaliana genomic DNA, chromosome...    35   1.4     
gb:AY539935_1178599 Rattus norvegicus LRRGT00184 mRNA, complete ...    35   1.4     
pir|T38671|T38671 Zinc finger, C3HC4 type - fission yeast (Schiz...    35   1.4     
pir|T03072|T03072 probable zinc finger protein - Chilo iridescen...    35   1.4     
pir|H96783|H96783 hypothetical protein F1B16.12 [imported] - Ara...    35   1.4     
pir|T04938|T04938 hypothetical protein F7J7.10 - Arabidopsis tha...    35   1.4     
pir|T10649|T10649 hypothetical protein T13K14.230 - Arabidopsis ...    35   1.4     
pir|A85240|A85240 hypothetical protein AT4g21070 [imported] - Ar...    35   1.4     
sp|P33288|UVS2_NEUCR|UVS2_NEUCR Postreplication repair protein uvs-2.>pir|S...    35   1.4     
sp|Q91187|RAG1_ONCMY|RAG1_ONCMY V(D)J recombination activating protein 1 (R...    35   1.4     
sp|P40266|H11_GLYSA|H11_GLYSA Histone H1-I.>gb:GPTSHISHI_1385475 Glyptoten...    35   1.4     
sp|P40263|H11_GLYBA|H11_GLYBA Histone H1-I.>gb:GPTHISHI_1385472 Glyptotend...    35   1.4     
gb:BC068344_2555032 Danio rerio zgc:56007, mRNA (cDNA clone MGC:...    34   1.8     
gb:BC045857_2549376 Danio rerio zgc:56007, mRNA (cDNA clone MGC:...    34   1.8     
gb:AY662638_2542628 Chalcides ocellatus recombination activating...    34   1.8     
gb:AY662596_2542586 Uracentron flaviceps recombination activatin...    34   1.8     
gb:AY461404_2533753 Micrastur semitorquatus recombination activa...    34   1.8     
gb:AY319994_2526723 Paradoxornis gularis recombination activatin...    34   1.8     
gb:AY319983_2526712 Estrilda astrild recombination activating pr...    34   1.8     
gb:AY057019_2510157 Picathartes gymnocephalus recombination acti...    34   1.8     
gb:AY056979_2510117 Apus affinis recombination activating protei...    34   1.8     
gb:AL954679_2504930 Zebrafish DNA sequence from clone DKEY-63J12...    34   1.8     
gb:AF143737_2477042 Coracias caudata recombination activating pr...    34   1.8     
gb:AY294962_2081741 Irenomys tarsalis recombination activating g...    34   1.8     
gb:AY294951_2081730 Acomys ignitus recombination activating gene...    34   1.8     
gb:AY294949_2081728 Tatera robusta recombination activating gene...    34   1.8     
gb:AY294947_2081726 Meriones shawi recombination activating gene...    34   1.8     
gb:AY294946_2081725 Arvicanthis somalicus recombination activati...    34   1.8     
gb:AY294945_2081724 Mastomys hildebrandtii recombination activat...    34   1.8     
gb:AY294944_2081723 Rhynchomys isarogensis recombination activat...    34   1.8     
gb:AY294943_2081722 Chrotomys gonzalesi recombination activating...    34   1.8     
gb:AY294942_2081721 Apomys hylocoetes recombination activating g...    34   1.8     
gb:AY294940_2081719 Rhabdomys pumilio recombination activating g...    34   1.8     
gb:AY294939_2081718 Parotomys sp. H656 recombination activating ...    34   1.8     
gb:AY294938_2081717 Rattus norvegicus recombination activating g...    34   1.8     
gb:AY241485_2080430 Xerus inauris RAG1 protein (RAG1) gene, part...    34   1.8     
gb:AY241465_2080410 Sigmodon hispidus RAG1 protein (RAG1) gene, ...    34   1.8     
gb:AY241462_2080407 Mus musculus RAG1 protein (RAG1) gene, parti...    34   1.8     
gb:AY241461_2080406 Batomys granti RAG1 protein (RAG1) gene, par...    34   1.8     
gb:AY241460_2080405 Deomys ferrugineus RAG1 protein (RAG1) gene,...    34   1.8     
gb:AB041548_2045418 Mus musculus brain cDNA, clone MNCb-3816, si...    34   1.8     
gb:BC088365_1989972 Homo sapiens PTD016 protein, mRNA (cDNA clon...    34   1.8     
gb:BC056677_1985329 Homo sapiens ring finger protein 128, mRNA (...    34   1.8     
gb:AK126553_1916357 Homo sapiens cDNA FLJ44589 fis, clone BEAST2...    34   1.8     
gb:AK098649_1915171 Homo sapiens cDNA FLJ25783 fis, clone TST06726.    34   1.8     
gb:AK074264_1912441 Homo sapiens cDNA FLJ23684 fis, clone HEP098...    34   1.8     
gb:AF394689_1900599 Homo sapiens GRAIL (GRAIL) mRNA, complete cds.     34   1.8     
gb:AP005158_1848415 Oryza sativa (japonica cultivar-group) genom...    34   1.8     
gb:AC135598_1742717 Oryza sativa chromosome 3 BAC OSJNBb0021K20 ...    34   1.8     
gb:OSJN00168_1696085 Oryza sativa genomic DNA, chromosome 4, BAC...    34   1.8     
gb:CR382134_1667330 Debaryomyces hansenii chromosome B of strain...    34   1.8     
gb:AB026655_1517324 Arabidopsis thaliana genomic DNA, chromosome...    34   1.8     
gb:BT003776_1357093 Drosophila melanogaster RE12056 full insert ...    34   1.8     
gb:CR857287_1181531 Pongo pygmaeus mRNA; cDNA DKFZp469O2321 (fro...    34   1.8     
gb:AK033601_1163427 Mus musculus adult male cecum cDNA, RIKEN fu...    34   1.8     
gb:AK029168_1161377 Mus musculus 0 day neonate head cDNA, RIKEN ...    34   1.8     
gb:AK018582_1159635 Mus musculus adult male cecum cDNA, RIKEN fu...    34   1.8     
gb:AK010228_1155611 Mus musculus adult male tongue cDNA, RIKEN f...    34   1.8     
gb:AK004847_1152639 Mus musculus adult male liver cDNA, RIKEN fu...    34   1.8     
gb:AE014134_1129808 Drosophila melanogaster chromosome 2L, compl...    34   1.8     
gb:AE014134_1129807 Drosophila melanogaster chromosome 2L, compl...    34   1.8     
gb:AE014134_1129806 Drosophila melanogaster chromosome 2L, compl...    34   1.8     
pir|T44967|T44967 gas-vesicle protein gvpC - Halorubrum vacuolat...    34   1.8     
pir|B33754|B33754 recombination-activating protein 1 - mouse           34   1.8     
sp|P15919|RAG1_MOUSE|RAG1_MOUSE V(D)J recombination activating protein 1 (R...    34   1.8     
gb:BC054643_2551052 Danio rerio zgc:64214, mRNA (cDNA clone MGC:...    34   2.4     
gb:BC044430_2548737 Danio rerio zgc:55577, mRNA (cDNA clone MGC:...    34   2.4     
gb:AY662644_2542634 Zonosaurus sp. TMT-2004b recombination activ...    34   2.4     
gb:AY662641_2542631 Typhlosaurus lomii recombination activating ...    34   2.4     
gb:AY662636_2542626 Proscelotes eggeli recombination activating ...    34   2.4     
gb:AY662634_2542624 Eumeces anthracinus recombination activating...    34   2.4     
gb:AY662633_2542623 Eumeces skiltonianus recombination activatin...    34   2.4     
gb:AY662632_2542622 Eumeces inexpectatus recombination activatin...    34   2.4     
gb:AY662613_2542603 Cylindrophis ruffus recombination activating...    34   2.4     
gb:AY662594_2542584 Phymaturus somuncurensis recombination activ...    34   2.4     
gb:AY662576_2542566 Sphenodon punctatus recombination activating...    34   2.4     
gb:AY443295_2532909 Manucodia atra recombination activating prot...    34   2.4     
gb:AY443266_2532880 Chaetops frenatus recombination activating p...    34   2.4     
gb:AY151045_2515305 Danio rerio cysteine-rich motor neuron 1 (cr...    34   2.4     
gb:AY056975_2510113 Acanthisitta chloris recombination activatin...    34   2.4     
gb:AL662880_2504293 Zebrafish DNA sequence from clone BUSM1-182N...    34   2.4     
gb:AF375049_2490141 Xenopus laevis Mel-18 mRNA, partial cds.           34   2.4     
gb:AF298586_2229700 Pseudorabies virus Ea early protein EPO gene...    34   2.4     
gb:BT007764_2150696 Synthetic construct Homo sapiens zinc finger...    34   2.4     
gb:BX883051_2111511 Rattus norvegicus chromosome 20, major histo...    34   2.4     
gb:BC006700_2090321 Mus musculus tripartite motif-containing 59,...    34   2.4     
gb:AY294957_2081736 Peromyscus leucopus recombination activating...    34   2.4     
gb:HSM806120_2018193 Homo sapiens mRNA; cDNA DKFZp686N1030 (from...    34   2.4     
gb:BC068444_1987606 Homo sapiens cDNA clone MGC:86976 IMAGE:4822...    34   2.4     
gb:AY604723_1957364 Pan troglodytes ZFP313 precursor RNA, comple...    34   2.4     
gb:AY589041_1957235 Macaca mulatta breast cancer type 1 (BRCA1) ...    34   2.4     
gb:AY159379_1937393 Homo sapiens tumor suppressor TSBF1 (TSBF1) ...    34   2.4     
gb:AK074329_1912460 Homo sapiens cDNA FLJ23749 fis, clone HEP16452.    34   2.4     
gb:AF220022_1890700 Homo sapiens tripartite motif protein TRIM3 ...    34   2.4     
gb:AF220021_1890699 Homo sapiens tripartite motif protein TRIM3 ...    34   2.4     
gb:CR382125_1657964 Kluyveromyces lactis strain NRRL Y-1140 chro...    34   2.4     
gb:AY647238_1619867 Zea mays unknown mRNA.                             34   2.4     
gb:AY069873_1566619 Arabidopsis thaliana AT5g45290/K9E15_7 mRNA,...    34   2.4     
gb:AY606064_1431885 Sus scrofa zinc finger protein 313 mRNA, com...    34   2.4     
gb:AB158487_1410959 Sus scrofa PPP1R11, ZNRD1, RNF39, TRIM10, TR...    34   2.4     
gb:TBBCHR1A4_1398903 Trypanosoma brucei DNA chromosome 1, segmen...    34   2.4     
gb:PFMAL4P3_1394796 Plasmodium falciparum MAL4P3.                      34   2.4     
gb:AK090256_1176201 Mus musculus 21 days neonate cerebellum cDNA...    34   2.4     
gb:AK078919_1172510 Mus musculus adult male cecum cDNA, RIKEN fu...    34   2.4     
gb:AK046850_1167943 Mus musculus 10 days neonate medulla oblonga...    34   2.4     
gb:AK020617_1160471 Mus musculus adult male urinary bladder cDNA...    34   2.4     
gb:AK016642_1158821 Mus musculus adult male testis cDNA, RIKEN f...    34   2.4     
gb:AK012269_1156865 Mus musculus 11 days embryo whole body cDNA,...    34   2.4     


>pir|T47595|T47595 RING finger protein T12E18.50 - Arabidopsis
           thaliana>gb:ATT12E18_1554324 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T12E18.>gb:AY086065_1571124
           Arabidopsis thaliana clone 20931 mRNA, complete
           sequence.>gb:BT000620_1634898 Arabidopsis thaliana RING
           finger-like protein (At3g54360/T12E18_50) mRNA, complete
           cds.>gb:AF410273_1797087 Arabidopsis thaliana
           AT3g54360/T12E18_50 mRNA, complete cds.
          Length = 405

 Score =  152 bits (385), Expect = 3e-36
 Identities = 83/173 (47%), Positives = 100/173 (57%), Gaps = 9/173 (5%)
 Frame = +2

Query: 146 TPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI 325
           T VCPF KAARPDD S +K GE                    +  S CPF   + A  + 
Sbjct: 4   TSVCPFSKAARPDDGSTRKQGE--------------------ITASGCPF--SKAARPDD 41

Query: 326 KPNQESGEQAKVSSKCPFGYT---QEAGGENKPKQV------SEKPGVMSPKCPLGFDSQ 478
              ++ GE    +S CPF  +    E G +  P+Q       S     +  KCP G+DSQ
Sbjct: 42  ASARKQGETT--ASGCPFSKSARPDENGSKGCPEQEGNLNKDSTDSATVPAKCPFGYDSQ 99

Query: 479 TFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD 637
           TFKLGP SCM+CQALLY+ SRCVPC+HVFCKVC+TRFKDCPLCGAD+E IE D
Sbjct: 100 TFKLGPFSCMLCQALLYESSRCVPCTHVFCKVCLTRFKDCPLCGADIESIEVD 152



>gb:AP002818_1822875 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0436E04.
          Length = 363

 Score =  124 bits (312), Expect = 1e-27
 Identities = 59/120 (49%), Positives = 72/120 (60%), Gaps = 1/120 (0%)
 Frame = +2

Query: 281 SKCPFVHKQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGEN-KPKQVSEKPGVMSPKC 457
           S CPF     AG+       S       +K    +T +   +N K    +  P V+ PKC
Sbjct: 3   SLCPFAKLASAGATCPVKSSS------DNKTTINHTDDDDDDNEKTGNANTDPRVVPPKC 56

Query: 458 PLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEAD 637
           P G+DS TFKLGPLSCM+C ALL+  S+C PCSH FCK CI RFKDCPLCGAD++ IE D
Sbjct: 57  PFGYDSNTFKLGPLSCMVCHALLHQSSKCTPCSHKFCKACILRFKDCPLCGADIQGIEPD 116



>gb:AP004094_1837610 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1695_H09.
          Length = 365

 Score =  114 bits (284), Expect = 2e-24
 Identities = 55/122 (45%), Positives = 71/122 (58%), Gaps = 3/122 (2%)
 Frame = +2

Query: 281 SKCPFVHKQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPK--QVSEKPGVMSPK 454
           S CPF     AG+      ++      ++ CP         ++  K    +  P V+  K
Sbjct: 3   SLCPFAKLASAGATCPVKSDNK-----TTSCPVTANNHTDDDDNEKTGNANTDPRVVPAK 57

Query: 455 CPLGFDSQ-TFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIE 631
           CP G+DS  TFKLGPLSC++C ALL+  S+C PCSH FCK CI RFKDCPLCGAD++ IE
Sbjct: 58  CPFGYDSNNTFKLGPLSCVVCHALLHQSSKCTPCSHKFCKACILRFKDCPLCGADIQGIE 117

Query: 632 AD 637
            D
Sbjct: 118 PD 119



>gb:BC064721_2553889 Xenopus tropicalis hypothetical protein
           MGC75959, mRNA (cDNA clone MGC:75959 IMAGE:5384094),
           complete cds.
          Length = 626

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 50/175 (28%), Positives = 77/175 (44%), Gaps = 22/175 (12%)
 Frame = +2

Query: 170 AARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQA---GSEIKPNQE 340
           +++ D  S ++P  S S     S  P   + EPA     C  ++K QA   G +++  ++
Sbjct: 144 SSQDDQLSYEEPQPSTSTSSLFST-PTTSASEPA-----CTLLYKSQASVPGVQLESGEK 197

Query: 341 SGEQAKVSSKCPFGYTQEAGGENKPKQVSE-------KPGVMSPKCPLGF--DSQTFKLG 493
           SGE  +  S        E G    PK+             ++S  C  G   +S+T  + 
Sbjct: 198 SGESLEGHSSTSDATAHEKGSLGPPKKRMRTEDLWTGNKNLVSASCSKGASDESKTPSMK 257

Query: 494 P------LSCMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLCGADVEKI 628
           P      L+C+ICQ LL+DC    PC H FC  C + + +    CP C   VE+I
Sbjct: 258 PDKMEETLTCIICQELLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERI 312



>gb:BC089260_2566141 Xenopus laevis cDNA clone MGC:85038
           IMAGE:6326619, complete cds.
          Length = 625

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 33/100 (33%), Positives = 47/100 (47%), Gaps = 19/100 (19%)
 Frame = +2

Query: 386 TQEAGGENKPKQV-------SEKPGVMSPKCPLGF--DSQTFKLGP------LSCMICQA 520
           TQE G    PK+        +     +   CP+G   +S+T  + P      L+C+ICQ 
Sbjct: 212 TQEQGSLGPPKKRIRTEDHWTTNKNFVPASCPIGASDESKTPSMKPDKMEETLTCIICQE 271

Query: 521 LLYDCSRCVPCSHVFCKVCITRFKD----CPLCGADVEKI 628
           LL+DC    PC H FC  C + + +    CP C   VE+I
Sbjct: 272 LLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERI 311



>gb:AL772284_1932818 Human DNA sequence from clone RP13-347D8 on
           chromosome X Contains a pseudogene similar to part of
           KIAA0633 protein (COBL), the RNF127 gene for ring finger
           protein 127 (FLJ40322, FLJ34458, FLJ22612), gene
           KIAA1210 and three CpG islands, complete sequence.
          Length = 524

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 38/152 (25%), Positives = 62/152 (40%), Gaps = 6/152 (3%)
 Frame = +2

Query: 170 AARPDDASVKKPGE--SQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQES 343
           AAR D +S+  P +     +QH   ++ ++E    A  P       K  +    K  ++ 
Sbjct: 133 AARGDGSSLMDPAKVKGDGQQHHMKDQEEEEEKWDATSP-------KAASSKTGKCQEKK 185

Query: 344 GEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQAL 523
            +  ++ S+   G   +A  ++ P    +KP +  P         +F    L C +C  L
Sbjct: 186 RKHCQIESQEETGMPNKASKQDPPTDQGDKPALSLPLA-------SFDASDLECALCMRL 238

Query: 524 LYDCSRCVPCSHVFCKVCITRFKD----CPLC 607
            Y+     PC H FC  C+ R  D    CPLC
Sbjct: 239 FYE-PVTTPCGHTFCLKCLERCLDHNAKCPLC 269



>gb:AL772284_1932816 Human DNA sequence from clone RP13-347D8 on
           chromosome X Contains a pseudogene similar to part of
           KIAA0633 protein (COBL), the RNF127 gene for ring finger
           protein 127 (FLJ40322, FLJ34458, FLJ22612), gene
           KIAA1210 and three CpG islands, complete sequence.
          Length = 718

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 38/152 (25%), Positives = 62/152 (40%), Gaps = 6/152 (3%)
 Frame = +2

Query: 170 AARPDDASVKKPGE--SQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQES 343
           AAR D +S+  P +     +QH   ++ ++E    A  P       K  +    K  ++ 
Sbjct: 327 AARGDGSSLMDPAKVKGDGQQHHMKDQEEEEEKWDATSP-------KAASSKTGKCQEKK 379

Query: 344 GEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQAL 523
            +  ++ S+   G   +A  ++ P    +KP +  P         +F    L C +C  L
Sbjct: 380 RKHCQIESQEETGMPNKASKQDPPTDQGDKPALSLPLA-------SFDASDLECALCMRL 432

Query: 524 LYDCSRCVPCSHVFCKVCITRFKD----CPLC 607
            Y+     PC H FC  C+ R  D    CPLC
Sbjct: 433 FYE-PVTTPCGHTFCLKCLERCLDHNAKCPLC 463



>gb:AK091777_1913560 Homo sapiens cDNA FLJ34458 fis, clone
           HLUNG2002811, weakly similar to Zinc finger
           protein.>gb:AL772284_1932817 Human DNA sequence from
           clone RP13-347D8 on chromosome X Contains a pseudogene
           similar to part of KIAA0633 protein (COBL), the RNF127
           gene for ring finger protein 127 (FLJ40322, FLJ34458,
           FLJ22612), gene KIAA1210 and three CpG islands, complete
           sequence.
          Length = 610

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 38/152 (25%), Positives = 62/152 (40%), Gaps = 6/152 (3%)
 Frame = +2

Query: 170 AARPDDASVKKPGE--SQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQES 343
           AAR D +S+  P +     +QH   ++ ++E    A  P       K  +    K  ++ 
Sbjct: 368 AARGDGSSLMDPAKVKGDGQQHHMKDQEEEEEKWDATSP-------KAASSKTGKCQEKK 420

Query: 344 GEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQAL 523
            +  ++ S+   G   +A  ++ P    +KP +  P         +F    L C +C  L
Sbjct: 421 RKHCQIESQEETGMPNKASKQDPPTDQGDKPALSLPLA-------SFDASDLECALCMRL 473

Query: 524 LYDCSRCVPCSHVFCKVCITRFKD----CPLC 607
            Y+     PC H FC  C+ R  D    CPLC
Sbjct: 474 FYE-PVTTPCGHTFCLKCLERCLDHNAKCPLC 504



>gb:AK026265_1910575 Homo sapiens cDNA: FLJ22612 fis, clone
           HSI04965.
          Length = 516

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 38/152 (25%), Positives = 62/152 (40%), Gaps = 6/152 (3%)
 Frame = +2

Query: 170 AARPDDASVKKPGE--SQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQES 343
           AAR D +S+  P +     +QH   ++ ++E    A  P       K  +    K  ++ 
Sbjct: 125 AARGDGSSLMDPAKVKGDGQQHHMKDQEEEEEKWDATSP-------KAASSKTGKCQEKK 177

Query: 344 GEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQAL 523
            +  ++ S+   G   +A  ++ P    +KP +  P         +F    L C +C  L
Sbjct: 178 RKHCQIESQEETGMPNKASKQDPPTDQGDKPALSLPLA-------SFDASDLECALCMRL 230

Query: 524 LYDCSRCVPCSHVFCKVCITRFKD----CPLC 607
            Y+     PC H FC  C+ R  D    CPLC
Sbjct: 231 FYE-PVTTPCGHTFCLKCLERCLDHNAKCPLC 261



>gb:AB097555_1872458 Macaca fascicularis brain cDNA
           clone:QmoA-15092, full insert sequence.
          Length = 718

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 38/152 (25%), Positives = 62/152 (40%), Gaps = 6/152 (3%)
 Frame = +2

Query: 170 AARPDDASVKKPGE--SQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQES 343
           AAR D +S+  P +     +QH   ++ ++E    A  P       K  +    K  ++ 
Sbjct: 327 AARGDGSSLMDPAKVKGDGQQHHMKDQEEEEEKWDATSP-------KAASSKTGKCQEKK 379

Query: 344 GEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQAL 523
            +  ++ S+   G   +A  ++ P    +KP +  P         +F    L C +C  L
Sbjct: 380 RKHCQIESQEDTGMPNKASKQDPPTDQGDKPALSLPLA-------SFDASDLECALCMRL 432

Query: 524 LYDCSRCVPCSHVFCKVCITRFKD----CPLC 607
            Y+     PC H FC  C+ R  D    CPLC
Sbjct: 433 FYE-PVTTPCGHTFCLKCLERCLDHNAKCPLC 463



>gb:BC087162_2110049 Rattus norvegicus checkpoint with forkhead and
           ring finger domains (predicted), mRNA (cDNA clone
           MGC:95316 IMAGE:7135077), complete cds.
          Length = 663

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 4/48 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLCGADVEKI 628
           L+C+ICQ LL+DC    PC H FC  C + + +    CP C   VE+I
Sbjct: 301 LTCIICQDLLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERI 348



>gb:BC012072_1973415 Homo sapiens checkpoint with forkhead and ring
           finger domains, mRNA (cDNA clone MGC:19963
           IMAGE:4650348), complete cds.
          Length = 652

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 4/48 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLCGADVEKI 628
           L+C+ICQ LL+DC    PC H FC  C + + +    CP C   VE+I
Sbjct: 290 LTCIICQDLLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERI 337



>gb:AX877222_1476895 Sequence 12127 from Patent
           EP1074617.>gb:AK001658_1908563 Homo sapiens cDNA
           FLJ10796 fis, clone NT2RP4000648, weakly similar to
           TRANS-ACTING TRANSCRIPTIONAL PROTEIN ICP0.
          Length = 623

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 4/48 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLCGADVEKI 628
           L+C+ICQ LL+DC    PC H FC  C + + +    CP C   VE+I
Sbjct: 261 LTCIICQDLLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERI 308



>gb:AX877194_1476881 Sequence 12099 from Patent
           EP1074617.>gb:AK027687_1911158 Homo sapiens cDNA
           FLJ14781 fis, clone NT2RP4000455, weakly similar to
           TRANS-ACTING TRANSCRIPTIONAL PROTEIN ICP0.
          Length = 652

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 4/48 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLCGADVEKI 628
           L+C+ICQ LL+DC    PC H FC  C + + +    CP C   VE+I
Sbjct: 290 LTCIICQDLLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERI 337



>gb:AX405642_1467570 Sequence 57 from Patent WO0222660.
          Length = 623

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 4/48 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLCGADVEKI 628
           L+C+ICQ LL+DC    PC H FC  C + + +    CP C   VE+I
Sbjct: 261 LTCIICQDLLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERI 308



>gb:CR857284_1181528 Pongo pygmaeus mRNA; cDNA DKFZp469H0121 (from
           clone DKFZp469H0121).
          Length = 571

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 4/48 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLCGADVEKI 628
           L+C+ICQ LL+DC    PC H FC  C + + +    CP C   VE+I
Sbjct: 210 LTCIICQDLLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERI 257



>gb:AK077629_1171963 Mus musculus 8 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:5730484M20
           product:similar to CELL CYCLE CHECKPOINT PROTEIN CHFR
           [Homo sapiens], full insert sequence.
          Length = 663

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 4/48 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLCGADVEKI 628
           L+C+ICQ LL+DC    PC H FC  C + + +    CP C   VE+I
Sbjct: 301 LTCIICQDLLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERI 348



>sp|Q810L3|CHFR_MOUSE Ubiquitin ligase protein CHFR (EC 6.3.2.-)
           (Checkpoint with forkhead and RING finger domains
           protein).>gb:BC049792_2100197 Mus musculus checkpoint
           with forkhead and ring finger domains, mRNA (cDNA clone
           MGC:59419 IMAGE:6510480), complete cds.
          Length = 664

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 4/48 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLCGADVEKI 628
           L+C+ICQ LL+DC    PC H FC  C + + +    CP C   VE+I
Sbjct: 301 LTCIICQDLLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERI 348



>sp|Q96EP1|CHFR_HUMAN Ubiquitin ligase protein CHFR (EC 6.3.2.-)
           (Checkpoint with forkhead and RING finger domains
           protein).>gb:AF170724_1887561 Homo sapiens cell cycle
           checkpoint protein CHFR mRNA, complete cds.
          Length = 664

 Score = 49.7 bits (117), Expect = 4e-05
 Identities = 21/48 (43%), Positives = 28/48 (58%), Gaps = 4/48 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLCGADVEKI 628
           L+C+ICQ LL+DC    PC H FC  C + + +    CP C   VE+I
Sbjct: 302 LTCIICQDLLHDCVSLQPCMHTFCAACYSGWMERSSLCPTCRCPVERI 349



>gb:AK016522_1158757 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:4932412G04
           product:hypothetical ATP-dependent protease La (LON)
           domain containing protein, full insert sequence.
          Length = 753

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 41/161 (25%), Positives = 63/161 (39%), Gaps = 8/161 (4%)
 Frame = +2

Query: 149 PVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPS----KCPFVHKQQAG 316
           P C   + A   + S      +Q K     ++ K + GE     S    KC    K++  
Sbjct: 360 PHCSNQEGAAAAEESSSLANSAQGKVSSKEDRKKDQEGEDRDAASVRTGKCQ--EKKRNR 417

Query: 317 SEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGP 496
            +I+  +++    KVS             ++ P +   KP + +P   LG    +F    
Sbjct: 418 CQIETQEDTELPNKVSK------------QDFPAEQGAKPDLSNP---LG----SFDASD 458

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLC 607
           L C +C  L Y+     PC H FC  C+ R  D    CPLC
Sbjct: 459 LECSLCMRLFYE-PVTTPCGHTFCLKCLERCLDHNAKCPLC 498



>gb:BC053151_2550543 Danio rerio B lymphoma Mo-MLV insertion region
           1 homolog (mouse) B, mRNA (cDNA clone MGC:63927
           IMAGE:6790897), complete cds.
          Length = 324

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           L C++C     D +  V C H FCK+CI R+    K CP+C   V K
Sbjct: 16  LMCVLCGGYFIDATTIVECLHSFCKMCIVRYLETSKYCPICDVQVHK 62



>gb:BC029501_1979523 Homo sapiens ring finger protein 151, mRNA
           (cDNA clone IMAGE:5272560), partial cds.
          Length = 244

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 24/61 (39%), Positives = 34/61 (55%), Gaps = 7/61 (11%)
 Frame = +2

Query: 464 GFDSQTFKLGPLS---CMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVE 622
           G+D   F   P S   C +C  +L   +R +PCSH+FCK CI R+    K CP C  +V+
Sbjct: 3   GYDLNLFASPPDSNFVCSVCHGVLKRPAR-LPCSHIFCKKCILRWLARQKTCPCCRKEVK 61

Query: 623 K 625
           +
Sbjct: 62  R 62



>gb:AP004053_1836980 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1234_B11.
          Length = 408

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 6/79 (7%)
 Frame = +2

Query: 392 EAGGENKPKQVSEKPG--VMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVF 565
           E  GEN+P++ + +P   V S    +    +  KL  +SC +C+ LLY  +  + C HV+
Sbjct: 142 EIDGENRPEESNSRPPQEVTSDGNTINGHPKKVKLEDVSCALCKELLYQPA-VLNCGHVY 200

Query: 566 CKVCITRFKD----CPLCG 610
           C  C++   D    C +CG
Sbjct: 201 CMSCLSSLDDGALKCQVCG 219



>gb:BC049423_2550233 Danio rerio B lymphoma Mo-MLV insertion region
           1 homolog (mouse), mRNA (cDNA clone MGC:56403
           IMAGE:5605189), complete cds.
          Length = 320

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           L C++C     D +  + C H FCK+CI R+    K CP+C   V K
Sbjct: 16  LMCVLCGGYFIDATTIIECLHSFCKMCIVRYLETSKYCPICDVQVHK 62



>gb:AB074153_2463268 Danio rerio psc1 gene, complete cds.
          Length = 322

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           L C++C     D +  + C H FCK+CI R+    K CP+C   V K
Sbjct: 18  LMCVLCGGYFIDATTIIECLHSFCKMCIVRYLETSKYCPICDVQVHK 64



>gb:BC082694_2562838 Xenopus laevis hypothetical LOC494698, mRNA
           (cDNA clone MGC:86196 IMAGE:6956907), complete cds.
          Length = 323

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           L C++C     D +  + C H FCK CI R+    K CP+C   V K
Sbjct: 16  LMCVLCGGYFIDAATIIECLHSFCKTCIVRYLETSKYCPICDVQVHK 62



>gb:BC072892_2556816 Xenopus laevis xbmi-1 protein, mRNA (cDNA clone
           MGC:80331 IMAGE:5074060), complete cds.
          Length = 326

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           L C++C     D +  + C H FCK CI R+    K CP+C   V K
Sbjct: 16  LMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHK 62



>gb:AY616032_2540541 Gallus gallus BMI1 mRNA, complete cds.
          Length = 326

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           L C++C     D +  + C H FCK CI R+    K CP+C   V K
Sbjct: 16  LMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHK 62



>gb:BT019449_2151365 Synthetic construct Homo sapiens B lymphoma
           Mo-MLV insertion region (mouse) mRNA, partial cds.
          Length = 327

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           L C++C     D +  + C H FCK CI R+    K CP+C   V K
Sbjct: 16  LMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHK 62



>gb:MUSBMI1B_2125268 Mouse zinc finger protein (bmi-1) gene,
           complete cds.
          Length = 249

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           L C++C     D +  + C H FCK CI R+    K CP+C   V K
Sbjct: 16  LMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHK 62



>gb:S62198S1_2040705 Homo sapiens flvi-2/bmi-1 (flvi-2/bmi-1) mRNA,
           partial cds.
          Length = 289

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           L C++C     D +  + C H FCK CI R+    K CP+C   V K
Sbjct: 5   LMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHK 51



>gb:CR456911_1993118 Homo sapiens full open reading frame cDNA clone
           RZPDo834E1018D for gene COMMD3, COMM domain containing
           3; complete cds, incl. stopcodon.
          Length = 326

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           L C++C     D +  + C H FCK CI R+    K CP+C   V K
Sbjct: 16  LMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHK 62



>gb:BT019450_1991072 Homo sapiens B lymphoma Mo-MLV insertion region
           (mouse) mRNA, complete cds.
          Length = 326

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           L C++C     D +  + C H FCK CI R+    K CP+C   V K
Sbjct: 16  LMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHK 62



>gb:AL158211_1921451 Human DNA sequence from clone RP11-573G6 on
           chromosome 10 Contains a ribosomal protein L31 (RPL31)
           pseudogene, the BUP gene for BUP protein, the BMI1 gene
           for B lymphoma Mo-MLV insertion region (mouse)
           (MGC12685), the 5' end of the SPAG6 gene for sperm
           associated antigen 6 (pf16, MGC26276,
           Repro-SA-1,DKFZp434I153), the 5' end of a novel gene and
           seven CpG islands, complete sequence.
          Length = 105

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           L C++C     D +  + C H FCK CI R+    K CP+C   V K
Sbjct: 16  LMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHK 62



>gb:AL158211_1921450 Human DNA sequence from clone RP11-573G6 on
           chromosome 10 Contains a ribosomal protein L31 (RPL31)
           pseudogene, the BUP gene for BUP protein, the BMI1 gene
           for B lymphoma Mo-MLV insertion region (mouse)
           (MGC12685), the 5' end of the SPAG6 gene for sperm
           associated antigen 6 (pf16, MGC26276,
           Repro-SA-1,DKFZp434I153), the 5' end of a novel gene and
           seven CpG islands, complete sequence.
          Length = 92

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           L C++C     D +  + C H FCK CI R+    K CP+C   V K
Sbjct: 16  LMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHK 62



>gb:AL158211_1921449 Human DNA sequence from clone RP11-573G6 on
           chromosome 10 Contains a ribosomal protein L31 (RPL31)
           pseudogene, the BUP gene for BUP protein, the BMI1 gene
           for B lymphoma Mo-MLV insertion region (mouse)
           (MGC12685), the 5' end of the SPAG6 gene for sperm
           associated antigen 6 (pf16, MGC26276,
           Repro-SA-1,DKFZp434I153), the 5' end of a novel gene and
           seven CpG islands, complete sequence.
          Length = 150

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           L C++C     D +  + C H FCK CI R+    K CP+C   V K
Sbjct: 16  LMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHK 62



>gb:AL158211_1921448 Human DNA sequence from clone RP11-573G6 on
           chromosome 10 Contains a ribosomal protein L31 (RPL31)
           pseudogene, the BUP gene for BUP protein, the BMI1 gene
           for B lymphoma Mo-MLV insertion region (mouse)
           (MGC12685), the 5' end of the SPAG6 gene for sperm
           associated antigen 6 (pf16, MGC26276,
           Repro-SA-1,DKFZp434I153), the 5' end of a novel gene and
           seven CpG islands, complete sequence.
          Length = 207

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           L C++C     D +  + C H FCK CI R+    K CP+C   V K
Sbjct: 16  LMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHK 62



>pir|I54339|I54339 proto-oncogene bmi-1 - human>gb:HUMBMI1X_2029625
           Human prot-oncogene (BMI-1) mRNA, complete cds.
          Length = 326

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           L C++C     D +  + C H FCK CI R+    K CP+C   V K
Sbjct: 16  LMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHK 62



>pir|I51694|I51694 transforming protein bmi1 - African clawed
           frog>gb:XLU39959_2583362 Xenopus laevis proto-oncogene
           xbmi-1 mRNA, complete cds.
          Length = 326

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           L C++C     D +  + C H FCK CI R+    K CP+C   V K
Sbjct: 16  LMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHK 62



>sp|P25916|BMI1_MOUSE Polycomb complex protein
           BMI-1.>pir|A39523|A39523 transforming protein bmi1 -
           mouse>gb:BC053708_2101558 Mus musculus B lymphoma Mo-MLV
           insertion region 1, mRNA (cDNA clone MGC:60636
           IMAGE:30074540), complete cds.>gb:BC056384_2102357 Mus
           musculus B lymphoma Mo-MLV insertion region 1, mRNA
           (cDNA clone MGC:73913 IMAGE:6854104), complete
           cds.>gb:MUSBMI1_2125266 Mouse zinc finger protein
           (bmi-1) gene, complete cds.>gb:MUSBMI1A_2125267 Mouse B
           cell-specific Mo-MLV integration site 1 (bmi-1) mRNA,
           complete cds.
          Length = 324

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           L C++C     D +  + C H FCK CI R+    K CP+C   V K
Sbjct: 16  LMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHK 62



>sp|P35226|BMI1_HUMAN Polycomb complex protein
           BMI-1.>gb:CR859740_1183843 Pongo pygmaeus mRNA; cDNA
           DKFZp468N068 (from clone
           DKFZp468N068).>gb:AL158211_1921447 Human DNA sequence
           from clone RP11-573G6 on chromosome 10 Contains a
           ribosomal protein L31 (RPL31) pseudogene, the BUP gene
           for BUP protein, the BMI1 gene for B lymphoma Mo-MLV
           insertion region (mouse) (MGC12685), the 5' end of the
           SPAG6 gene for sperm associated antigen 6 (pf16,
           MGC26276, Repro-SA-1,DKFZp434I153), the 5' end of a
           novel gene and seven CpG islands, complete
           sequence.>gb:BC011652_1973103 Homo sapiens polycomb
           group ring finger 4, mRNA (cDNA clone MGC:12685
           IMAGE:4138748), complete cds.
          Length = 326

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           L C++C     D +  + C H FCK CI R+    K CP+C   V K
Sbjct: 16  LMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHK 62



>sp|Q9TST0|BMI1_FELCA Polycomb complex protein
           BMI-1.>gb:FDO132013_1440157 Felis domesticus mRNA for
           Bmi-1 protein.
          Length = 326

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           L C++C     D +  + C H FCK CI R+    K CP+C   V K
Sbjct: 16  LMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHK 62



>gb:BC068930_2555424 Xenopus laevis hypothetical protein MGC83173,
           mRNA (cDNA clone MGC:83173 IMAGE:6631376), complete cds.
          Length = 317

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           L C +C     D +  V C H FCK CI R+    K CP+C + V K
Sbjct: 16  LMCALCGGYFIDAATIVECLHSFCKTCILRYLEAHKFCPMCDSQVHK 62



>gb:BC068725_2555226 Xenopus laevis hypothetical protein MGC81178,
           mRNA (cDNA clone MGC:81178 IMAGE:6318210), complete cds.
          Length = 317

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           L C +C     D +  V C H FCK CI R+    K CP+C + V K
Sbjct: 16  LMCALCGGYFIDAATIVECLHSFCKTCILRYLEAHKFCPMCDSQVHK 62



>gb:AY261359_2319423 Bovine herpesvirus 5 strain SV507/99, complete
           genome.
          Length = 720

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 4/47 (8%)
 Frame = +2

Query: 500 SCMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLCGADVEKI 628
           SC IC  ++   +R +PC H FC  CI R+ +    CPLC A V  +
Sbjct: 20  SCCICLDVITGAARALPCLHAFCLACIRRWLEGRPTCPLCKAPVRSL 66



>gb:BT007960_2150892 Synthetic construct Homo sapiens zinc finger
           protein 144 (Mel-18) mRNA, partial cds.
          Length = 345

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           L C +C     D +  V C H FCK CI R+    K CP+C   V K
Sbjct: 16  LMCALCGGYFIDATTIVECLHSFCKTCIVRYLETNKYCPMCDVQVHK 62



>sp|P23798|ME18_MOUSE DNA-binding protein Mel-18 (RING finger
           protein 110) (Zinc finger protein
           144).>pir|A37991|A37991 DNA-binding protein Mel-18 -
           mouse>gb:AF483502_2066879 Mus musculus strain ILS mel-18
           protein mRNA, complete cds.>gb:AF483503_2066880 Mus
           musculus strain ISS mel-18 protein mRNA, complete
           cds.>gb:BC016419_2092289 Mus musculus ring finger
           protein 110, mRNA (cDNA clone MGC:25374 IMAGE:4458285),
           complete cds.>gb:MUSMEL18_2128915 Mus musculus Mel-18
           mRNA, complete cds.
          Length = 342

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           L C +C     D +  V C H FCK CI R+    K CP+C   V K
Sbjct: 16  LMCALCGGYFIDATTIVECLHSFCKTCIVRYLETNKYCPMCDVQVHK 62



>sp|P35227|ME18_HUMAN DNA-binding protein Mel-18 (RING finger
           protein 110) (Zinc finger protein
           144).>pir|JN0717|JN0717 DNA-binding Mel-18 protein -
           human>gb:BC004858_1969392 Homo sapiens polycomb group
           ring finger 2, mRNA (cDNA clone MGC:10336
           IMAGE:3841545), complete cds.>gb:BC024255_1978307 Homo
           sapiens polycomb group ring finger 2, mRNA (cDNA clone
           MGC:10545 IMAGE:3605568), complete
           cds.>gb:HUMMEL18_2034261 Homo sapiens mRNA for Mel-18
           protein, complete cds.
          Length = 344

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           L C +C     D +  V C H FCK CI R+    K CP+C   V K
Sbjct: 16  LMCALCGGYFIDATTIVECLHSFCKTCIVRYLETNKYCPMCDVQVHK 62



>sp|P29836|ICP0_BHV1K Trans-acting transcriptional protein ICP0
           (P135 protein) (IER 2.9/ER2.6).>pir|A38209|EDBE22
           immediate-early protein IER2.9 - bovine herpesvirus 1
           (strain K22)>gb:HSBP135A_2437562 Bovine herpesvirus type
           1 p135 protein (EI2.9/E2.6) gene, complete cds.
          Length = 676

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 4/47 (8%)
 Frame = +2

Query: 500 SCMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLCGADVEKI 628
           SC IC   +   +R +PC H FC  CI R+ +    CPLC A V+ +
Sbjct: 12  SCCICLDAITGAARALPCLHAFCLACIRRWLEGRPTCPLCKAPVQSL 58



>sp|P29128|ICP0_BHV1J Trans-acting transcriptional protein ICP0
           (P135 protein) (IER 2.9/ER2.6).>pir|B38209|EDBE23
           immediate-early protein IER2.9 - bovine herpesvirus 1
           (strain Jura)>gb:BHV1CGEN_2394474 Bovine herpesvirus
           type 1.1 complete genome.>gb:HSBP135B_2437563 Bovine
           herpesvirus type 1 p135 protein (EI2.9/E2.6) gene,
           complete cds.
          Length = 676

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 19/47 (40%), Positives = 26/47 (55%), Gaps = 4/47 (8%)
 Frame = +2

Query: 500 SCMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLCGADVEKI 628
           SC IC   +   +R +PC H FC  CI R+ +    CPLC A V+ +
Sbjct: 12  SCCICLDAITGAARALPCLHAFCLACIRRWLEGRPTCPLCKAPVQSL 58



>gb:TBBCHR1A3_1398818 Trypanosoma brucei DNA chromosome 1, segment
           3/4.
          Length = 713

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 21/58 (36%), Positives = 28/58 (48%)
 Frame = +2

Query: 446 SPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADV 619
           S  C  G+  + +K+G   C +CQ         +PC HVFC  C    K CPLC  +V
Sbjct: 6   SANCVYGYPPR-WKVG---CGMCQKRWAVSMESIPCGHVFCSTCFPEIKVCPLCCGEV 59



>gb:AE014134_1129561 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003657_1219668 Drosophila melanogaster
           chromosome 2L, section 66 of 83 of the complete
           sequence.>gb:AY113298_1299246 Drosophila melanogaster
           AT24563 full insert cDNA.
          Length = 187

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 35/131 (26%), Positives = 53/131 (40%), Gaps = 20/131 (15%)
 Frame = +2

Query: 284 KCPFVHKQQAGSEIKPNQES----------GEQAKVSSKCPFGYTQ--EAGGENKPKQVS 427
           + PF+ +  + SE   + +S             +   S  P G+T+  ++  ++ P +  
Sbjct: 61  RTPFLLEYSSDSESSSSSDSESSSTSISFDSSMSSTESSTPMGHTESSDSNEDSPPNKRI 120

Query: 428 EKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVP----CSHVFCKVCITRFKD 595
           +     S K  L          P +C +C   L D    +P    C HVFCK CI R  D
Sbjct: 121 KSDDEESKKSVL----------PYNCPVC---LEDVREKLPVSTNCGHVFCKACIKRAVD 167

Query: 596 ----CPLCGAD 616
               CPLCG D
Sbjct: 168 TGRVCPLCGVD 178



>gb:CP000001_851400 Bacillus cereus ZK, complete genome.
          Length = 913

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 33/96 (34%), Positives = 48/96 (50%), Gaps = 2/96 (2%)
 Frame = +2

Query: 158 PFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI-KPN 334
           P  +  +P + + +KPGE   K    +EKP +E+G+P     K         G EI KP 
Sbjct: 688 PGEETGKPGEET-EKPGEETEKPGEETEKPGEETGKPGEETGK--------PGEEIEKPG 738

Query: 335 QESGEQAKVSSKCPFGYTQEAGGE-NKPKQVSEKPG 439
           +E+G   + + K P G T + G E  KP +  EKPG
Sbjct: 739 EETGTSGEETEK-PGGETGKPGEETGKPGEEIEKPG 773



 Score = 41.2 bits (95), Expect = 0.015
 Identities = 30/100 (30%), Positives = 49/100 (49%), Gaps = 1/100 (1%)
 Frame = +2

Query: 158 PFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQ 337
           P  +  +P + + +KPGE   K    +EKP +E+ EP     K P    ++ G E +   
Sbjct: 541 PGEETEKPSEET-EKPGEETEKPGEETEKPGEETEEPGEETEK-PGEETEKPGEETEKPG 598

Query: 338 ESGEQAKVSSKCPFGYTQEAGGE-NKPKQVSEKPGVMSPK 454
           E  E+    ++ P   T++ G E  KP + +EKPG  + K
Sbjct: 599 EETEKPGEETEKPGEETEKPGEETEKPGEETEKPGEETEK 638



 Score = 39.3 bits (90), Expect = 0.056
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 2/83 (2%)
 Frame = +2

Query: 197 KKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI-KPNQESGEQAKVSSKC 373
           +KPGE   K    +EKP +E+ +P     K P    ++ G E  KP +E+G+  + + K 
Sbjct: 644 EKPGEETEKPGEETEKPGEETEKPGEETEK-PGEETEKPGEETEKPGEETGKPGEETEK- 701

Query: 374 PFGYTQEAGGE-NKPKQVSEKPG 439
           P   T++ G E  KP + + KPG
Sbjct: 702 PGEETEKPGEETEKPGEETGKPG 724



 Score = 39.3 bits (90), Expect = 0.056
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 1/87 (1%)
 Frame = +2

Query: 197 KKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCP 376
           +KPGE   K    +EKP +E+ +P     K P    ++ G E +   E  E+    ++ P
Sbjct: 623 EKPGEETEKPGEETEKPGEETEKPGEETEK-PGEETEKPGEETEKPGEETEKPGEETEKP 681

Query: 377 FGYTQEAGGE-NKPKQVSEKPGVMSPK 454
              T++ G E  KP + +EKPG  + K
Sbjct: 682 GEETEKPGEETGKPGEETEKPGEETEK 708



 Score = 38.9 bits (89), Expect = 0.074
 Identities = 28/83 (33%), Positives = 44/83 (53%), Gaps = 2/83 (2%)
 Frame = +2

Query: 197 KKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI-KPNQESGEQAKVSSKC 373
           +KPGE   K    +EKP +E+ +P     K P    ++ G E  KP +E+ +  + + K 
Sbjct: 637 EKPGEETEKPGEETEKPGEETEKPGEETEK-PGEETEKPGEETEKPGEETEKPGEETGK- 694

Query: 374 PFGYTQEAGGE-NKPKQVSEKPG 439
           P   T++ G E  KP + +EKPG
Sbjct: 695 PGEETEKPGEETEKPGEETEKPG 717



 Score = 38.1 bits (87), Expect = 0.13
 Identities = 26/87 (29%), Positives = 42/87 (48%), Gaps = 1/87 (1%)
 Frame = +2

Query: 197 KKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCP 376
           + PGE   K    +EKP +E+ +P     K P    ++ G E +   E  E+    ++ P
Sbjct: 539 ENPGEETEKPSEETEKPGEETEKPGEETEK-PGEETEEPGEETEKPGEETEKPGEETEKP 597

Query: 377 FGYTQEAGGE-NKPKQVSEKPGVMSPK 454
              T++ G E  KP + +EKPG  + K
Sbjct: 598 GEETEKPGEETEKPGEETEKPGEETEK 624



 Score = 37.7 bits (86), Expect = 0.16
 Identities = 27/83 (32%), Positives = 43/83 (51%), Gaps = 2/83 (2%)
 Frame = +2

Query: 197 KKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI-KPNQESGEQAKVSSKC 373
           +KPGE   K    +EKP +E+G+P     K P    ++ G E  KP +E+G+  + + K 
Sbjct: 672 EKPGEETEKPGEETEKPGEETGKPGEETEK-PGEETEKPGEETEKPGEETGKPGEETGK- 729

Query: 374 PFGYTQEAGGENKPK-QVSEKPG 439
           P    ++ G E     + +EKPG
Sbjct: 730 PGEEIEKPGEETGTSGEETEKPG 752



 Score = 37.7 bits (86), Expect = 0.16
 Identities = 27/87 (31%), Positives = 42/87 (48%), Gaps = 1/87 (1%)
 Frame = +2

Query: 197 KKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCP 376
           +KPGE   K    +EKP +E+ +P     K P    ++ G E +   E  E+    ++ P
Sbjct: 630 EKPGEETEKPGEETEKPGEETEKPGEETEK-PGEETEKPGEETEKPGEETEKPGEETEKP 688

Query: 377 FGYTQEAGGE-NKPKQVSEKPGVMSPK 454
              T + G E  KP + +EKPG  + K
Sbjct: 689 GEETGKPGEETEKPGEETEKPGEETEK 715



 Score = 37.4 bits (85), Expect = 0.21
 Identities = 30/96 (31%), Positives = 44/96 (45%), Gaps = 2/96 (2%)
 Frame = +2

Query: 158 PFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI-KPN 334
           P  +  +P +  ++KPGE        +EKP  E+G+P     K         G EI KP 
Sbjct: 758 PGEETGKPGE-EIEKPGEETGTSGEETEKPGGETGKPGEETGK--------PGEEIEKPG 808

Query: 335 QESGEQAKVSSKCPFGYTQEAGGE-NKPKQVSEKPG 439
           +E+G   +         T++ GGE  KP +  EKPG
Sbjct: 809 EETGTSGE--------ETEKPGGETGKPGEEIEKPG 836



 Score = 36.6 bits (83), Expect = 0.37
 Identities = 26/87 (29%), Positives = 42/87 (48%), Gaps = 1/87 (1%)
 Frame = +2

Query: 197 KKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCP 376
           +KPGE   K    +EKP +E+ +P     K P    ++ G E +   E  E+    ++ P
Sbjct: 616 EKPGEETEKPGEETEKPGEETEKPGEETEK-PGEETEKPGEETEKPGEETEKPGEETEKP 674

Query: 377 FGYTQEAGGE-NKPKQVSEKPGVMSPK 454
              T++ G E  KP + + KPG  + K
Sbjct: 675 GEETEKPGEETEKPGEETGKPGEETEK 701



 Score = 36.2 bits (82), Expect = 0.48
 Identities = 27/83 (32%), Positives = 43/83 (51%), Gaps = 2/83 (2%)
 Frame = +2

Query: 197 KKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI-KPNQESGEQAKVSSKC 373
           +KPGE   K    +EKP +E+ +P     K P    ++ G E  KP +E+ +  + + K 
Sbjct: 651 EKPGEETEKPGEETEKPGEETEKPGEETEK-PGEETEKPGEETGKPGEETEKPGEETEK- 708

Query: 374 PFGYTQEAGGE-NKPKQVSEKPG 439
           P   T++ G E  KP + + KPG
Sbjct: 709 PGEETEKPGEETGKPGEETGKPG 731



 Score = 36.2 bits (82), Expect = 0.48
 Identities = 25/87 (28%), Positives = 41/87 (47%), Gaps = 1/87 (1%)
 Frame = +2

Query: 197 KKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCP 376
           + PGE        +EKP +E+ +P     K P    ++ G E +   E  E+    ++ P
Sbjct: 532 ENPGEETENPGEETEKPSEETEKPGEETEK-PGEETEKPGEETEEPGEETEKPGEETEKP 590

Query: 377 FGYTQEAGGE-NKPKQVSEKPGVMSPK 454
              T++ G E  KP + +EKPG  + K
Sbjct: 591 GEETEKPGEETEKPGEETEKPGEETEK 617



 Score = 34.7 bits (78), Expect = 1.4
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 1/82 (1%)
 Frame = +2

Query: 197 KKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCP 376
           +KPGE   K    +EKP +E+ +P     K P     + G E +   E  E+    ++ P
Sbjct: 658 EKPGEETEKPGEETEKPGEETEKPGEETEK-PGEETGKPGEETEKPGEETEKPGEETEKP 716

Query: 377 FGYTQEAGGE-NKPKQVSEKPG 439
              T + G E  KP +  EKPG
Sbjct: 717 GEETGKPGEETGKPGEEIEKPG 738



>gb:AE017027_381112 Bacillus anthracis str. Ames section 4 of 18 of
            the complete genome.>gb:AE017225_406231 Bacillus
            anthracis str. Sterne, complete
            genome.>gb:AE017334_450961 Bacillus anthracis str. 'Ames
            Ancestor', complete genome.>gb:AE016879_1010817 Bacillus
            anthracis str. Ames complete genome.
          Length = 969

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 30/98 (30%), Positives = 49/98 (50%), Gaps = 1/98 (1%)
 Frame = +2

Query: 149  PVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIK 328
            P  P  +  +P + + +KPGE   K    +EKP +E+ +P     K P    ++ G E +
Sbjct: 815  PENPGEETEKPGEET-EKPGEETEKPGEETEKPGEETEKPGEETEK-PGEETEKPGEETE 872

Query: 329  PNQESGEQAKVSSKCPFGYTQEAGGE-NKPKQVSEKPG 439
               E  E+    ++ P   T++ GGE  KP + +EKPG
Sbjct: 873  KPGEETEKPGEETEKPGEETEKPGGETEKPGKETEKPG 910



>gb:AY454396_2533412 Hippoglossus hippoglossus recombination
           activation gene 1 gene, partial cds.
          Length = 1033

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 5/68 (7%)
 Frame = +2

Query: 419 QVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFK-- 592
           Q+S K  ++S K P+ F      L   +CM+C  LL+D  +  PC H+FC+ CI ++   
Sbjct: 259 QLSTK--LISEKLPVDF------LYSFTCMVCDHLLFDPVQS-PCGHLFCRSCIAKYNHA 309

Query: 593 ---DCPLC 607
               CP C
Sbjct: 310 LGPQCPAC 317



>gb:EHU81154_2400802 Equine herpesvirus 1 transcriptional protein
           (ICP0) gene, complete cds.
          Length = 419

 Score = 41.2 bits (95), Expect = 0.015
 Identities = 20/46 (43%), Positives = 24/46 (52%), Gaps = 4/46 (8%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEKI 628
           C IC     + S  +PC H FC VCITR+      CPLC   VE +
Sbjct: 8   CPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCPLCKVPVESV 53



>gb:AB158517_2173656 Equine herpesvirus 1 ORF63 gene for
           transactivator protein, complete cds.
          Length = 532

 Score = 41.2 bits (95), Expect = 0.015
 Identities = 20/46 (43%), Positives = 24/46 (52%), Gaps = 4/46 (8%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEKI 628
           C IC     + S  +PC H FC VCITR+      CPLC   VE +
Sbjct: 8   CPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCPLCKVPVESV 53



>gb:AK005850_1153263 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:1700010O16
           product:hypothetical TRAF-type zinc
           finger/Immunoglobulin and major histocompatibility
           complex domain/RING finger/Cytochrome c family
           heme-binding site containing protein, full insert
           sequence.>gb:AK005854_1153266 Mus musculus adult male
           testis cDNA, RIKEN full-length enriched library,
           clone:1700011A04 product:hypothetical TRAF-type zinc
           finger/Immunoglobulin and major histocompatibility
           complex domain/RING finger/Cytochrome c family
           heme-binding site containing protein, full insert
           sequence.>gb:BC049562_2100048 Mus musculus ring finger
           protein 151, mRNA (cDNA clone MGC:58153 IMAGE:6774166),
           complete cds.
          Length = 239

 Score = 41.2 bits (95), Expect = 0.015
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 7/61 (11%)
 Frame = +2

Query: 464 GFDSQTFKLGP---LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVE 622
           G+D   F   P     C +C  +L   +R +PCSH+FCK CI R+      CP C  +V 
Sbjct: 4   GYDLNLFASPPDCKFLCSVCHGVLKRPTR-LPCSHIFCKKCIFRWLARQNTCPCCRKEVT 62

Query: 623 K 625
           +
Sbjct: 63  R 63



>sp|P09309|ICP0_VZVD Trans-acting transcriptional protein
           ICP0.>pir|I27215|WZBE61 gene 61 protein - human
           herpesvirus 3>gb:AF206304_2214544 Human herpesvirus 3
           ORF49, ORF50, ORF51, ORF52, ORF53, ORF54, ORF55, ORF56,
           ORF57, ORF58, ORF59, ORF60, ORF61, ORF62, ORF63, ORF64,
           ORF65, ORF66, ORF67, and ORF68 genes, complete
           cds.>gb:AF314215S5_2232977 Human herpesvirus 3 VZV-32
           ORF60 and ORF61 genes, complete cds.>gb:AY548170_2359813
           Human herpesvirus 3 strain MSP, complete
           genome.>gb:AY548171_2359885 Human herpesvirus 3 strain
           BC, complete genome.>gb:HEVZVXX_2409225 Human
           herpesvirus 3 (strain Dumas) complete genome.
          Length = 467

 Score = 41.2 bits (95), Expect = 0.015
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 4/47 (8%)
 Frame = +2

Query: 500 SCMICQALLYDCSRCVPCSHVFCKVCITRFK----DCPLCGADVEKI 628
           +C IC + + D  + +PC H FC VCI  +      CPLC   V+ I
Sbjct: 18  TCTICMSTVSDLGKTMPCLHDFCFVCIRAWTSTSVQCPLCRCPVQSI 64



>sp|P28990|ICP0_EHV1B Trans-acting transcriptional protein
           ICP0.>pir|I36801|WZBEF5 59K transcription activator -
           equine herpesvirus 1 (strain Ab4p)>gb:AY464052_2348222
           Equine herpesvirus 1 strain V592, complete
           genome.>gb:AY665713_2373378 Equine herpesvirus 1 strain
           Ab4, complete genome.
          Length = 532

 Score = 41.2 bits (95), Expect = 0.015
 Identities = 20/46 (43%), Positives = 24/46 (52%), Gaps = 4/46 (8%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEKI 628
           C IC     + S  +PC H FC VCITR+      CPLC   VE +
Sbjct: 8   CPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCPLCKVPVESV 53



>gb:BC051845_1984700 Homo sapiens polycomb group ring finger 5, mRNA
           (cDNA clone MGC:60159 IMAGE:5199133), complete
           cds.>gb:HSM803804_2017724 Homo sapiens mRNA; cDNA
           DKFZp686I1251 (from clone DKFZp686I1251); complete cds.
          Length = 256

 Score = 40.0 bits (92), Expect = 0.033
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           ++C IC+  L   +    C H FCK CI +      DCP CG  V +
Sbjct: 16  ITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQVHE 62



>gb:AE016818_1748261 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 665

 Score = 40.0 bits (92), Expect = 0.033
 Identities = 25/84 (29%), Positives = 33/84 (39%), Gaps = 23/84 (27%)
 Frame = +2

Query: 443 MSPKCPLGFDSQTFKLGPL--SCMICQALLYDCSRCVPCSHVFCKVCITRF--------- 589
           + P  PL  DS    + P   +C IC A      R  PC H+ C  C+ +F         
Sbjct: 207 VDPNVPLPADSIRRVVAPRGQACPICLAEEVVAPRMAPCGHILCMTCMLQFFAAETGREV 266

Query: 590 ------------KDCPLCGADVEK 625
                       K+CPLCG+ V K
Sbjct: 267 ARAPGAYVRRPPKECPLCGSIVRK 290



>gb:SCCYP1_1707467 Yeast CYP1 gene.
          Length = 1483

 Score = 40.0 bits (92), Expect = 0.033
 Identities = 31/122 (25%), Positives = 46/122 (37%), Gaps = 3/122 (2%)
 Frame = +2

Query: 155 CPFVKAARPDDASV---KKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI 325
           CP   A  P  A+    +K     S    G   PK+E+     +P KCP  H   +   I
Sbjct: 281 CPINHAQAPPSAAAAATRKCPVDHSAFSSGMVAPKEETP----LPRKCPVDHTMFSSGMI 336

Query: 326 KPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSC 505
            P +++  Q     +CP  +T  + G   PK   E P   S K  +  +  T       C
Sbjct: 337 PPREDTSSQ----KRCPVDHTMYSAGMMPPK--DETPSPFSTKAMIDHNKHTMNPPQSKC 390

Query: 506 MI 511
            +
Sbjct: 391 PV 392



>gb:AX405728_1467656 Sequence 143 from Patent
           WO0222660.>gb:AX405800_1467728 Sequence 215 from Patent
           WO0222660.
          Length = 193

 Score = 40.0 bits (92), Expect = 0.033
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           ++C IC+  L   +    C H FCK CI +      DCP CG  V +
Sbjct: 16  ITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQVHE 62



>gb:AK017984_1159402 Mus musculus adult male thymus cDNA, RIKEN
           full-length enriched library, clone:5830443C21
           product:hypothetical RING finger containing protein,
           full insert sequence.
          Length = 236

 Score = 40.0 bits (92), Expect = 0.033
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           ++C IC+  L   +    C H FCK CI +      DCP CG  V +
Sbjct: 16  ITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQVHE 62



>gb:AK002387_1151165 Mus musculus adult male kidney cDNA, RIKEN
           full-length enriched library, clone:0610009F02
           product:hypothetical RING finger containing protein,
           full insert sequence.
          Length = 233

 Score = 40.0 bits (92), Expect = 0.033
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           ++C IC+  L   +    C H FCK CI +      DCP CG  V +
Sbjct: 16  ITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSNDCPRCGNQVHE 62



>sp|P12351|CYP1_YEAST CYP1 activatory protein.>pir|S59400|RGBYH1
           CYC1/CYP3 transcription activator - yeast (Saccharomyces
           cerevisiae)>gb:YSCL9672_1729772 Saccharomyces cerevisiae
           chromosome XII cosmid 9672.
          Length = 1502

 Score = 40.0 bits (92), Expect = 0.033
 Identities = 31/122 (25%), Positives = 46/122 (37%), Gaps = 3/122 (2%)
 Frame = +2

Query: 155 CPFVKAARPDDASV---KKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI 325
           CP   A  P  A+    +K     S    G   PK+E+     +P KCP  H   +   I
Sbjct: 281 CPINHAQAPPSAAAAATRKCPVDHSAFSSGMVAPKEETP----LPRKCPVDHTMFSSGMI 336

Query: 326 KPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSC 505
            P +++  Q     +CP  +T  + G   PK   E P   S K  +  +  T       C
Sbjct: 337 PPREDTSSQ----KRCPVDHTMYSAGMMPPK--DETPSPFSTKAMIDHNKHTMNPPQSKC 390

Query: 506 MI 511
            +
Sbjct: 391 PV 392



>gb:PPI297298_1701334 Pinus pinaster partial mRNA for putative RING
           zinc finger protein.
          Length = 80

 Score = 39.7 bits (91), Expect = 0.043
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%)
 Frame = +2

Query: 494 PLSCMICQALLYDCSRCVPCSHVFCKV-CITRFKDCPLCGADVEKI 628
           P  C+IC    Y+    VPC H+ C   C +R  +CPLC  D+E++
Sbjct: 30  PALCIICLEQEYNVV-FVPCGHMCCCTSCSSRLSECPLCRGDIEQV 74



>gb:AE016818_1748533 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 316

 Score = 39.3 bits (90), Expect = 0.056
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 4/39 (10%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLC 607
           C++C A + D S C+PC H+FC  C+ ++     +CPLC
Sbjct: 266 CILCLADMTDPS-CLPCGHMFCWACVMQWCNERNECPLC 303



>gb:AC145780_1744493 Oryza sativa chromosome 3 BAC OSJNBb0069P02
           genomic sequence, complete sequence.
          Length = 537

 Score = 39.3 bits (90), Expect = 0.056
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 11/58 (18%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCI------TRFKDCPLCGAD-----VEKIEAD 637
           ++C +C  LL D +    C H FC+ CI         + CP+C  D     VEK+ AD
Sbjct: 108 MTCPLCGRLLRDATTVSECLHTFCRKCIYEKLNDEEVESCPVCKIDLGCTPVEKLRAD 165



>gb:CR380959_1654025 Candida glabrata strain CBS138 chromosome M
           complete sequence.
          Length = 328

 Score = 39.3 bits (90), Expect = 0.056
 Identities = 18/40 (45%), Positives = 25/40 (62%), Gaps = 4/40 (10%)
 Frame = +2

Query: 500 SCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLC 607
           +C++C   + D S C+PC HVFC  CIT +     +CPLC
Sbjct: 276 NCILCLMEMTDPS-CLPCGHVFCWDCITDWTKENPECPLC 314



>gb:AY249876_1427999 Tupaia tana recombination activating protein 1
           (RAG1) gene, partial cds.
          Length = 187

 Score = 39.3 bits (90), Expect = 0.056
 Identities = 30/106 (28%), Positives = 43/106 (40%), Gaps = 6/106 (5%)
 Frame = +2

Query: 308 QAGSEIKPNQESGEQAKVSSKCPFGYTQ-EAGGENKPKQVSEKPGVMSPKCPLGFDSQTF 484
           Q   ++KP +    QA+       G  Q   G  N  K+++    +      L  D    
Sbjct: 47  QLSKKLKPARGRARQAQRHK----GRAQARVGSNNAMKKIANCGQMHLSAALLAVDFPAH 102

Query: 485 KLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
            +  +SC IC+ +L D      C HVFC+VCI R        CP C
Sbjct: 103 FVKAVSCQICEHILADPVETA-CKHVFCRVCILRCLRVVGSHCPAC 147



>gb:AE017000_375830 Bacillus cereus ATCC 14579 section 3 of 18 of the
            complete genome.>gb:AE016877_1016080 Bacillus cereus ATCC
            14579 complete genome.
          Length = 1324

 Score = 39.3 bits (90), Expect = 0.056
 Identities = 30/106 (28%), Positives = 46/106 (43%), Gaps = 2/106 (1%)
 Frame = +2

Query: 149  PVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIK 328
            P  P     +PD+ +  KPGE   K   G+EKP + +G+P     K      +      K
Sbjct: 1177 PEKPGEGTEKPDEGT-GKPGEGTGKPGEGTEKPDEGTGKPGEGTGKPGEGTGKPGEGTGK 1235

Query: 329  PNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKP--GVMSPKCP 460
            P + +G+  + + K   G  +   G  KP + + KP  GV  P  P
Sbjct: 1236 PGEGTGKPGEGTEKPGEGTEKPGEGVEKPGEGTGKPGEGVEKPNLP 1281



 Score = 38.5 bits (88), Expect = 0.096
 Identities = 24/85 (28%), Positives = 38/85 (44%)
 Frame = +2

Query: 185  DASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQESGEQAKVS 364
            D   +KPGE   K   G+ KP + +G+P     K      +      KP + +G+  + +
Sbjct: 1174 DKDPEKPGEGTEKPDEGTGKPGEGTGKPGEGTEKPDEGTGKPGEGTGKPGEGTGKPGEGT 1233

Query: 365  SKCPFGYTQEAGGENKPKQVSEKPG 439
             K   G  +   G  KP + +EKPG
Sbjct: 1234 GKPGEGTGKPGEGTEKPGEGTEKPG 1258



>pir|T42606|T42606 probable transcription activator - equine
           herpesvirus 4  (strain NS80567)>gb:AF030027_2182212
           Equine herpesvirus 4 strain NS80567, complete genome.
          Length = 536

 Score = 39.3 bits (90), Expect = 0.056
 Identities = 19/46 (41%), Positives = 23/46 (50%), Gaps = 4/46 (8%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEKI 628
           C IC     + S  +PC H FC VCITR+      CPLC   V  +
Sbjct: 9   CPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCPLCKVPVNSV 54



>gb:HSDJ568F9_2012245 Human DNA sequence from clone RP4-568F9 on
           chromosome 20 Contains the ZNF133 gene for zinc finger
           protein 133, three novel genes, the 3' end of the
           C20orf12 gene for chromosome 20 open reading frame 12
           and two CpG islands, complete sequence.
          Length = 653

 Score = 38.9 bits (89), Expect = 0.074
 Identities = 29/96 (30%), Positives = 44/96 (45%), Gaps = 1/96 (1%)
 Frame = +2

Query: 197 KKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCP 376
           K  G   S+Q       +  SGE  MV  +C     Q++         SGE+  V  +C 
Sbjct: 468 KDCGRGFSQQSNLIRHQRTHSGEKPMVCGECGRGFSQKSNLVAHQRTHSGERPYVCRECG 527

Query: 377 FGYTQEAG-GENKPKQVSEKPGVMSPKCPLGFDSQT 481
            G++ +AG   +K K   EKP  M  +C LGF +++
Sbjct: 528 RGFSHQAGLIRHKRKHSREKP-YMCRQCGLGFGNKS 562



 Score = 34.3 bits (77), Expect = 1.8
 Identities = 30/128 (23%), Positives = 49/128 (38%), Gaps = 20/128 (15%)
 Frame = +2

Query: 158 PFVKAARPDDASVKKPGESQSKQHGGSEKP--------------------KQESGEPAMV 277
           P+V        S+KK      K H G EKP                    +  SGE   +
Sbjct: 240 PYVCGVCEKGFSLKKSLARHQKAHSG-EKPIVCRECGRGFNRKSTLIIHERTHSGEKPYM 298

Query: 278 PSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKC 457
            S+C     Q++   I     SGE+  V  +C  G++Q++      +   E+  ++   C
Sbjct: 299 CSECGRGFSQKSNLIIHQRTHSGEKPYVCRECGKGFSQKSAVVRHQRTHLEEKTIVCSDC 358

Query: 458 PLGFDSQT 481
            LGF  ++
Sbjct: 359 GLGFSDRS 366



>gb:HSDJ568F9_2012244 Human DNA sequence from clone RP4-568F9 on
           chromosome 20 Contains the ZNF133 gene for zinc finger
           protein 133, three novel genes, the 3' end of the
           C20orf12 gene for chromosome 20 open reading frame 12
           and two CpG islands, complete sequence.
          Length = 654

 Score = 38.9 bits (89), Expect = 0.074
 Identities = 29/96 (30%), Positives = 44/96 (45%), Gaps = 1/96 (1%)
 Frame = +2

Query: 197 KKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCP 376
           K  G   S+Q       +  SGE  MV  +C     Q++         SGE+  V  +C 
Sbjct: 469 KDCGRGFSQQSNLIRHQRTHSGEKPMVCGECGRGFSQKSNLVAHQRTHSGERPYVCRECG 528

Query: 377 FGYTQEAG-GENKPKQVSEKPGVMSPKCPLGFDSQT 481
            G++ +AG   +K K   EKP  M  +C LGF +++
Sbjct: 529 RGFSHQAGLIRHKRKHSREKP-YMCRQCGLGFGNKS 563



 Score = 34.3 bits (77), Expect = 1.8
 Identities = 30/128 (23%), Positives = 49/128 (38%), Gaps = 20/128 (15%)
 Frame = +2

Query: 158 PFVKAARPDDASVKKPGESQSKQHGGSEKP--------------------KQESGEPAMV 277
           P+V        S+KK      K H G EKP                    +  SGE   +
Sbjct: 241 PYVCGVCEKGFSLKKSLARHQKAHSG-EKPIVCRECGRGFNRKSTLIIHERTHSGEKPYM 299

Query: 278 PSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKC 457
            S+C     Q++   I     SGE+  V  +C  G++Q++      +   E+  ++   C
Sbjct: 300 CSECGRGFSQKSNLIIHQRTHSGEKPYVCRECGKGFSQKSAVVRHQRTHLEEKTIVCSDC 359

Query: 458 PLGFDSQT 481
            LGF  ++
Sbjct: 360 GLGFSDRS 367



>gb:BC001887_1967933 Homo sapiens zinc finger protein 133 (clone
           pHZ-13), mRNA (cDNA clone MGC:1579 IMAGE:3535533),
           complete cds.>gb:BT007310_1990748 Homo sapiens zinc
           finger protein 133 (clone pHZ-13) mRNA, complete cds.
          Length = 653

 Score = 38.9 bits (89), Expect = 0.074
 Identities = 29/96 (30%), Positives = 44/96 (45%), Gaps = 1/96 (1%)
 Frame = +2

Query: 197 KKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCP 376
           K  G   S+Q       +  SGE  MV  +C     Q++         SGE+  V  +C 
Sbjct: 468 KDCGRGFSQQSNLIRHQRTHSGEKPMVCGECGRGFSQKSNLVAHQRTHSGERPYVCRECG 527

Query: 377 FGYTQEAG-GENKPKQVSEKPGVMSPKCPLGFDSQT 481
            G++ +AG   +K K   EKP  M  +C LGF +++
Sbjct: 528 RGFSHQAGLIRHKRKHSREKP-YMCRQCGLGFGNKS 562



 Score = 34.3 bits (77), Expect = 1.8
 Identities = 30/128 (23%), Positives = 49/128 (38%), Gaps = 20/128 (15%)
 Frame = +2

Query: 158 PFVKAARPDDASVKKPGESQSKQHGGSEKP--------------------KQESGEPAMV 277
           P+V        S+KK      K H G EKP                    +  SGE   +
Sbjct: 240 PYVCGVCEKGFSLKKSLARHQKAHSG-EKPIVCRECGRGFNRKSTLIIHERTHSGEKPYM 298

Query: 278 PSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKC 457
            S+C     Q++   I     SGE+  V  +C  G++Q++      +   E+  ++   C
Sbjct: 299 CSECGRGFSQKSNLIIHQRTHSGEKPYVCRECGKGFSQKSAVVRHQRTHLEEKTIVCSDC 358

Query: 458 PLGFDSQT 481
            LGF  ++
Sbjct: 359 GLGFSDRS 366



>gb:AC096855_1736362 Oryza sativa chromosome 3 BAC OJ1365_D05
           genomic sequence, complete sequence.
          Length = 439

 Score = 38.9 bits (89), Expect = 0.074
 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 11/58 (18%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRFKD------CPLCGADV-----EKIEAD 637
           ++C +C+ LL + +    C H FCK CI    D      CP+C  D+     EK+  D
Sbjct: 20  MTCPLCKGLLREATAITECLHTFCKECIMEKIDDEEVDHCPVCNIDLGCDPEEKLRPD 77



>gb:YSCHAP1_1729295 Yeast (S.cerevisiae) activator protein HAP1
           gene, complete cds.
          Length = 1483

 Score = 38.9 bits (89), Expect = 0.074
 Identities = 30/122 (24%), Positives = 46/122 (37%), Gaps = 3/122 (2%)
 Frame = +2

Query: 155 CPFVKAARPDDASV---KKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEI 325
           CP   A  P  A+    +K     S    G   PK+E+     +P +CP  H   +   I
Sbjct: 281 CPINHAQAPPSAAAAATRKCPVDHSAFSSGMVAPKEETP----LPRRCPVDHTMFSSGMI 336

Query: 326 KPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSC 505
            P +++  Q     +CP  +T  + G   PK   E P   S K  +  +  T       C
Sbjct: 337 PPREDTSSQ----KRCPVDHTMYSAGMMPPK--DETPSPFSTKAMIDHNKHTMNPPQSKC 390

Query: 506 MI 511
            +
Sbjct: 391 PV 392



>gb:AY160104_1305302 Dictyostelium discoideum nucleotide exchange
           factor RasGEF O (gefO) gene, complete cds.
          Length = 944

 Score = 38.9 bits (89), Expect = 0.074
 Identities = 18/43 (41%), Positives = 23/43 (53%), Gaps = 3/43 (6%)
 Frame = +2

Query: 488 LGPLSCMICQALLYDCSRCVPCSHVFCKVCIT---RFKDCPLC 607
           L  L+C ICQ L  D +  +PC H FC  C+T     K+C  C
Sbjct: 11  LQSLTCGICQNLFKDPNTLIPCGHAFCLDCLTTNASIKNCIQC 53



>gb:CR858677_1182834 Pongo pygmaeus mRNA; cDNA DKFZp468M0413 (from
           clone DKFZp468M0413).
          Length = 590

 Score = 38.9 bits (89), Expect = 0.074
 Identities = 29/96 (30%), Positives = 44/96 (45%), Gaps = 1/96 (1%)
 Frame = +2

Query: 197 KKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCP 376
           K  G   S+Q       +  SGE  MV  +C     Q++         SGE+  V  +C 
Sbjct: 405 KDCGRGFSQQSNLIRHQRTHSGEKPMVCGECGRGFSQKSNLVAHQRTHSGERPYVCRECG 464

Query: 377 FGYTQEAG-GENKPKQVSEKPGVMSPKCPLGFDSQT 481
            G++ +AG   +K K   EKP  M  +C LGF +++
Sbjct: 465 RGFSHQAGLIRHKRKHSREKP-YMCRQCGLGFGNKS 499



 Score = 33.9 bits (76), Expect = 2.4
 Identities = 30/128 (23%), Positives = 49/128 (38%), Gaps = 20/128 (15%)
 Frame = +2

Query: 158 PFVKAARPDDASVKKPGESQSKQHGGSEKP--------------------KQESGEPAMV 277
           P+V        S+KK      K H G EKP                    +  SGE   +
Sbjct: 177 PYVCGVCEKGFSLKKSLARHQKAHSG-EKPIVCRECGRGFNRKSTLIIHERTHSGEKPYM 235

Query: 278 PSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKC 457
            S+C     Q++   I     SGE+  V  +C  G++Q++      +   E+  ++   C
Sbjct: 236 CSECGRGFSQKSNLIIHQRTHSGEKPYVCRECGKGFSQKSAVVRHQRTHLEERTIVCSDC 295

Query: 458 PLGFDSQT 481
            LGF  ++
Sbjct: 296 GLGFSDRS 303



>sp|P52736|Z133_HUMAN Zinc finger protein 133.>pir|A57785|A57785
           finger protein ZNF133 - human>gb:HSU09366_2021970 Human
           zinc finger protein ZNF133.
          Length = 654

 Score = 38.9 bits (89), Expect = 0.074
 Identities = 29/96 (30%), Positives = 44/96 (45%), Gaps = 1/96 (1%)
 Frame = +2

Query: 197 KKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCP 376
           K  G   S+Q       +  SGE  MV  +C     Q++         SGE+  V  +C 
Sbjct: 469 KDCGRGFSQQSNLIRHQRTHSGEKPMVCGECGRGFSQKSNLVAHQRTHSGERPYVCRECG 528

Query: 377 FGYTQEAG-GENKPKQVSEKPGVMSPKCPLGFDSQT 481
            G++ +AG   +K K   EKP  M  +C LGF +++
Sbjct: 529 RGFSHQAGLIRHKRKHSREKP-YMCRQCGLGFGNKS 563



 Score = 34.3 bits (77), Expect = 1.8
 Identities = 30/128 (23%), Positives = 49/128 (38%), Gaps = 20/128 (15%)
 Frame = +2

Query: 158 PFVKAARPDDASVKKPGESQSKQHGGSEKP--------------------KQESGEPAMV 277
           P+V        S+KK      K H G EKP                    +  SGE   +
Sbjct: 241 PYVCGVCEKGFSLKKSLARHQKAHSG-EKPIVCRECGRGFNRKSTLIIHERTHSGEKPYM 299

Query: 278 PSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKC 457
            S+C     Q++   I     SGE+  V  +C  G++Q++      +   E+  ++   C
Sbjct: 300 CSECGRGFSQKSNLIIHQRTHSGEKPYVCRECGKGFSQKSAVVRHQRTHLEEKTIVCSDC 359

Query: 458 PLGFDSQT 481
            LGF  ++
Sbjct: 360 GLGFSDRS 367



>gb:BC065679_2554124 Danio rerio myosin regulatory light chain
           interacting protein, mRNA (cDNA clone MGC:77168
           IMAGE:6961511), complete cds.
          Length = 472

 Score = 38.5 bits (88), Expect = 0.096
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 1/46 (2%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSH-VFCKVCITRFKDCPLCGADVEKIE 631
           L CM+C     D + C PC H V C+ C  + + CP+C ++VE ++
Sbjct: 382 LLCMLCCEEEIDAAFC-PCGHMVCCQNCAAQLQSCPVCRSEVEHVQ 426



>gb:BC054692_2551089 Danio rerio zgc:66368, mRNA (cDNA clone
           MGC:66368 IMAGE:5611909), complete cds.
          Length = 458

 Score = 38.5 bits (88), Expect = 0.096
 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 7/43 (16%)
 Frame = +2

Query: 500 SCMICQALLYDCSRCVPCSHVFCKVCITRF-------KDCPLC 607
           +C +C  + Y   +C PC+HVFC+ C+            CPLC
Sbjct: 299 TCAVCLDVYYSPYKCHPCNHVFCEPCLRTLAKNRPSNTPCPLC 341



>gb:AY434450_2532412 Danio rerio myosin regulatory light
           chain-interacting protein mRNA, complete cds.
          Length = 472

 Score = 38.5 bits (88), Expect = 0.096
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 1/46 (2%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSH-VFCKVCITRFKDCPLCGADVEKIE 631
           L CM+C     D + C PC H V C+ C  + + CP+C ++VE ++
Sbjct: 382 LLCMLCCEEEIDAAFC-PCGHMVCCQNCAAQLQSCPVCRSEVEHVQ 426



>gb:AY423020_2532106 Danio rerio myosin regulatory light chain
           interacting protein (MIR) mRNA, complete cds.
          Length = 472

 Score = 38.5 bits (88), Expect = 0.096
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 1/46 (2%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSH-VFCKVCITRFKDCPLCGADVEKIE 631
           L CM+C     D + C PC H V C+ C  + + CP+C ++VE ++
Sbjct: 382 LLCMLCCEEEIDAAFC-PCGHMVCCQNCAAQLQSCPVCRSEVEHVQ 426



>gb:AL831789_2504570 Zebrafish DNA sequence from clone CH211-207O21
           in linkage group 14 Contains the zebrafish fgf24 gene
           for fibroblast growth factor 24, a novel gene for a RING
           finger protein, the lbx1h gene for lady bird-like
           homeobox 1 homolog, (Drosophila) and eight CpG islands,
           complete sequence.
          Length = 261

 Score = 38.5 bits (88), Expect = 0.096
 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 4/47 (8%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEKIE 631
           C +C     D +    C H FCK CI ++    K CP+C   + + +
Sbjct: 45  CYLCAGYFIDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQ 91



>gb:BC046775_2099357 Mus musculus RIKEN cDNA 3110001E11 gene, mRNA
           (cDNA clone MGC:61324 IMAGE:5708557), complete
           cds.>gb:BC075700_2106716 Mus musculus RIKEN cDNA
           3110001E11 gene, mRNA (cDNA clone MGC:62463
           IMAGE:5708557), complete cds.
          Length = 591

 Score = 38.5 bits (88), Expect = 0.096
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 7/49 (14%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCI-TRFKD------CPLCGADVEKI 628
           C +C  + ++   C PC H+FC+ C+ T  KD      CPLC   + ++
Sbjct: 431 CAVCLDVYFNPYMCYPCHHIFCEPCLRTLAKDNPASTPCPLCRTIISRV 479



>gb:BC028560_2096261 Mus musculus nervous system polycomb 1, mRNA
           (cDNA clone MGC:41745 IMAGE:1380201), complete cds.
          Length = 247

 Score = 38.5 bits (88), Expect = 0.096
 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 4/47 (8%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEKIE 631
           C +C     D +    C H FCK CI ++    K CP+C   + + +
Sbjct: 35  CCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQ 81



>gb:AY662670_2087498 Rattus norvegicus Nspc1-like protein (Nspc1)
           mRNA, complete cds.
          Length = 243

 Score = 38.5 bits (88), Expect = 0.096
 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 4/47 (8%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEKIE 631
           C +C     D +    C H FCK CI ++    K CP+C   + + +
Sbjct: 35  CCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQ 81



>gb:AJ421479_2068272 Mus musculus X-inactivation center region;
           segment 2/3.
          Length = 194

 Score = 38.5 bits (88), Expect = 0.096
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 4/47 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLCGADVEK 625
           +SC IC+  L D +    C H FCK CI +  +    CP C   V +
Sbjct: 83  ISCFICKGYLIDAATITECLHSFCKSCIVKHFEHSNRCPKCNLIVHQ 129



>gb:HSM803889_2017732 Homo sapiens mRNA; cDNA DKFZp451F1716 (from
           clone DKFZp451F1716).
          Length = 615

 Score = 38.5 bits (88), Expect = 0.096
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 7/49 (14%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCI-TRFKD------CPLCGADVEKI 628
           C +C  + ++   C PC H+FC+ C+ T  KD      CPLC   + ++
Sbjct: 455 CAVCLDVYFNPYMCYPCHHIFCEPCLGTLAKDNPSSTPCPLCRTIISRV 503



>gb:BC004952_1969471 Homo sapiens polycomb group ring finger 1, mRNA
           (cDNA clone MGC:10882 IMAGE:3621400), complete cds.
          Length = 247

 Score = 38.5 bits (88), Expect = 0.096
 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 4/47 (8%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEKIE 631
           C +C     D +    C H FCK CI ++    K CP+C   + + +
Sbjct: 35  CCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQ 81



>gb:AF087884_1881898 Homo sapiens RNF3A-2 mRNA, complete cds.
          Length = 238

 Score = 38.5 bits (88), Expect = 0.096
 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 4/47 (8%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEKIE 631
           C +C     D +    C H FCK CI ++    K CP+C   + + +
Sbjct: 26  CCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQ 72



>gb:AX886036_1481489 Sequence 1899 from Patent EP1033401.
          Length = 121

 Score = 38.5 bits (88), Expect = 0.096
 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 4/47 (8%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEKIE 631
           C +C     D +    C H FCK CI ++    K CP+C   + + +
Sbjct: 47  CCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQ 93



>gb:AY239187_1427661 Phoca vitulina recombination activating protein
           1 (RAG-1) gene, partial cds.
          Length = 298

 Score = 38.5 bits (88), Expect = 0.096
 Identities = 32/123 (26%), Positives = 53/123 (43%), Gaps = 16/123 (13%)
 Frame = +2

Query: 287 CPFVHKQQAGSEIKPNQESGEQAKV------SSKCPFGYTQEAGGENKPKQVSEKPGV-- 442
           C   H  + G + K +Q +G+ +K        ++    + + A  +   K+V +K     
Sbjct: 53  CDICHTARQGLKRKSHQPNGQLSKKLKTVVDRARRARRHKRRAQAKISSKEVMQKISNCS 112

Query: 443 ---MSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDC 598
              +S K  L  D     +  +SC IC+ +L D      C HVFC++CI R       +C
Sbjct: 113 NIHLSTKL-LAVDFPAHFVKSISCQICKHILADPVETT-CKHVFCRICILRCLKVMGSNC 170

Query: 599 PLC 607
           P C
Sbjct: 171 PCC 173



>gb:AY239182_1427656 Sus scrofa recombination activating protein 1
           (RAG-1) gene, partial cds.
          Length = 268

 Score = 38.5 bits (88), Expect = 0.096
 Identities = 22/60 (36%), Positives = 29/60 (48%), Gaps = 5/60 (8%)
 Frame = +2

Query: 443 MSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           +SPK  L  D     +  +SC IC+ +L D      C HVFC++CI R        CP C
Sbjct: 100 LSPKL-LAVDFPAHFVKSISCQICEHILADPVE-TSCKHVFCRICILRCLKVMGSSCPSC 157



>gb:AB091392_1409521 Sus scrofa RAG-1 gene for recombination
           activating protein 1, complete cds.
          Length = 1043

 Score = 38.5 bits (88), Expect = 0.096
 Identities = 22/60 (36%), Positives = 29/60 (48%), Gaps = 5/60 (8%)
 Frame = +2

Query: 443 MSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           +SPK  L  D     +  +SC IC+ +L D      C HVFC++CI R        CP C
Sbjct: 274 LSPKL-LAVDFPAHFVKSISCQICEHILADPVE-TSCKHVFCRICILRCLKVMGSSCPSC 331



>gb:CR859012_1183152 Pongo pygmaeus mRNA; cDNA DKFZp469J021 (from
           clone DKFZp469J021).
          Length = 592

 Score = 38.5 bits (88), Expect = 0.096
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 7/49 (14%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCI-TRFKD------CPLCGADVEKI 628
           C +C  + ++   C PC H+FC+ C+ T  KD      CPLC   + ++
Sbjct: 432 CAVCLDVYFNPYMCYPCRHIFCEPCLRTLAKDNPSSTPCPLCRTIISRV 480



>gb:AK013941_1157709 Mus musculus 13 days embryo head cDNA, RIKEN
           full-length enriched library, clone:3110001E11
           product:hypothetical protein, full insert sequence.
          Length = 502

 Score = 38.5 bits (88), Expect = 0.096
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 7/49 (14%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCI-TRFKD------CPLCGADVEKI 628
           C +C  + ++   C PC H+FC+ C+ T  KD      CPLC   + ++
Sbjct: 431 CAVCLDVYFNPYMCYPCHHIFCEPCLRTLAKDNPASTPCPLCRTIISRV 479



>gb:AY294954_2081733 Phodopus sungorus recombination activating gene
           1 (RAG1) gene, partial cds.
          Length = 997

 Score = 38.1 bits (87), Expect = 0.13
 Identities = 28/99 (28%), Positives = 40/99 (40%), Gaps = 5/99 (5%)
 Frame = +2

Query: 326 KPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSC 505
           +  Q    QA+VSSK               K++S    +      L  D   + +  +SC
Sbjct: 209 RDRQRKRAQARVSSK------------EVMKKISNCSKIHLSTKLLAVDFPAYFVKSISC 256

Query: 506 MICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
            IC+ +L D      C HVFC++CI R        CP C
Sbjct: 257 QICEHILADPVE-TSCKHVFCRICILRCLKVMGSYCPCC 294



>gb:AK127467_1916760 Homo sapiens cDNA FLJ45559 fis, clone
           BRTHA3003225.
          Length = 346

 Score = 38.1 bits (87), Expect = 0.13
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 6/46 (13%)
 Frame = +2

Query: 503 CMICQALLYDCS--RCVPCSHVFCKVCITRF----KDCPLCGADVE 622
           C IC ++L D    R +PC H+F ++C+ ++    K CP+C  D+E
Sbjct: 294 CTICLSMLEDGEDVRRLPCMHLFHQLCVDQWLAMSKKCPICRVDIE 339



>gb:CR382123_1655854 Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 427

 Score = 38.1 bits (87), Expect = 0.13
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 4/45 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADV 619
           L C IC+  L   S   PC H FC +CI ++      CPLC +D+
Sbjct: 30  LRCHICKDFL-KASVLTPCGHSFCSICIRKYLQKESKCPLCLSDL 73



>gb:AY045618_1561209 Arabidopsis thaliana At2g30580/T6B20.7 mRNA,
           complete cds.>gb:BT000505_1634783 Arabidopsis thaliana
           putative C3HC4 zinc finger protein (At2g30580/T6B20.7)
           mRNA, complete cds.>gb:U93215_1726547 Arabidopsis
           thaliana chromosome 2 BAC T6B20 genomic sequence,
           complete sequence.
          Length = 420

 Score = 38.1 bits (87), Expect = 0.13
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 11/58 (18%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCI------TRFKDCPLC-----GADVEKIEAD 637
           ++C +C  LL D +    C H FC+ CI         + CP+C     G  +EK+  D
Sbjct: 18  MTCPLCDKLLRDATTISECLHTFCRKCIYEKITEDEIESCPVCDIDLGGTPLEKLRPD 75



>pir|B84710|B84710 probable C3HC4 zinc finger protein [imported] -
           Arabidopsis thaliana
          Length = 416

 Score = 38.1 bits (87), Expect = 0.13
 Identities = 18/58 (31%), Positives = 27/58 (46%), Gaps = 11/58 (18%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCI------TRFKDCPLC-----GADVEKIEAD 637
           ++C +C  LL D +    C H FC+ CI         + CP+C     G  +EK+  D
Sbjct: 14  MTCPLCDKLLRDATTISECLHTFCRKCIYEKITEDEIESCPVCDIDLGGTPLEKLRPD 71



>gb:BC073117_2557022 Xenopus laevis MGC83623 protein, mRNA (cDNA
           clone MGC:83623 IMAGE:5084396), complete cds.
          Length = 445

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/44 (38%), Positives = 26/44 (59%), Gaps = 1/44 (2%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSH-VFCKVCITRFKDCPLCGADVEKIE 631
           CM+C     + + C PC H V C+ C T+ + CP+C A VE ++
Sbjct: 387 CMLCCEEEINSAFC-PCGHMVCCEGCATQLQSCPVCRASVEHVQ 429



>gb:AY423858_2532141 Ictalurus punctatus recombination activating
           gene-1 protein mRNA, partial cds.>gb:AY423859_2532142
           Ictalurus punctatus recombination activating gene-1
           protein gene, partial cds.
          Length = 797

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 5/41 (12%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRFK-----DCPLCG 610
           C +C  LL D  +  PC H+FC+ CI ++       CP CG
Sbjct: 270 CQVCDHLLSDPVQS-PCQHLFCRTCIQKYSRVLGPQCPSCG 309



>gb:AY319982_2526711 Eremopterix australis recombination activating
           protein 1 (RAG1) gene, partial cds.
          Length = 957

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 31/120 (25%), Positives = 49/120 (40%), Gaps = 13/120 (10%)
 Frame = +2

Query: 287 CPFVHKQQAGSEIK---PNQESGEQAKVSSKCPF---GYTQEAGGENKP--KQVSEKPGV 442
           C   H  + G + K   P+ + G++ K + +C     G   +A   NK   K++     +
Sbjct: 177 CXVCHTTRRGVKRKNQPPSVQXGKRVKTTGECARLNRGXKNQAQINNKNLMKEIVNCKDI 236

Query: 443 MSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
                 L  DS    +  +SC IC  +L D      C H+FC+ CI +        CP C
Sbjct: 237 HLSTKLLAIDSPVDFIKSISCQICDHILADPVETT-CRHLFCRTCILKCIRVXGSYCPSC 295



>gb:AF329846_2487919 Gallus gallus ring finger protein (arkadia)
           mRNA, partial cds.
          Length = 879

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 6/46 (13%)
 Frame = +2

Query: 503 CMICQALLYDCS--RCVPCSHVFCKVCITRF----KDCPLCGADVE 622
           C IC ++L +    R +PC H+F +VC+ ++    K CP+C  D+E
Sbjct: 827 CTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDIE 872



>gb:BT007862_2150794 Synthetic construct Homo sapiens STRIN protein
           mRNA, partial cds.
          Length = 246

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 5/48 (10%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVC-ITRFKD----CPLCGADVEKIE 631
           C +CQ +L    R   C HVFC+ C +T  ++    CPLC  +V + E
Sbjct: 18  CPVCQEVLKTPVRTTACQHVFCRKCFLTAMRESGAHCPLCRGNVTRRE 65



>gb:BC083820_2108885 Rattus norvegicus cDNA clone MGC:94892
           IMAGE:7111130, complete cds.
          Length = 351

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/47 (36%), Positives = 21/47 (44%), Gaps = 4/47 (8%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEKIE 631
           C IC+  L D +    C H FCK CI R       CP C   V + +
Sbjct: 135 CSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQ 181



>gb:BC069835_2106126 Mus musculus ring finger 111, mRNA (cDNA clone
            MGC:76599 IMAGE:30094289), complete cds.
          Length = 981

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 6/46 (13%)
 Frame = +2

Query: 503  CMICQALLYDCS--RCVPCSHVFCKVCITRF----KDCPLCGADVE 622
            C IC ++L +    R +PC H+F +VC+ ++    K CP+C  D+E
Sbjct: 929  CTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDIE 974



>gb:BC054842_2101871 Mus musculus ring finger 111, mRNA (cDNA clone
           IMAGE:6485999), partial cds.
          Length = 185

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 6/46 (13%)
 Frame = +2

Query: 503 CMICQALLYDCS--RCVPCSHVFCKVCITRF----KDCPLCGADVE 622
           C IC ++L +    R +PC H+F +VC+ ++    K CP+C  D+E
Sbjct: 133 CTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDIE 178



>gb:AK172991_2069925 Mus musculus mRNA for mKIAA0646 protein.
          Length = 749

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 29/111 (26%), Positives = 45/111 (40%), Gaps = 4/111 (3%)
 Frame = +2

Query: 302 KQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQT 481
           KQQ    ++ +Q   E+   S K  F    +A  +   +   EK  V + K  +      
Sbjct: 370 KQQLVQALQEHQALMEELNCSKK-DFEKIIQAKNKELEQTKEEKDKVQAQKEEVLSHMND 428

Query: 482 FKLGPLSCMICQALLYDCSRCVPCSHVFCKVCIT----RFKDCPLCGADVE 622
                L C+IC     +    + C+H FC  CI     R  +CP+C  D+E
Sbjct: 429 LLENELQCIICSEYFIEAVT-LNCAHSFCSFCINEWMKRKVECPICRKDIE 478



>gb:AF330197_2063382 Mus musculus Arkadia (Arkadia) mRNA, complete
            cds.
          Length = 989

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 6/46 (13%)
 Frame = +2

Query: 503  CMICQALLYDCS--RCVPCSHVFCKVCITRF----KDCPLCGADVE 622
            C IC ++L +    R +PC H+F +VC+ ++    K CP+C  D+E
Sbjct: 937  CTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDIE 982



>gb:AB047007_2046073 Mus musculus mMBLR mRNA, complete
           cds.>gb:BC016195_2092215 Mus musculus ring finger
           protein 134, mRNA (cDNA clone MGC:27578 IMAGE:4488614),
           complete cds.>gb:BC089460_2110827 Mus musculus ring
           finger protein 134, mRNA (cDNA clone MGC:106622
           IMAGE:30632537), complete cds.
          Length = 353

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/47 (36%), Positives = 21/47 (44%), Gaps = 4/47 (8%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEKIE 631
           C IC+  L D +    C H FCK CI R       CP C   V + +
Sbjct: 137 CSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQ 183



>gb:HSM806331_2018289 Homo sapiens mRNA; cDNA DKFZp686H1966 (from
            clone DKFZp686H1966); complete cds.
          Length = 986

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 6/46 (13%)
 Frame = +2

Query: 503  CMICQALLYDCS--RCVPCSHVFCKVCITRF----KDCPLCGADVE 622
            C IC ++L +    R +PC H+F +VC+ ++    K CP+C  D+E
Sbjct: 934  CTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDIE 979



>gb:BC060862_1985760 Homo sapiens ring finger protein 111, mRNA (cDNA
            clone MGC:71797 IMAGE:30336202), complete cds.
          Length = 985

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 6/46 (13%)
 Frame = +2

Query: 503  CMICQALLYDCS--RCVPCSHVFCKVCITRF----KDCPLCGADVE 622
            C IC ++L +    R +PC H+F +VC+ ++    K CP+C  D+E
Sbjct: 933  CTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDIE 978



>gb:BC020984_1977329 Homo sapiens ring finger protein 111, mRNA
           (cDNA clone IMAGE:3851753), partial cds.
          Length = 441

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 6/46 (13%)
 Frame = +2

Query: 503 CMICQALLYDCS--RCVPCSHVFCKVCITRF----KDCPLCGADVE 622
           C IC ++L +    R +PC H+F +VC+ ++    K CP+C  D+E
Sbjct: 389 CTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDIE 434



>gb:BC018107_1976414 Homo sapiens ring finger protein 138,
           transcript variant 1, mRNA (cDNA clone MGC:8758
           IMAGE:3914953), complete cds.>gb:BT006878_1990316 Homo
           sapiens STRIN protein mRNA, complete
           cds.>gb:CR457150_1993357 Homo sapiens full open reading
           frame cDNA clone RZPDo834B048D for gene RNF138, ring
           finger protein 138; complete cds, incl. stopcodon.
          Length = 245

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 5/48 (10%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVC-ITRFKD----CPLCGADVEKIE 631
           C +CQ +L    R   C HVFC+ C +T  ++    CPLC  +V + E
Sbjct: 18  CPVCQEVLKTPVRTTACQHVFCRKCFLTAMRESGAHCPLCRGNVTRRE 65



>gb:BC007602_1970846 Homo sapiens polycomb group ring finger 6, mRNA
           (cDNA clone MGC:15678 IMAGE:3350074), complete cds.
          Length = 277

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/47 (36%), Positives = 21/47 (44%), Gaps = 4/47 (8%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEKIE 631
           C IC+  L D +    C H FCK CI R       CP C   V + +
Sbjct: 136 CSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQ 182



>gb:AL591408_1930057 Human DNA sequence from clone RP11-792D24 on
           chromosome 10 Contains the INA gene for internexin
           neuronal intermediate filament protein alpha, the RNF134
           gene for ring finger protein 134, the TAF5D gene for 100
           kD TAF5 RNA polymerase II TATA box binding protein
           (TBP)-associated factor, a novel gene, the 5' end of the
           PDCD11 gene for programmed cell death 11 and four CpG
           islands, complete sequence.
          Length = 350

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/47 (36%), Positives = 21/47 (44%), Gaps = 4/47 (8%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEKIE 631
           C IC+  L D +    C H FCK CI R       CP C   V + +
Sbjct: 134 CSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQ 180



>gb:AL591408_1930056 Human DNA sequence from clone RP11-792D24 on
           chromosome 10 Contains the INA gene for internexin
           neuronal intermediate filament protein alpha, the RNF134
           gene for ring finger protein 134, the TAF5D gene for 100
           kD TAF5 RNA polymerase II TATA box binding protein
           (TBP)-associated factor, a novel gene, the 5' end of the
           PDCD11 gene for programmed cell death 11 and four CpG
           islands, complete sequence.
          Length = 275

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/47 (36%), Positives = 21/47 (44%), Gaps = 4/47 (8%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEKIE 631
           C IC+  L D +    C H FCK CI R       CP C   V + +
Sbjct: 134 CSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQ 180



>gb:AK131488_1918022 Homo sapiens cDNA FLJ16671 fis, clone
           THYMU3001428.
          Length = 602

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 6/46 (13%)
 Frame = +2

Query: 503 CMICQALLYDCS--RCVPCSHVFCKVCITRF----KDCPLCGADVE 622
           C IC ++L +    R +PC H+F +VC+ ++    K CP+C  D+E
Sbjct: 550 CTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDIE 595



>gb:AK131304_1917860 Homo sapiens cDNA FLJ16278 fis, clone
            NT2RI3001132, highly similar to Mus musculus Arkadia
            (Arkadia) mRNA.
          Length = 994

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 6/46 (13%)
 Frame = +2

Query: 503  CMICQALLYDCS--RCVPCSHVFCKVCITRF----KDCPLCGADVE 622
            C IC ++L +    R +PC H+F +VC+ ++    K CP+C  D+E
Sbjct: 942  CTICLSILEEGEDVRRLPCMHLFHQVCVDQWLVTNKKCPICRVDIE 987



>gb:AK122906_1915281 Homo sapiens cDNA FLJ16581 fis, clone
           TESTI2050987, weakly similar to RET finger protein-like
           1.
          Length = 263

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 22/54 (40%), Positives = 28/54 (51%), Gaps = 8/54 (14%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF--------KDCPLCGADVEKIEA 634
           LSC +C    + CS  + C+HVFC  CI R+          CPLC  DV K+ A
Sbjct: 9   LSCPVCLDF-FSCSISLSCTHVFCFDCIQRYILENHDFRAMCPLC-RDVVKVPA 60



>gb:AK095327_1914343 Homo sapiens cDNA FLJ38008 fis, clone
           CTONG2012452, highly similar to Mus musculus Arkadia
           (Arkadia) mRNA.
          Length = 370

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 6/46 (13%)
 Frame = +2

Query: 503 CMICQALLYDCS--RCVPCSHVFCKVCITRF----KDCPLCGADVE 622
           C IC ++L +    R +PC H+F +VC+ ++    K CP+C  D+E
Sbjct: 318 CTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDIE 363



>gb:AF162680_1887102 Homo sapiens HSD-4 protein (HSD-4) mRNA,
           complete cds.
          Length = 245

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 5/48 (10%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVC-ITRFKD----CPLCGADVEKIE 631
           C +CQ +L    R   C HVFC+ C +T  ++    CPLC  +V + E
Sbjct: 18  CPVCQEVLKTPVRTTACQHVFCRKCFLTAMRESGAHCPLCRGNVTRRE 65



>gb:AB047006_1867505 Homo sapiens hMBLR mRNA, complete
           cds.>gb:BC010235_1972555 Homo sapiens polycomb group
           ring finger 6, transcript variant 1, mRNA (cDNA clone
           MGC:17541 IMAGE:3461513), complete cds.
          Length = 352

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/47 (36%), Positives = 21/47 (44%), Gaps = 4/47 (8%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEKIE 631
           C IC+  L D +    C H FCK CI R       CP C   V + +
Sbjct: 136 CSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQ 182



>gb:AE017349_1758900 Cryptococcus neoformans var. neoformans JEC21
           chromosome 9, complete sequence.
          Length = 657

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 15/30 (50%), Positives = 18/30 (60%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITR 586
           L+C ICQ+ L D      C H FC+ CITR
Sbjct: 17  LTCAICQSALVDPVTTTSCKHTFCRDCITR 46



>gb:AY136340_1581841 Arabidopsis thaliana putative protein
           (At5g23110) mRNA, complete cds.>gb:BT000162_1634440
           Arabidopsis thaliana putative protein (At5g23110) mRNA,
           complete cds.
          Length = 620

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 16/41 (39%), Positives = 20/41 (48%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEK 625
           C ICQ    + +  VPC HV C+ C T    CP C   V +
Sbjct: 574 CQICQTKEVEVT-IVPCGHVLCRHCSTSVSRCPFCRLQVNR 613



>gb:ATAC012395_1543479 Arabidopsis thaliana chromosome III BAC T1B9
           genomic sequence, complete sequence.>gb:BT020309_1642704
           Arabidopsis thaliana At3g07120 gene, complete
           cds.>gb:BT020575_1642969 Arabidopsis thaliana At3g07120
           gene, complete cds.
          Length = 360

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 40/169 (23%), Positives = 70/169 (41%), Gaps = 12/169 (7%)
 Frame = +2

Query: 149 PVCPFVKAARP---DDASVKKPGESQSKQHGGSEKP-----KQESGEPAMVPSKCPFVHK 304
           P+  FV+  +    +  + ++  E+++   GGSE       + +SGE   + S      K
Sbjct: 197 PIVTFVEERQMSAREAVAAQEAAEAEAAAAGGSEDEDDDDEEDDSGETEEMKSSSASEPK 256

Query: 305 QQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTF 484
           Q   S +   +E+  Q  ++         E   E++  + +E+ G          DS   
Sbjct: 257 QTM-SLMDLLEETDRQMGLTGSRYAMDEDEEYEEDEEDENNEEEG----------DSHGG 305

Query: 485 KLGPLSCMICQALLYDCSRCVPCSHVFCKVC----ITRFKDCPLCGADV 619
             G LSC +C   +   S   PC H FCK+C    + +   CP+C + V
Sbjct: 306 GEGELSCCVCMVKIKGAS-FTPCGHTFCKLCSKELMAQKGHCPVCSSFV 353



>gb:AB006708_1510055 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MYJ24.
          Length = 4706

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 16/41 (39%), Positives = 20/41 (48%)
 Frame = +2

Query: 503  CMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEK 625
            C ICQ    + +  VPC HV C+ C T    CP C   V +
Sbjct: 4660 CQICQTKEVEVT-IVPCGHVLCRHCSTSVSRCPFCRLQVNR 4699



>gb:AX881027_1478514 Sequence 15932 from Patent
           EP1074617.>gb:AK027885_1911292 Homo sapiens cDNA
           FLJ14979 fis, clone Y79AA1000037, moderately similar to
           DNA-BINDING PROTEIN BMI-1.
          Length = 220

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/47 (36%), Positives = 21/47 (44%), Gaps = 4/47 (8%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEKIE 631
           C IC+  L D +    C H FCK CI R       CP C   V + +
Sbjct: 136 CSICKGYLIDATTITECLHTFCKSCIVRHFYYSNRCPKCNIVVHQTQ 182



>gb:AX405832_1467760 Sequence 247 from Patent WO0222660.
          Length = 371

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 6/46 (13%)
 Frame = +2

Query: 503 CMICQALLYDCS--RCVPCSHVFCKVCITRF----KDCPLCGADVE 622
           C IC ++L +    R +PC H+F +VC+ ++    K CP+C  D+E
Sbjct: 319 CTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDIE 364



>gb:HSM802460_1186708 Homo sapiens mRNA; cDNA DKFZp761D081 (from
           clone DKFZp761D081).
          Length = 178

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 6/46 (13%)
 Frame = +2

Query: 503 CMICQALLYDCS--RCVPCSHVFCKVCITRF----KDCPLCGADVE 622
           C IC ++L +    R +PC H+F +VC+ ++    K CP+C  D+E
Sbjct: 126 CTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDIE 171



>gb:CR861381_1185379 Pongo pygmaeus mRNA; cDNA DKFZp459A112 (from
            clone DKFZp459A112).
          Length = 986

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 6/46 (13%)
 Frame = +2

Query: 503  CMICQALLYDCS--RCVPCSHVFCKVCITRF----KDCPLCGADVE 622
            C IC ++L +    R +PC H+F +VC+ ++    K CP+C  D+E
Sbjct: 934  CTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDIE 979



>gb:AK048110_1168293 Mus musculus 16 days embryo head cDNA, RIKEN
            full-length enriched library, clone:C130035E22
            product:arkadia, full insert sequence.
          Length = 981

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 6/46 (13%)
 Frame = +2

Query: 503  CMICQALLYDCS--RCVPCSHVFCKVCITRF----KDCPLCGADVE 622
            C IC ++L +    R +PC H+F +VC+ ++    K CP+C  D+E
Sbjct: 929  CTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDIE 974



>gb:AK036351_1164439 Mus musculus 16 days neonate cerebellum cDNA,
            RIKEN full-length enriched library, clone:9630060A01
            product:arkadia, full insert sequence.
          Length = 981

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 6/46 (13%)
 Frame = +2

Query: 503  CMICQALLYDCS--RCVPCSHVFCKVCITRF----KDCPLCGADVE 622
            C IC ++L +    R +PC H+F +VC+ ++    K CP+C  D+E
Sbjct: 929  CTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDIE 974



>pir|T46904|T46904 hypothetical protein DKFZp761D081.1 -
           human>gb:BC010369_1972594 Homo sapiens ring finger
           protein 111, mRNA (cDNA clone IMAGE:4049734), complete
           cds.
          Length = 137

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 6/46 (13%)
 Frame = +2

Query: 503 CMICQALLYDCS--RCVPCSHVFCKVCITRF----KDCPLCGADVE 622
           C IC ++L +    R +PC H+F +VC+ ++    K CP+C  D+E
Sbjct: 85  CTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDIE 130



>pir|E86326|E86326 protein F18O14.3 [imported] - Arabidopsis
           thaliana>gb:AE005172_890890 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC025808_1539550 Genomic sequence for
           Arabidopsis thaliana BAC F18O14 from chromosome I,
           complete sequence.>gb:AY057705_1564117 Arabidopsis
           thaliana At1g19310/F18O14_14 mRNA, complete
           cds.>gb:AY085230_1570303 Arabidopsis thaliana clone 1402
           mRNA, complete sequence.>gb:AY116959_1579119 Arabidopsis
           thaliana At1g19310/F18O14_14 mRNA, complete cds.
          Length = 226

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 7/66 (10%)
 Frame = +2

Query: 449 PKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF-------KDCPLC 607
           P C  G D+         C IC  L  D    + C H+FC  C+ ++       KDCP+C
Sbjct: 5   PSCSSGNDTNNNDSSNFECNICLDLAQDPIVTL-CGHLFCWPCLYKWLHLHSQSKDCPVC 63

Query: 608 GADVEK 625
            A +E+
Sbjct: 64  KAVIEE 69



>sp|Q8VC56|RNF8_MOUSE Ubiquitin ligase protein RNF8 (EC 6.3.2.-)
           (RING finger protein 8) (AIP37) (ActA-interacting
           protein 37) (LaXp180).>gb:AK076180_1171285 Mus musculus
           18 days pregnant adult female placenta and extra
           embryonic tissue cDNA, RIKEN full-length enriched
           library, clone:3830404E21 product:similar to NEW ZINC
           FINGER PROTEIN (DJ744I24.1) (KIAA0646 (NEW ZINC FINGER
           PROTEIN)) (RING FINGER PROTEIN (C3HC4 TYPE) 8) [Homo
           sapiens], full insert sequence.>gb:BC021778_2093628 Mus
           musculus ring finger protein 8, mRNA (cDNA clone
           MGC:28682 IMAGE:4239442), complete cds.
          Length = 488

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 29/111 (26%), Positives = 45/111 (40%), Gaps = 4/111 (3%)
 Frame = +2

Query: 302 KQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQT 481
           KQQ    ++ +Q   E+   S K  F    +A  +   +   EK  V + K  +      
Sbjct: 340 KQQLVQALQEHQALMEELNCSKK-DFEKIIQAKNKELEQTKEEKDKVQAQKEEVLSHMND 398

Query: 482 FKLGPLSCMICQALLYDCSRCVPCSHVFCKVCIT----RFKDCPLCGADVE 622
                L C+IC     +    + C+H FC  CI     R  +CP+C  D+E
Sbjct: 399 LLENELQCIICSEYFIEAVT-LNCAHSFCSFCINEWMKRKVECPICRKDIE 448



>sp|O13033|RAG1_BRARE V(D)J recombination activating protein 1
           (RAG-1).>gb:DRU71093_2571368 Danio rerio recombinase
           (rag1) gene, complete cds.
          Length = 1057

 Score = 37.7 bits (86), Expect = 0.16
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 5/42 (11%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           ++C +C  LL D  +  PC H+FC++CI R+      +CP C
Sbjct: 294 VTCQVCDHLLSDPVQS-PCRHLFCRLCIIRYTHALGPNCPTC 334



>gb:AF275348_2225683 Cercopithecine herpesvirus 7, complete genome.
          Length = 503

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 4/47 (8%)
 Frame = +2

Query: 500 SCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEKI 628
           +C IC + +    + +PC H FC VCI  +      CPLC   V  I
Sbjct: 18  NCAICMSAISGLGKTLPCLHDFCFVCIQTWTSTSAQCPLCRTVVSSI 64



>gb:AY249879_2080744 Hystrix africaeaustralis recombination
           activating protein 1 (RAG1) gene, partial cds.
          Length = 263

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 5/54 (9%)
 Frame = +2

Query: 461 LGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           L  D  T  +  +SC IC+ +L D      C HVFC++CI R        CP C
Sbjct: 101 LAVDFPTHFVKSISCQICEHILADPVETT-CKHVFCRICILRCLKVMGSYCPSC 153



>gb:AY249878_2080743 Dolichotis patagonum recombination activating
           protein 1 (RAG1) gene, partial cds.
          Length = 269

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 5/54 (9%)
 Frame = +2

Query: 461 LGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           L  D  T  +  +SC IC+ +L D      C HVFC++CI R        CP C
Sbjct: 103 LAVDFPTHFVKSISCQICEHILADPVETT-CKHVFCRICILRCLKVMGSYCPSC 155



>gb:AY241472_2080417 Glaucomys volans RAG1 protein (RAG1) gene,
           partial cds.
          Length = 692

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 20/54 (37%), Positives = 26/54 (48%), Gaps = 5/54 (9%)
 Frame = +2

Query: 461 LGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           L  D  T  +  +SC IC+ +L D      C HVFC++CI R        CP C
Sbjct: 248 LAVDFPTHFVKSISCQICEHILADPVE-TSCKHVFCRICILRCLKVMGSYCPSC 300



>gb:AF315468_2062620 Rattus norvegicus RSD-4 mRNA, complete
           cds.>gb:BC061821_2104681 Rattus norvegicus ring finger
           protein 138, mRNA (cDNA clone MGC:72355 IMAGE:5599087),
           complete cds.
          Length = 209

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 5/48 (10%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVC-ITRFKD----CPLCGADVEKIE 631
           C +CQ +L    R   C HVFC+ C +T  ++    CPLC   V + E
Sbjct: 18  CPVCQEVLKTPVRTAACQHVFCRKCFLTAMRESGIHCPLCRGSVTRRE 65



>gb:AB025011_2044350 Mus musculus mRNA for Trif-d, complete cds.
          Length = 95

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 5/48 (10%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVC-ITRFKD----CPLCGADVEKIE 631
           C +CQ +L    R   C HVFC+ C +T  ++    CPLC   V + E
Sbjct: 18  CPVCQEVLKTPVRTAACQHVFCRKCFLTAMRESGIHCPLCRGSVTRRE 65



>gb:AB025010_2044349 Mus musculus mRNA for Trif, complete
           cds.>gb:BC003712_2089273 Mus musculus ring finger
           protein 138, transcript variant 2, mRNA (cDNA clone
           MGC:5701 IMAGE:3593899), complete cds.
          Length = 209

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 5/48 (10%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVC-ITRFKD----CPLCGADVEKIE 631
           C +CQ +L    R   C HVFC+ C +T  ++    CPLC   V + E
Sbjct: 18  CPVCQEVLKTPVRTAACQHVFCRKCFLTAMRESGIHCPLCRGSVTRRE 65



>gb:BT001981_1635584 Arabidopsis thaliana expressed protein
           (At1g18660) mRNA, complete cds.>gb:BT006617_1639504
           Arabidopsis thaliana At1g18660 mRNA, complete cds.
          Length = 486

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 4/39 (10%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLC 607
           C +C  LLY+ +   PC H FC+ C+ +  D    CPLC
Sbjct: 196 CTVCLKLLYEPAT-TPCGHTFCRSCLFQSMDRGNKCPLC 233



>gb:AY085998_1571059 Arabidopsis thaliana clone 205719 mRNA,
           complete sequence.
          Length = 486

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 4/39 (10%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLC 607
           C +C  LLY+ +   PC H FC+ C+ +  D    CPLC
Sbjct: 196 CTVCLKLLYEPAT-TPCGHTFCRSCLFQSMDRGNKCPLC 233



>gb:AY249883_1428003 Tenrec ecaudatus recombination activating
           protein 1 (RAG1) gene, partial cds.
          Length = 268

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 23/60 (38%), Positives = 28/60 (46%), Gaps = 5/60 (8%)
 Frame = +2

Query: 443 MSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           +SPK  L  D     +   SC IC+ LL D      C HVFC++CI R        CP C
Sbjct: 97  LSPKL-LAVDYPVNFVKSFSCQICEHLLADPVE-TSCQHVFCRICILRCLKIMGSHCPSC 154



>gb:AY249871_1427995 Erinaceus europaeus recombination activating
           protein 1 (RAG1) gene, partial cds.
          Length = 266

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 33/124 (26%), Positives = 46/124 (37%), Gaps = 15/124 (12%)
 Frame = +2

Query: 281 SKCPFVHKQQAGSEIKPNQESGEQAKVSSKCPFGYTQ--EAGGENKPKQVSEKPGVMSPK 454
           S C   H    G + K  Q +G+ +K          Q  +    N+ K  S+K       
Sbjct: 31  SSCDICHASSRGLKRKSQQSNGQLSKRLKSVVDQARQIHQRKKRNQAKISSKKAMKKITN 90

Query: 455 CP--------LGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KD 595
           C         L  D     +  +SC IC  +L D  +   C HVFC++CI R        
Sbjct: 91  CSKIHLSTNLLAVDFPAHFVKSVSCQICGHILTDPVQ-TSCKHVFCRICILRCLKVMGSY 149

Query: 596 CPLC 607
           CP C
Sbjct: 150 CPSC 153



>gb:U67953_1405932 Caenorhabditis elegans cosmid ZC13, complete
           sequence.
          Length = 398

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 4/45 (8%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLCGADVEK 625
           C +C   L    + + C+HVFCK CI  + D    CP+C A+V K
Sbjct: 337 CAVCHGDLLQPIK-LECTHVFCKFCIETWLDQKSTCPICRAEVTK 380



>gb:CPU48717_1374796 Cryptosporidium parvum zinc finger protein
           gene, complete cds.
          Length = 873

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 29/104 (27%), Positives = 46/104 (44%), Gaps = 6/104 (5%)
 Frame = +2

Query: 314 GSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLG 493
           GS+I  N+++     V+++ P+   +    +NK ++V+            GF+S      
Sbjct: 22  GSDIINNKDNMFNITVNTE-PYDVLENDIMKNKSRKVNNSS-------KNGFESTNISNK 73

Query: 494 PLSCMICQALL--YDCSRCVPCSHVFCKVCITR----FKDCPLC 607
            LS   C   L  Y     +PC H FC+ CIT      K CP+C
Sbjct: 74  ILSEFTCPVCLDYYMLPVTIPCGHTFCRYCITHNRLLGKKCPVC 117



>gb:AK013419_1157508 Mus musculus 10, 11 days embryo whole body
           cDNA, RIKEN full-length enriched library,
           clone:2810480D20 product:Trif gene, full insert
           sequence.
          Length = 178

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 5/48 (10%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVC-ITRFKD----CPLCGADVEKIE 631
           C +CQ +L    R   C HVFC+ C +T  ++    CPLC   V + E
Sbjct: 6   CPVCQEVLKTPVRTAACQHVFCRKCFLTAMRESGIHCPLCRGSVTRRE 53



>gb:AK004238_1152284 Mus musculus 18-day embryo whole body cDNA,
           RIKEN full-length enriched library, clone:1110053K18
           product:Trif gene, full insert
           sequence.>gb:AK010486_1155798 Mus musculus ES cells
           cDNA, RIKEN full-length enriched library,
           clone:2410015A17 product:Trif gene, full insert
           sequence.
          Length = 245

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 5/48 (10%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVC-ITRFKD----CPLCGADVEKIE 631
           C +CQ +L    R   C HVFC+ C +T  ++    CPLC   V + E
Sbjct: 18  CPVCQEVLKTPVRTAACQHVFCRKCFLTAMRESGIHCPLCRGSVTRRE 65



>gb:AE014298_1126147 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003505_1213156 Drosophila melanogaster
           chromosome X, section 57 of 74 of the complete sequence.
          Length = 975

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 1/78 (1%)
 Frame = +2

Query: 206 GESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCPF-G 382
           G+ ++       K     G P + PS    V + +  S+I+ + ESGE++  S + P   
Sbjct: 205 GDQEASADEEDAKNNSGGGSPRVKPSSA--VKESKKSSDIEDSGESGEESATSDEEPDES 262

Query: 383 YTQEAGGENKPKQVSEKP 436
             Q  G E +PKQ ++KP
Sbjct: 263 SAQSPGQEKEPKQTAKKP 280



>gb:AE014298_1126146 Drosophila melanogaster chromosome X, complete
           sequence.>gb:AE003505_1213155 Drosophila melanogaster
           chromosome X, section 57 of 74 of the complete
           sequence.>gb:AF145609_1244668 Drosophila melanogaster
           clone GH02833 BcDNA.GH02833 (BcDNA.GH02833) mRNA,
           complete cds.
          Length = 974

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 1/78 (1%)
 Frame = +2

Query: 206 GESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCPF-G 382
           G+ ++       K     G P + PS    V + +  S+I+ + ESGE++  S + P   
Sbjct: 204 GDQEASADEEDAKNNSGGGSPRVKPSSA--VKESKKSSDIEDSGESGEESATSDEEPDES 261

Query: 383 YTQEAGGENKPKQVSEKP 436
             Q  G E +PKQ ++KP
Sbjct: 262 SAQSPGQEKEPKQTAKKP 279



>pir|T25935|T25935 hypothetical protein ZC13.1 - Caenorhabditis
           elegans
          Length = 409

 Score = 37.4 bits (85), Expect = 0.21
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 4/45 (8%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLCGADVEK 625
           C +C   L    + + C+HVFCK CI  + D    CP+C A+V K
Sbjct: 348 CAVCHGDLLQPIK-LECTHVFCKFCIETWLDQKSTCPICRAEVTK 391



>pir|S53414|S53414 probable membrane protein YLR427w - yeast
           (Saccharomyces cerevisiae)>gb:AY692728_1622775
           Saccharomyces cerevisiae clone FLH158303.01X YLR427W
           gene, complete cds.>gb:YSCL9576_1729717 Saccharomyces
           cerevisiae chromosome XII cosmid 9576.
          Length = 670

 Score = 33.1 bits (74), Expect(2) = 0.23
 Identities = 17/58 (29%), Positives = 23/58 (39%), Gaps = 20/58 (34%)
 Frame = +2

Query: 500 SCMICQALLYDCSRCVPCSHVFCKVCITRF--------------------KDCPLCGA 613
           +C IC +      R V C H+FC  C+  F                    K+CPLCG+
Sbjct: 194 NCSICLSEEPVAPRMVTCGHIFCLSCLLNFFSIEETVKNKETGYSKKKKYKECPLCGS 251



 Score = 23.1 bits (48), Expect(2) = 0.23
 Identities = 18/66 (27%), Positives = 32/66 (48%)
 Frame = +3

Query: 207 EKVKVNSMAAVRSPSRSLGSQLWCRRNALLSINSKLAVKSSLIRNLGSKQRCHPNAPLDI 386
           E+ K  S ++ +S +R     +    +  +++N +L V     R    +Q C+PN P+D 
Sbjct: 126 EREKSRSSSSKKS-NRRRDEHVHLHGDTFVNVNYRLLVDD---RFDYPEQNCNPNVPVDQ 181

Query: 387 HKKLVV 404
            K L V
Sbjct: 182 EKILRV 187



>gb:BC074706_2558199 Xenopus tropicalis ribosome binding protein 1
           homolog 180kDa (dog), mRNA (cDNA clone MGC:69441
           IMAGE:5335852), complete cds.
          Length = 1037

 Score = 37.0 bits (84), Expect = 0.28
 Identities = 33/105 (31%), Positives = 43/105 (40%), Gaps = 4/105 (3%)
 Frame = +2

Query: 152 VCPFVKAARPDDASV----KKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGS 319
           V P  K + P         +KP     K    S+KP   S +PA V  K   V ++ A  
Sbjct: 116 VAPVPKKSAPGSVKSAPVSEKPAPVSQKPAPVSQKPAPVSQKPAPVSQKPAPVSQKPAPV 175

Query: 320 EIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPK 454
             KP   S + A VS K      + A    KP  VS+KP  +S K
Sbjct: 176 SQKPAPVSQKPAPVSQKPAPVSQKPAPVSQKPAPVSQKPAPVSQK 220



 Score = 36.2 bits (82), Expect = 0.48
 Identities = 35/108 (32%), Positives = 45/108 (41%), Gaps = 2/108 (1%)
 Frame = +2

Query: 137 IKMTPVC--PFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQ 310
           +K  PV   P   + +P   S +KP     K    S+KP   S +PA V  K   V ++ 
Sbjct: 128 VKSAPVSEKPAPVSQKPAPVS-QKPAPVSQKPAPVSQKPAPVSQKPAPVSQKPAPVSQKP 186

Query: 311 AGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPK 454
           A    KP   S + A VS K      + A    KP  V EKP   S K
Sbjct: 187 APVSQKPAPVSQKPAPVSQKPAPVSQKPAPVSQKPAPVPEKPAPASEK 234



 Score = 32.3 bits (72), Expect = 6.9
 Identities = 28/86 (32%), Positives = 35/86 (40%)
 Frame = +2

Query: 197 KKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCP 376
           +KP     K    S+KP   S +PA V  K   V ++ A    KP   S + A VS K  
Sbjct: 163 QKPAPVSQKPAPVSQKPAPVSQKPAPVSQKPAPVSQKPAPVSQKPAPVSQKPAPVSQK-- 220

Query: 377 FGYTQEAGGENKPKQVSEKPGVMSPK 454
                 A    KP   SEKP  +  K
Sbjct: 221 -----PAPVPEKPAPASEKPAPVQEK 241



>gb:AY241458_2080403 Dendromus mesomelas RAG1 protein (RAG1) gene,
           partial cds.
          Length = 438

 Score = 37.0 bits (84), Expect = 0.28
 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 5/42 (11%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           +SC IC+ +L D      C HVFC++CI R       +CP C
Sbjct: 252 ISCQICEHILADPVE-TSCKHVFCRICILRCLKVMGSNCPSC 292



>gb:CR380956_1652189 Candida glabrata strain CBS138 chromosome J
           complete sequence.
          Length = 599

 Score = 37.0 bits (84), Expect = 0.28
 Identities = 24/93 (25%), Positives = 36/93 (38%), Gaps = 20/93 (21%)
 Frame = +2

Query: 404 ENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCI- 580
           EN P +  +K  ++    P G           +C IC   +    R V C H+FC  C+ 
Sbjct: 129 ENDPNKFVDKEKIVRVIVPRG----------QNCPICLNEIPVAPRMVTCGHIFCMSCLE 178

Query: 581 -------------------TRFKDCPLCGADVE 622
                               +FK+CPLCG+ V+
Sbjct: 179 NFFEIEEVVKNPETGIKQKKKFKECPLCGSIVK 211



>gb:AY239195_1427669 Elephas maximus recombination activating
           protein 1 (RAG-1) gene, partial cds.
          Length = 262

 Score = 37.0 bits (84), Expect = 0.28
 Identities = 31/128 (24%), Positives = 49/128 (38%), Gaps = 15/128 (11%)
 Frame = +2

Query: 269 AMVPSKCPFVHKQQAGSEIKPNQES----------GEQAKVSSKCPFGYTQEAGGENKPK 418
           A  PS C   H  + G + K +Q S           ++A+ + +C          +   K
Sbjct: 27  AHTPS-CDICHAARRGLKRKSHQPSLQLSKKLKTVADRARQACQCKRRAQTRISNKEVMK 85

Query: 419 QVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF--- 589
           ++     +      L  D     +  +SC IC+ +L D      C HVFC++CI R    
Sbjct: 86  RIXNCSKIHLSTKLLAVDYPVHFVKSISCQICKHILADPVE-TSCKHVFCRICILRCLKV 144

Query: 590 --KDCPLC 607
               CP C
Sbjct: 145 MGSYCPSC 152



>pir|T15742|T15742 hypothetical protein C32D5.11 - Caenorhabditis
           elegans>gb:U23511_1402309 Caenorhabditis elegans cosmid
           C32D5, complete sequence.
          Length = 770

 Score = 37.0 bits (84), Expect = 0.28
 Identities = 22/73 (30%), Positives = 33/73 (45%), Gaps = 8/73 (10%)
 Frame = +2

Query: 443 MSPKCPLGFDSQTFKLGPLSCMICQALLY--DCSRCVPCSHVFCKVCITRF------KDC 598
           + P  P    S    +  L C IC +  +  +C R   C+H FC  CI+ +        C
Sbjct: 48  VEPVIPSPSTSSNNPVEELQCTICLSTRFSQEC-RIEGCNHSFCFSCISEWVCQSLRPSC 106

Query: 599 PLCGADVEKIEAD 637
           P+C  DV+K+  D
Sbjct: 107 PMCRKDVDKVSYD 119



>gb:BC081009_2561919 Xenopus laevis MGC81562 protein, mRNA (cDNA clone
            MGC:81562 IMAGE:6863030), complete cds.
          Length = 967

 Score = 36.6 bits (83), Expect = 0.37
 Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 6/46 (13%)
 Frame = +2

Query: 503  CMICQALLYDCS--RCVPCSHVFCKVCITRF----KDCPLCGADVE 622
            C IC ++L +    R +PC H+F +VC+ ++    K CP+C  D++
Sbjct: 915  CTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDID 960



>gb:BC070603_2555582 Xenopus laevis cDNA clone MGC:81253
            IMAGE:6631223, complete cds.
          Length = 959

 Score = 36.6 bits (83), Expect = 0.37
 Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 6/46 (13%)
 Frame = +2

Query: 503  CMICQALLYDCS--RCVPCSHVFCKVCITRF----KDCPLCGADVE 622
            C IC ++L +    R +PC H+F +VC+ ++    K CP+C  D++
Sbjct: 907  CTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDID 952



>gb:AF329847_2487920 Xenopus laevis ring finger-H2 protein (arkadia)
            mRNA, partial cds.
          Length = 923

 Score = 36.6 bits (83), Expect = 0.37
 Identities = 16/46 (34%), Positives = 28/46 (60%), Gaps = 6/46 (13%)
 Frame = +2

Query: 503  CMICQALLYDCS--RCVPCSHVFCKVCITRF----KDCPLCGADVE 622
            C IC ++L +    R +PC H+F +VC+ ++    K CP+C  D++
Sbjct: 871  CTICLSILEEGEDVRRLPCMHLFHQVCVDQWLITNKKCPICRVDID 916



>gb:HSRNF3A_2020116 Homo sapiens mRNA for RNF3A (DONG1) ring finger
           protein.
          Length = 247

 Score = 36.6 bits (83), Expect = 0.37
 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 4/41 (9%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLC 607
           ++C +C   L D +    C H FC+ C+ ++ +    CP C
Sbjct: 20  ITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTC 60



>gb:AL158211_1921452 Human DNA sequence from clone RP11-573G6 on
           chromosome 10 Contains a ribosomal protein L31 (RPL31)
           pseudogene, the BUP gene for BUP protein, the BMI1 gene
           for B lymphoma Mo-MLV insertion region (mouse)
           (MGC12685), the 5' end of the SPAG6 gene for sperm
           associated antigen 6 (pf16, MGC26276,
           Repro-SA-1,DKFZp434I153), the 5' end of a novel gene and
           seven CpG islands, complete sequence.
          Length = 184

 Score = 36.6 bits (83), Expect = 0.37
 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 4/36 (11%)
 Frame = +2

Query: 530 DCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           D +  + C H FCK CI R+    K CP+C   V K
Sbjct: 4   DATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHK 39



>gb:AY102110_1577718 Arabidopsis thaliana At1g19870/F6F9_18 mRNA,
           complete cds.>gb:BT001081_1635336 Arabidopsis thaliana
           At1g19870/F6F9_18 mRNA, complete cds.
          Length = 794

 Score = 36.6 bits (83), Expect = 0.37
 Identities = 35/111 (31%), Positives = 48/111 (43%), Gaps = 4/111 (3%)
 Frame = +2

Query: 89  PQNYSTEIQCRSHGLLIKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEP 268
           PQ Y+      S G L  MT        A    +SVK   + +S++ G S+K K      
Sbjct: 625 PQAYAL-----SEGALTPMTITESQATPASQASSSVKAR-KGKSEKSGSSQKRK------ 672

Query: 269 AMVPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCPFGYTQEA----GGEN 409
             V  K     KQ+ G+     QE G++ K   +  FGY QEA    GG+N
Sbjct: 673 --VSKKITSSPKQEIGTGEATEQEEGKEQKSGRRTSFGYDQEARESSGGKN 721



>gb:AY084918_1570000 Arabidopsis thaliana clone 121418 mRNA,
           complete sequence.
          Length = 312

 Score = 36.6 bits (83), Expect = 0.37
 Identities = 35/111 (31%), Positives = 48/111 (43%), Gaps = 4/111 (3%)
 Frame = +2

Query: 89  PQNYSTEIQCRSHGLLIKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEP 268
           PQ Y+      S G L  MT        A    +SVK   + +S++ G S+K K      
Sbjct: 143 PQAYAL-----SEGALTPMTITESQATPASQASSSVKAR-KGKSEKSGSSQKRK------ 190

Query: 269 AMVPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCPFGYTQEA----GGEN 409
             V  K     KQ+ G+     QE G++ K   +  FGY QEA    GG+N
Sbjct: 191 --VSKKITSSPKQEIGTGEATEQEEGKEQKSGRRTSFGYDQEARESSGGKN 239



>gb:AY249874_1427998 Uropsilus soricipes recombination activating
           protein 1 (RAG1) gene, partial cds.
          Length = 265

 Score = 36.6 bits (83), Expect = 0.37
 Identities = 31/123 (25%), Positives = 45/123 (36%), Gaps = 16/123 (13%)
 Frame = +2

Query: 287 CPFVHKQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCP-- 460
           C   H  + G + K +Q + E +K   K      ++A    K  Q       +  K    
Sbjct: 33  CDICHNARRGLKRKSHQPNAELSK-KLKTVIDQARQARQRKKRAQARINSKEVMKKITNC 91

Query: 461 ---------LGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDC 598
                    L  D     +  +SC IC+ +L D      C HVFC++CI R        C
Sbjct: 92  HKIHLSTKLLAVDFPAHFVKSISCQICEHILADPVE-TSCKHVFCRICILRCLKVMGSYC 150

Query: 599 PLC 607
           P C
Sbjct: 151 PCC 153



>gb:AY239192_1427666 Procavia capensis recombination activating
           protein 1 (RAG-1) gene, partial cds.
          Length = 266

 Score = 36.6 bits (83), Expect = 0.37
 Identities = 30/122 (24%), Positives = 45/122 (36%), Gaps = 15/122 (12%)
 Frame = +2

Query: 287 CPFVHKQQAGSEIKPNQES----------GEQAKVSSKCPFGYTQEAGGENKPKQVSEKP 436
           C   H  + G + K  Q S            +A+ + +C          +   KQ++   
Sbjct: 33  CDICHAARQGLKRKGRQPSLLLSKKLKTVANRARQACQCKRRAQARISSKEVMKQIANCS 92

Query: 437 GVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCP 601
            +      L  D     +  +SC IC+ +L D      C HVFC+VCI R        CP
Sbjct: 93  KIHLSTKLLVVDYPAHFVKSISCQICEHILADPVE-TSCKHVFCRVCILRCLKVTGSYCP 151

Query: 602 LC 607
            C
Sbjct: 152 SC 153



>gb:AY070592_1294737 Drosophila melanogaster RE69393 full length
           cDNA.
          Length = 376

 Score = 36.6 bits (83), Expect = 0.37
 Identities = 24/97 (24%), Positives = 40/97 (41%), Gaps = 4/97 (4%)
 Frame = +2

Query: 341 SGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQA 520
           SGE   V S      +      + P + +   GV +     G DS +     L C IC  
Sbjct: 70  SGEDPAVGSASGAAASDTDSLASSPDEGALATGVDAAAAVSGEDSPSAAAAALECPICLQ 129

Query: 521 LLYDCSRCVPCSHVFCKVCIT----RFKDCPLCGADV 619
                +R +PC H+FC +C+     + + C +C  ++
Sbjct: 130 TCIHPAR-LPCGHIFCFLCVKGVAYKNRRCAMCRREI 165



>gb:AK089091_1175796 Mus musculus 2 days neonate thymus thymic cells
           cDNA, RIKEN full-length enriched library,
           clone:E430039C14 product:RING FINGER PROTEIN homolog
           [Homo sapiens], full insert
           sequence.>gb:BC049266_2100006 Mus musculus ring finger
           protein 3, mRNA (cDNA clone MGC:55128 IMAGE:5371040),
           complete cds.
          Length = 241

 Score = 36.6 bits (83), Expect = 0.37
 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 4/41 (9%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLC 607
           ++C +C   L D +    C H FC+ C+ ++ +    CP C
Sbjct: 15  ITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTC 55



>gb:AK033609_1163433 Mus musculus adult male cecum cDNA, RIKEN
           full-length enriched library, clone:9130201A12
           product:RING FINGER PROTEIN homolog [Homo sapiens], full
           insert sequence.
          Length = 178

 Score = 36.6 bits (83), Expect = 0.37
 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 4/41 (9%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLC 607
           ++C +C   L D +    C H FC+ C+ ++ +    CP C
Sbjct: 15  ITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTC 55



>gb:AE014296_1137025 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003516_1213694 Drosophila melanogaster
           chromosome 3L, section 69 of 83 of the complete
           sequence.
          Length = 376

 Score = 36.6 bits (83), Expect = 0.37
 Identities = 24/97 (24%), Positives = 40/97 (41%), Gaps = 4/97 (4%)
 Frame = +2

Query: 341 SGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQA 520
           SGE   V S      +      + P + +   GV +     G DS +     L C IC  
Sbjct: 70  SGEDPAVGSASGAAASDTDSLASSPDEGALATGVDAAAAVSGEDSPSAAAAALECPICLQ 129

Query: 521 LLYDCSRCVPCSHVFCKVCIT----RFKDCPLCGADV 619
                +R +PC H+FC +C+     + + C +C  ++
Sbjct: 130 TCIHPAR-LPCGHIFCFLCVKGVAYKNRRCAMCRREI 165



>gb:AE014296_1136454 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003529_1214243 Drosophila melanogaster
           chromosome 3L, section 56 of 83 of the complete
           sequence.>gb:AY051931_1290525 Drosophila melanogaster
           LD41235 full length cDNA.
          Length = 315

 Score = 36.6 bits (83), Expect = 0.37
 Identities = 17/40 (42%), Positives = 22/40 (55%), Gaps = 4/40 (10%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCI----TRFKDCPL 604
           L+C IC  +L D  + V C H FC+ CI    TR   CP+
Sbjct: 16  LTCPICSGVLEDPLQAVMCEHAFCRGCINEWLTRQPTCPV 55



>gb:AE016959_1023235 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC068950_1540557
           Oryza sativa chromosome 10 BAC OSJNBa0041P03 genomic
           sequence, complete sequence.>gb:AE017108_1753054 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           62 of 77 of the complete sequence.
          Length = 502

 Score = 36.6 bits (83), Expect = 0.37
 Identities = 14/43 (32%), Positives = 20/43 (46%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIE 631
           C  C+  +    R +PC H FC  C      C LC   ++KI+
Sbjct: 108 CCRCEFPIALYGRLIPCEHAFCLACARSDSSCYLCDERIQKIQ 150



>pir|A86332|A86332 F6F9.8 protein - Arabidopsis
           thaliana>gb:AE005172_890949 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC007797_1536221 Arabidopsis thaliana
           chromosome I BAC F6F9 genomic sequence, complete
           sequence.
          Length = 805

 Score = 36.6 bits (83), Expect = 0.37
 Identities = 35/111 (31%), Positives = 48/111 (43%), Gaps = 4/111 (3%)
 Frame = +2

Query: 89  PQNYSTEIQCRSHGLLIKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEP 268
           PQ Y+      S G L  MT        A    +SVK   + +S++ G S+K K      
Sbjct: 625 PQAYAL-----SEGALTPMTITESQATPASQASSSVKAR-KGKSEKSGSSQKRK------ 672

Query: 269 AMVPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCPFGYTQEA----GGEN 409
             V  K     KQ+ G+     QE G++ K   +  FGY QEA    GG+N
Sbjct: 673 --VSKKITSSPKQEIGTGEATEQEEGKEQKSGRRTSFGYDQEARESSGGKN 721



>sp|Q00940|PEXA_PICAN Peroxisome assembly protein PER8
           (Peroxin-10).>pir|A56488|A56488 Per8 peroxisomal
           integral membrane protein - yeast (Pichia
           angusta)>gb:HPPER8P_1682046 H.polymorpha PER8 gene
           encoding peroxisomal integral membrane protein (Per8p).
          Length = 295

 Score = 36.6 bits (83), Expect = 0.37
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 4/46 (8%)
 Frame = +2

Query: 500 SCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEK 625
           +CM+C + + D S C  C HVFC  C+  +    ++CPLC A + +
Sbjct: 244 TCMLCLSPMKDPS-CGECGHVFCWKCVLDWVKERQECPLCRAKMRE 288



>gb:BC084067_2563473 Xenopus laevis hypothetical LOC494986, mRNA
           (cDNA clone MGC:80484 IMAGE:5156596), complete cds.
          Length = 445

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 16/44 (36%), Positives = 26/44 (59%), Gaps = 1/44 (2%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSH-VFCKVCITRFKDCPLCGADVEKIE 631
           CM+C     + + C PC H V C+ C T+ + CP+C A V+ ++
Sbjct: 387 CMLCCEEEINSAFC-PCGHMVCCEGCATQLQSCPVCRASVKHVQ 429



>gb:AY443301_2532915 Microeca papuana recombination activating
           protein 1 (RAG1) gene, partial cds.
          Length = 957

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 30/120 (25%), Positives = 48/120 (40%), Gaps = 13/120 (10%)
 Frame = +2

Query: 287 CPFVHKQQAGSEIK---PNQESGEQAKVSSKCPF---GYTQEAGGENKP--KQVSEKPGV 442
           C   H  + G + K   P+ +  ++ K + +C     G   +A   NK   K++     +
Sbjct: 177 CDVCHTTRQGVKRKSQPPSVQRSKRVKTTGECARLNRGVKNQAQINNKNLMKEIXNCKDI 236

Query: 443 MSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
                 L FD     +  +SC IC  +L D      C H+FC+ CI +        CP C
Sbjct: 237 HLSTKLLAFDYPADFIKSISCQICDHILADPVETT-CRHLFCRTCILKCIRVMGSYCPSC 295



>gb:AY294959_2081738 Neotoma floridana recombination activating gene
           1 (RAG1) gene, partial cds.
          Length = 1006

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 28/99 (28%), Positives = 39/99 (39%), Gaps = 5/99 (5%)
 Frame = +2

Query: 326 KPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSC 505
           +  Q    QA+VSSK               K++S    +      L  D     +  +SC
Sbjct: 216 RDRQRKRAQARVSSK------------EVMKKISNCSKIHLSTKLLAVDFPAHFVKSISC 263

Query: 506 MICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
            IC+ +L D      C HVFC++CI R        CP C
Sbjct: 264 QICEHILADPVE-TSCKHVFCRICILRCLKVMGSYCPSC 301



>gb:AY241459_2080404 Beamys hindei RAG1 protein (RAG1) gene, partial
           cds.
          Length = 418

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 27/99 (27%), Positives = 39/99 (39%), Gaps = 5/99 (5%)
 Frame = +2

Query: 326 KPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSC 505
           +  Q    QA++SSK               K++S    +      L  D     +  +SC
Sbjct: 202 RDRQRKRAQARISSK------------EVMKKISNCSKIHLSTKLLAVDFPAHFMKSISC 249

Query: 506 MICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
            IC+ +L D      C HVFC++CI R        CP C
Sbjct: 250 QICEHILADPVE-TSCKHVFCRICILRCLKVMGSYCPSC 287



>gb:HSRINGG_2020012 Homo sapiens RFB30 gene for RING finger protein.
          Length = 481

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEK 625
           ++C ICQ  L +    + C H FC+ C+TR+  C + G D+E+
Sbjct: 14  VNCPICQGTLRE-PVTIDCGHNFCRACLTRY--CEIPGPDLEE 53



>gb:AL669914_1932066 Human DNA sequence from clone XXbac-250I8 on
           chromosome 6 contains a major histocompatibility
           complex, class I, J pseudogene, the gene for HCGVIII
           protein, the genes for HTEX4, 4.3 and 6, a eukaryotic
           translation termination factor 1 (ETF1) pseudogene, the
           ZNRD1 gene for zinc ribbon domain containing, 1 , the
           PPP1R11 gene for protein phosphatase 1, regulatory
           (inhibitor) subunit 11, the HZFW1 gene for HZFW1
           protein, the TRIM31 gene for tripartite motif containing
           31, the TRIM40 gene for tripartite morif-containing 40,
           the TRIM10 gene for tripartite motif containing 10, the
           5' end of the TRIM15 gene for tripartite
           motif-containing 15 and five CpG islands, complete
           sequence.>gb:AL671859_1932243 Human DNA sequence from
           clone XXbac-218N7 on chromosome 6 contains the 5' end of
           the gene for HTEX4, 4.3 and 6, a eukaryotic translation
           termination factor 1 (ETF1) pseudogene, the ZNRD1 gene
           for zinc ribbon domain containing 1, the PPP1R11 gene
           for protein phosphatase 1, regulatory (inhibitor)
           subunit 11, the HZFW1 gene for HZFW1 protein, the
           TRIM31, TRIM40 and TRIM10 genes for tripartite
           motif-containing 31,40 and 10 and four CpG islands,
           complete sequence.>gb:AL844220_1933034 Human DNA
           sequence from clone DAQB-44E15 on chromosome 6, complete
           sequence.
          Length = 395

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEK 625
           ++C ICQ  L +    + C H FC+ C+TR+  C + G D+E+
Sbjct: 14  VNCPICQGTLRE-PVTIDCGHNFCRACLTRY--CEIPGPDLEE 53



>gb:AK094385_1914156 Homo sapiens cDNA FLJ37066 fis, clone
           BRACE2015132, weakly similar to Drosophila melanogaster
           Oregon R cytoplasmic basic protein (deltex) mRNA.
          Length = 350

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 4/41 (9%)
 Frame = +2

Query: 500 SCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCG 610
           +C IC   + +      C H FC+ CITR     K CP+CG
Sbjct: 166 TCPICLGEIQNAKTLEKCRHSFCEGCITRALQVKKACPMCG 206



>gb:AF220123_1890723 Homo sapiens tripartite motif protein TRIM10
           beta (TRIM10) mRNA, complete cds; alternatively spliced.
          Length = 396

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEK 625
           ++C ICQ  L +    + C H FC+ C+TR+  C + G D+E+
Sbjct: 14  VNCPICQGTLRE-PVTIDCGHNFCRACLTRY--CEIPGPDLEE 53



>gb:AB088089_1872100 Homo sapiens RNF9, ZNFB7 genes for tripartite
           motif-containing 10, tripartite motif-containing 15,
           complete cds.>gb:AL669914_1932067 Human DNA sequence
           from clone XXbac-250I8 on chromosome 6 contains a major
           histocompatibility complex, class I, J pseudogene, the
           gene for HCGVIII protein, the genes for HTEX4, 4.3 and
           6, a eukaryotic translation termination factor 1 (ETF1)
           pseudogene, the ZNRD1 gene for zinc ribbon domain
           containing, 1 , the PPP1R11 gene for protein phosphatase
           1, regulatory (inhibitor) subunit 11, the HZFW1 gene for
           HZFW1 protein, the TRIM31 gene for tripartite motif
           containing 31, the TRIM40 gene for tripartite
           morif-containing 40, the TRIM10 gene for tripartite
           motif containing 10, the 5' end of the TRIM15 gene for
           tripartite motif-containing 15 and five CpG islands,
           complete sequence.>gb:AL671859_1932244 Human DNA
           sequence from clone XXbac-218N7 on chromosome 6 contains
           the 5' end of the gene for HTEX4, 4.3 and 6, a
           eukaryotic translation termination factor 1 (ETF1)
           pseudogene, the ZNRD1 gene for zinc ribbon domain
           containing 1, the PPP1R11 gene for protein phosphatase
           1, regulatory (inhibitor) subunit 11, the HZFW1 gene for
           HZFW1 protein, the TRIM31, TRIM40 and TRIM10 genes for
           tripartite motif-containing 31,40 and 10 and four CpG
           islands, complete sequence.>gb:AL844220_1933035 Human
           DNA sequence from clone DAQB-44E15 on chromosome 6,
           complete sequence.>gb:BA000025_1966204 Homo sapiens
           genomic DNA, chromosome 6p21.3, HLA Class I region.
          Length = 481

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEK 625
           ++C ICQ  L +    + C H FC+ C+TR+  C + G D+E+
Sbjct: 14  VNCPICQGTLRE-PVTIDCGHNFCRACLTRY--CEIPGPDLEE 53



>gb:MDU51897_1440959 Monodelphis domestica recombination-activating
           protein (RAG-1) gene, partial cds.
          Length = 1047

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 46/197 (23%), Positives = 67/197 (34%), Gaps = 5/197 (2%)
 Frame = +2

Query: 32  SSPHESPFPIGALC*NIDFPQNYSTEIQCRSHGLLIKMTPVCPFVKAARPDDASVKKPGE 211
           +SPHE  FP  A              I+   H      TP C   +AAR     +K+ G 
Sbjct: 193 NSPHEVYFPRNAT-------------IEWHPH------TPSCDICQAAR---WGLKRKGR 230

Query: 212 SQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCPFGYTQ 391
             +       K   +    A +P            S+ +P + S +  K  + C   +  
Sbjct: 231 QSNPSLSKKLKAMADRARRARLPK-----------SQAQPRKSSKDLMKKLTNCSKMH-- 277

Query: 392 EAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCK 571
                            +S KC L  D     +  +SC IC+ +L D      C H+FC+
Sbjct: 278 -----------------LSTKC-LAVDYPVDFVKAISCQICEHILTDPVETT-CKHLFCR 318

Query: 572 VCITRF-----KDCPLC 607
            CI R        CP C
Sbjct: 319 TCILRCLKVMGSYCPSC 335



>gb:AY249872_1427996 Scalopus aquaticus recombination activating
           protein 1 (RAG1) gene, partial cds.
          Length = 269

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 31/123 (25%), Positives = 45/123 (36%), Gaps = 16/123 (13%)
 Frame = +2

Query: 287 CPFVHKQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCP-- 460
           C   H  + G + K +Q + E +K   K      ++A    +  Q       M  K    
Sbjct: 37  CDICHSARQGLKRKRHQTNAELSK-KLKTVIDQARQARQRKRRAQARITSKEMMKKITNC 95

Query: 461 ---------LGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDC 598
                    L  D     +  +SC IC+ +L D      C HVFC++CI R        C
Sbjct: 96  HKIHLSTKLLAVDFPAHFVKSISCQICEHILADPVE-TSCKHVFCRICILRCLKVMGSYC 154

Query: 599 PLC 607
           P C
Sbjct: 155 PCC 157



>gb:AY449458_1327285 Oikopleura dioica clone BACOIKO002 4xj18,
           complete sequence.
          Length = 486

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 4/44 (9%)
 Frame = +2

Query: 488 LGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLC 607
           LG L C +C  + ++     PC H FC  C+ R  D    CPLC
Sbjct: 174 LGDLECPLCLRVYWNPD-VTPCGHTFCSDCLERTLDHDPKCPLC 216



>gb:AK006700_1153685 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:1700045I19
           product:similar to HSD-4 PROTEIN [Homo sapiens], full
           insert sequence.
          Length = 248

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 5/48 (10%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVC-ITRFKD----CPLCGADVEKIE 631
           C ICQ +     R   C HVFC+ C ++  K+    CPLC  +V + E
Sbjct: 19  CPICQEVFKTPVRVAACKHVFCRKCFLSAMKESRLHCPLCRGNVTRRE 66



>gb:AE014296_1136610 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003526_1214031 Drosophila melanogaster
           chromosome 3L, section 59 of 83 of the complete
           sequence.>gb:AY071030_1295115 Drosophila melanogaster
           RE11339 full length cDNA.
          Length = 222

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 4/41 (9%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLC 607
           ++C IC     D +    C H FCK C+ +     K CP C
Sbjct: 14  ITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTC 54



>gb:AE014186_938207 Plasmodium falciparum 3D7 chromosome 11 complete
           sequence.>gb:AE014839_1228941 Plasmodium falciparum 3D7
           chromosome 11 section 4 of 8 of the complete sequence.
          Length = 689

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 4/45 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLCGADV 619
           + C IC  LL      +PC H FC+ CI + K+    CPLC +++
Sbjct: 223 VECAICMKLLI-VPVTIPCGHNFCRDCIEKAKEYKNLCPLCRSNM 266



>gb:AY188989_595912 Bacillus circulans
            endo-beta-N-acetylglucosaminidase gene, complete cds.
          Length = 1936

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 26/92 (28%), Positives = 46/92 (50%), Gaps = 1/92 (1%)
 Frame = +2

Query: 167  KAARPDDASVKKPGESQSKQHGGSEKPKQESGE-PAMVPSKCPFVHKQQAGSEIKPNQES 343
            K A+P +   ++PGE   +Q G  E+P ++ GE P   P + P    +Q G +  P   +
Sbjct: 1497 KPAQPGEEPGEEPGEQPGEQPG--EQPGEQPGEQPGEQPGEQP---GEQPGEQ--PGAGN 1549

Query: 344  GEQAKVSSKCPFGYTQEAGGENKPKQVSEKPG 439
            G + +  ++   G   + G   KP+++  KPG
Sbjct: 1550 GSENQGGNEDQGGNGSQGGNGPKPEKIIVKPG 1581



>pir|JC4296|JC4296 ring finger protein - fruit fly (Drosophila
           melanogaster)
          Length = 222

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 14/41 (34%), Positives = 19/41 (46%), Gaps = 4/41 (9%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLC 607
           ++C IC     D +    C H FCK C+ +     K CP C
Sbjct: 14  ITCKICGGYFIDATTVTECLHTFCKSCLVKHLEEKKTCPTC 54



>pir|T03093|T03093 probable apoptosis inhibitor - Chilo iridescent
           virus>gb:AF303741_2231593 Chilo iridescent virus
           complete genome.
          Length = 152

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 4/45 (8%)
 Frame = +2

Query: 503 CMICQALLYDCSRCV---PCSH-VFCKVCITRFKDCPLCGADVEK 625
           C++C    Y+   C+   PC+H V CK C  R   CP+C + + K
Sbjct: 111 CVVC----YENEICIKIQPCNHFVVCKSCFNRLNTCPMCRSKINK 151



>sp|Q7YR32|TRMA_PANTR Tripartite motif protein 10 (RING finger
           protein 9) (B30-RING finger
           protein).>gb:BA000041_1966282 Pan troglodytes DNA, major
           histocompatibility complex class I region.
          Length = 481

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEK 625
           ++C ICQ  L +    + C H FC+ C+TR+  C + G D+E+
Sbjct: 14  VNCPICQGTLRE-PVTIDCGHNFCRACLTRY--CEIPGPDLEE 53



>sp|Q9UDY6|TRMA_HUMAN Tripartite motif protein 10 (RING finger
           protein 9) (B30-RING finger
           protein).>gb:AF220122_1890722 Homo sapiens tripartite
           motif protein TRIM10 alpha (TRIM10) mRNA, complete cds;
           alternatively spliced.
          Length = 482

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 16/43 (37%), Positives = 26/43 (60%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEK 625
           ++C ICQ  L +    + C H FC+ C+TR+  C + G D+E+
Sbjct: 14  VNCPICQGTLRE-PVTIDCGHNFCRACLTRY--CEIPGPDLEE 53



>sp|P29129|ICP0_PRVIF Trans-acting transcriptional protein ICP0
           (Early protein 0) (EP0).>gb:SH1EPO_2451253 Pseudorabies
           virus EPO mRNA, complete cds.
          Length = 410

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 4/48 (8%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEKI 628
           + C IC  +    ++ +PC H FC  CI R+      CPLC A V  I
Sbjct: 44  MDCPICLDVAATEAQTLPCMHKFCLDCIQRWTLTSTACPLCNARVTSI 91



>sp|Q80V91|DTX3_MOUSE Deltex protein 3 (Deltex-3) (Deltex3)
           (mDTX3).>gb:AB015425_2043825 Mus musculus mRNA for
           Deltex3, complete cds.
          Length = 347

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 4/41 (9%)
 Frame = +2

Query: 500 SCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCG 610
           +C IC   + +      C H FC+ CITR     K CP+CG
Sbjct: 163 TCPICLGEIQNAKTLEKCRHSFCEGCITRALQVKKACPMCG 203



>sp|Q8N9I9|DTX3_HUMAN Deltex protein 3 (Deltex-3)
           (Deltex3).>gb:CR857565_1181791 Pongo pygmaeus mRNA; cDNA
           DKFZp468F1823 (from clone
           DKFZp468F1823).>gb:AK092085_1913617 Homo sapiens cDNA
           FLJ34766 fis, clone NT2NE2002651, weakly similar to
           Basic protein, cytosolic.>gb:AY225126_1939720 Homo
           sapiens deltex 3 (DTX3) mRNA, complete cds.
          Length = 347

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 4/41 (9%)
 Frame = +2

Query: 500 SCMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCG 610
           +C IC   + +      C H FC+ CITR     K CP+CG
Sbjct: 163 TCPICLGEIQNAKTLEKCRHSFCEGCITRALQVKKACPMCG 203



>gb:AY662590_2542580 Phrynosoma mcallii recombination activating
           gene 1 (RAG-1) gene, partial cds.
          Length = 941

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 26/79 (32%), Positives = 35/79 (44%), Gaps = 14/79 (17%)
 Frame = +2

Query: 413 PKQVSEKPGV-MSPKCP--------LGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVF 565
           PKQV++K  V M   C         L  D     +  +SC IC+ +L D      C H+F
Sbjct: 219 PKQVNQKSLVKMIASCKKIHLTTKILAVDYPADFVKSISCQICEHILADPVETT-CKHLF 277

Query: 566 CKVCITRF-----KDCPLC 607
           C+VCI +        CP C
Sbjct: 278 CRVCILKSLKIMGSYCPAC 296



>gb:AJ719385_2501572 Gallus gallus mRNA for hypothetical protein,
           clone 1m21.
          Length = 888

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 27/99 (27%), Positives = 40/99 (40%)
 Frame = +2

Query: 137 IKMTPVCPFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVPSKCPFVHKQQAG 316
           +  TP     KA+ P   S ++   S+S        PK+  G P+   S+ P  +   A 
Sbjct: 717 VSRTPEPKKTKASTPSPRSARRVSSSRSASGSPEPAPKKHQGPPSPARSRSPSANWSPAK 776

Query: 317 SEIKPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEK 433
               P Q S   A+ S        QE GG+ K K+  +K
Sbjct: 777 KAKSPTQ-SPSPARNSD-------QEGGGKKKKKKKDKK 807



>gb:AF022391_2180250 Feline herpesvirus 1 immediate early protein,
           glycoprotein gL, and uracil DNA glycosylase genes,
           complete cds.
          Length = 498

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 4/46 (8%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSHVFCKVCITRF----KDCPLCGADVEKI 628
           C IC   + D +  +PC H FC  C++R+      CPLC   V  +
Sbjct: 8   CPICLDPMNDLTFTMPCLHKFCYSCLSRWVGLNNKCPLCKTSVTSL 53



>gb:AY294956_2081735 Cricetulus migratorius recombination activating
           gene 1 (RAG1) gene, partial cds.
          Length = 997

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 36/132 (27%), Positives = 52/132 (39%), Gaps = 5/132 (3%)
 Frame = +2

Query: 227 HGGSEKPKQESGEPAMVPSKCPFVHKQQAGSEIKPNQESGEQAKVSSKCPFGYTQEAGGE 406
           HGG ++ + +   P +  SK       QA  +    Q    QA+VSSK            
Sbjct: 180 HGGLKRKRHQ---PNVQLSKKLKTVLNQARQD---RQRKRAQARVSSK------------ 221

Query: 407 NKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITR 586
              K++S    +      L  D     +  +SC IC+ +L D      C HVFC++CI R
Sbjct: 222 EVMKKISNCSMIHLSTKLLAVDFPAHFVKSISCQICEHILADPVE-TSCKHVFCRICILR 280

Query: 587 F-----KDCPLC 607
                   CP C
Sbjct: 281 CLKVMGSYCPSC 292



>gb:AY294952_2081731 Clethrionomys gapperi recombination activating
           gene 1 (RAG1) gene, partial cds.
          Length = 1000

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 28/99 (28%), Positives = 39/99 (39%), Gaps = 5/99 (5%)
 Frame = +2

Query: 326 KPNQESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSC 505
           +  Q    QA+VSSK               K++S    +      L  D     +  +SC
Sbjct: 211 RDRQRKRAQARVSSK------------EVMKKISNCSKIHLSTKLLAVDFPAAFVKAISC 258

Query: 506 MICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
            IC+ +L D      C HVFC++CI R        CP C
Sbjct: 259 QICEHILADPVETT-CKHVFCRICILRCLKVMGSYCPSC 296



>gb:AY294936_2081715 Cricetomys gambianus recombination activating
           gene 1 (RAG1) gene, partial cds.
          Length = 998

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 28/96 (29%), Positives = 38/96 (39%), Gaps = 5/96 (5%)
 Frame = +2

Query: 335 QESGEQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMIC 514
           Q    QA+VSSK               K++S    +      L  D     +  +SC IC
Sbjct: 210 QRKRAQARVSSK------------EVMKKISNCSKIHLSTKLLAVDFPAHFVKSISCQIC 257

Query: 515 QALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           + +L D      C HVFC++CI R        CP C
Sbjct: 258 EHILADPVE-TSCKHVFCRICILRCLKVMGSYCPSC 292



>gb:AY241499_2080444 Paraxerus ochraceus RAG1 protein (RAG1) gene,
           partial cds.
          Length = 708

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 5/54 (9%)
 Frame = +2

Query: 461 LGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           L  D     +  +SC IC+ +L D      C HVFC++CI R        CP C
Sbjct: 243 LAVDFPAHLVKSISCQICEHILADPVE-TSCKHVFCRICILRCLKVMGSYCPSC 295



>gb:AY241498_2080443 Paraxerus cepapi RAG1 protein (RAG1) gene,
           partial cds.
          Length = 710

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 5/42 (11%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           +SC IC+ +L D      C HVFC++CI R        CP C
Sbjct: 257 ISCQICEHILADPVE-TSCKHVFCRICILRCLKVMGSYCPXC 297



>gb:AY155439_2076911 Mus musculus goliath-related E3 ubiquitin
           ligase 4 (Greul4) mRNA, partial cds.
          Length = 282

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 24/90 (26%), Positives = 42/90 (46%), Gaps = 7/90 (7%)
 Frame = +2

Query: 377 FGYT-QEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMIC--QALLYDCSRCV 547
           F YT  + G +N  K+  +  G + P   +    +   +   +C +C     + D  R +
Sbjct: 111 FLYTGSQFGSQNHRKETKKVIGQL-PLHTVKHGEKGIDVDAENCAVCIENFKVKDVIRIL 169

Query: 548 PCSHVFCKVCITRF----KDCPLCGADVEK 625
           PC H+F ++CI  +    + CP+C  DV K
Sbjct: 170 PCKHIFHRICIDPWLLDHRTCPMCKLDVIK 199



>gb:AY249877_1940254 Tarsius syrichta recombination activating
           protein 1 (RAG1) gene, partial cds.
          Length = 266

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 5/42 (11%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           +SC IC+ +L D      C HVFC+VCI R        CP C
Sbjct: 113 ISCQICEHILADPVE-TSCKHVFCRVCILRCLKVMGSYCPSC 153



>gb:AC105773_1738245 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1562_H01, complete sequence.
          Length = 549

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 28/98 (28%), Positives = 43/98 (43%), Gaps = 7/98 (7%)
 Frame = +2

Query: 347 EQAKVSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMIC--QA 520
           + A +SS+  F      G    PK+V E+  V   +  L   ++        C IC  + 
Sbjct: 447 QSAALSSRPSFS---SIGSVPAPKEVVERLPVKVYRRSLKHQTEE----AAQCYICLVEY 499

Query: 521 LLYDCSRCVPCSHVFCKVCITRF-----KDCPLCGADV 619
              DC R +PC+H F   C+ ++     + CPLC  DV
Sbjct: 500 AEGDCVRILPCNHEFHLTCVDKWLKEIHRVCPLCRGDV 537



>gb:MCI250998_1685755 Mucor circinelloides crgA gene for carotenoid
           regulatory protein.>gb:EVE305344_2152482 Expression
           vector pEUKA4-crgA.
          Length = 535

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 4/47 (8%)
 Frame = +2

Query: 494 PLSCMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLCGADVE 622
           P  C IC    +  +   PC HVFC+ C+ R  D    CP C   +E
Sbjct: 55  PTECPIC-CTRFTNATTTPCGHVFCRNCLVRSLDHQRSCPFCRDSLE 100



>gb:AY249885_1428005 Choloepus hoffmanni recombination activating
           protein 1 (RAG1) gene, partial cds.
          Length = 263

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 5/54 (9%)
 Frame = +2

Query: 461 LGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           L  D     +  +SC IC+ +L D      C HVFC++CI R        CP C
Sbjct: 101 LAVDLPVHLVKSISCQICEHILADPVE-TSCKHVFCRICILRCLKVVGSYCPSC 153



>gb:AY249884_1428004 Macroscelides proboscideus recombination
           activating protein 1 (RAG1) gene, partial cds.
          Length = 259

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 22/60 (36%), Positives = 29/60 (48%), Gaps = 5/60 (8%)
 Frame = +2

Query: 443 MSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           +SPK  L  D     +  +SC IC+ +L D      C HVFC++CI R        CP C
Sbjct: 97  LSPKL-LVVDYPVHFVKAISCRICEHILADPVE-TSCKHVFCRICILRCLKVMGSYCPSC 154



>gb:AY249882_1428002 Amblysomus hottentotus recombination activating
           protein 1 (RAG1) gene, partial cds.
          Length = 269

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 5/42 (11%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           +SC IC+ +L D      C HVFC+VCI R        CP C
Sbjct: 115 ISCQICEHILTDPVE-TSCKHVFCRVCILRCLKVMGNYCPSC 155



>gb:AY249881_1428001 Ochotona princeps recombination activating
           protein 1 (RAG1) gene, partial cds.
          Length = 268

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 5/42 (11%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           +SC IC+ +L D      C HVFC+VCI R        CP C
Sbjct: 114 ISCQICEHILADPVE-TSCKHVFCRVCILRCLKVMGSYCPSC 154



>gb:AY249873_1427997 Talpa europaea recombination activating protein
           1 (RAG1) gene, partial cds.
          Length = 263

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 5/42 (11%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           +SC IC+ +L D      C HVFC++CI R        CP C
Sbjct: 117 ISCQICEHILADPVE-TSCKHVFCRICILRCLKVMGSYCPCC 157



>gb:AY239194_1427668 Trichechus manatus recombination activating
           protein 1 (RAG-1) gene, partial cds.
          Length = 267

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 5/45 (11%)
 Frame = +2

Query: 488 LGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           L  +SC IC+ +L D      C HVFC++CI R        CP C
Sbjct: 110 LKSISCQICEHILADPVE-TSCKHVFCRICILRCLKVTGSYCPSC 153



>gb:AY239193_1427667 Dugong dugon recombination activating protein 1
           (RAG-1) gene, partial cds.
          Length = 266

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 5/45 (11%)
 Frame = +2

Query: 488 LGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           L  +SC IC+ +L D      C HVFC++CI R        CP C
Sbjct: 110 LKSISCQICEHILADPVE-TSCKHVFCRICILRCLKVTGSYCPSC 153



>gb:AY239189_1427663 Uncia uncia recombination activating protein 1
           (RAG-1) gene, partial cds.
          Length = 268

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 5/42 (11%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           +SC IC+ +L D      C HVFC++CI R        CP C
Sbjct: 114 ISCQICEHILADPVE-TSCKHVFCRICILRCLKVMGSYCPCC 154



>gb:AY239188_1427662 Ailurus fulgens recombination activating
           protein 1 (RAG-1) gene, partial cds.
          Length = 266

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 5/42 (11%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           +SC IC+ +L D      C HVFC++CI R        CP C
Sbjct: 113 ISCQICEHILADPVETT-CKHVFCRICILRCLKVMGSYCPCC 153



>gb:AY239179_1427653 Lagenorhynchus obscurus recombination
           activating protein 1 (RAG-1) gene, partial cds.
          Length = 298

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 20/54 (37%), Positives = 27/54 (50%), Gaps = 5/54 (9%)
 Frame = +2

Query: 461 LGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITR-FK----DCPLC 607
           L  D     +  +SC +C+ +L D      C HVFC++CI R FK     CP C
Sbjct: 121 LALDFPAHFVKSVSCQVCEHILADPVE-TSCKHVFCRICILRCFKVMGNYCPSC 173



>gb:BT001903_1356676 Drosophila melanogaster SD22693 full insert
           cDNA.
          Length = 913

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 15/47 (31%), Positives = 21/47 (44%)
 Frame = +2

Query: 494 PLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEA 634
           PL C +C  +L  C     C H FC+ C      C +C     +I+A
Sbjct: 27  PLMCPLCSDILR-CPVTTNCGHTFCRQCCETITQCNICQVRFPRIQA 72



 Score = 35.0 bits (79), Expect = 1.1
 Identities = 16/48 (33%), Positives = 21/48 (43%), Gaps = 4/48 (8%)
 Frame = +2

Query: 476 QTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLC 607
           Q        C++C   L+      PC H +C VC+ R  D    CPLC
Sbjct: 526 QLIDASDFDCVVCSRTLWK-PVVTPCGHTYCLVCLDRCMDYNSPCPLC 572



>gb:AE014296_1135210 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003557_1215448 Drosophila melanogaster
           chromosome 3L, section 28 of 83 of the complete
           sequence.
          Length = 1066

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 15/47 (31%), Positives = 21/47 (44%)
 Frame = +2

Query: 494 PLSCMICQALLYDCSRCVPCSHVFCKVCITRFKDCPLCGADVEKIEA 634
           PL C +C  +L  C     C H FC+ C      C +C     +I+A
Sbjct: 180 PLMCPLCSDILR-CPVTTNCGHTFCRQCCETITQCNICQVRFPRIQA 225



 Score = 35.0 bits (79), Expect = 1.1
 Identities = 16/48 (33%), Positives = 21/48 (43%), Gaps = 4/48 (8%)
 Frame = +2

Query: 476 QTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRFKD----CPLC 607
           Q        C++C   L+      PC H +C VC+ R  D    CPLC
Sbjct: 679 QLIDASDFDCVVCSRTLWK-PVVTPCGHTYCLVCLDRCMDYNSPCPLC 725



>pir|T39456|T39456 zinc finger protein - fission yeast
           (Schizosaccharomyces pombe)>gb:SPBC14F5_1719004 S.pombe
           chromosome II cosmid c14F5.
          Length = 486

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 4/41 (9%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVC----ITRFKDCPLC 607
           L C IC  +LYD     PC H FC  C    +T+   CP C
Sbjct: 167 LECQICFGMLYD-PVVSPCGHTFCGPCLMQALTQSPQCPTC 206



>sp|Q9PU36|PCLO_CHICK Piccolo protein (Aczonin)
           (Fragment).>gb:GGY19187_2573869 Gallus gallus mRNA for
           partial aczonin, XL spliced variant (acz gene).
          Length = 5120

 Score = 35.8 bits (81), Expect = 0.62
 Identities = 27/107 (25%), Positives = 44/107 (41%), Gaps = 9/107 (8%)
 Frame = +2

Query: 158 PFVKAARPDDASVKKPGESQSKQHGGSEKPKQESGEPAMVP-SKCPFVHKQQAGSEIKPN 334
           P  K +     SVK+P +  ++Q G  +   Q++G P   P S+ P    QQ G   +P 
Sbjct: 233 PPTKPSLQQSGSVKQPSQQPARQGGPVKPSAQQAGPPKQQPGSEKPTA--QQTGPAKQPP 290

Query: 335 QESGEQAKVSSKCPFGYTQEAGGENKP--------KQVSEKPGVMSP 451
           Q    +  +    P        G  KP        K ++++PG+  P
Sbjct: 291 QPGPGKTPLQQTGPVKQVPPQAGPTKPSSQTAGAAKSLAQQPGLTKP 337



>gb:BC072221_2556479 Xenopus laevis hypothetical protein MGC81405,
           mRNA (cDNA clone MGC:81405 IMAGE:6635047), complete cds.
          Length = 738

 Score = 35.4 bits (80), Expect = 0.81
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 6/48 (12%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITR-FK-----DCPLCGADVE 622
           L C +C   L   ++ +PC H FC+ C+ R FK      CP C   V+
Sbjct: 10  LDCPLCHGKLDVTAKVLPCQHTFCQPCLQRIFKARKELKCPECRTPVQ 57



>gb:AY461402_2533751 Herpetotheres cachinnans recombination
           activating protein 1 gene, partial cds.
          Length = 945

 Score = 35.4 bits (80), Expect = 0.81
 Identities = 28/120 (23%), Positives = 47/120 (39%), Gaps = 13/120 (10%)
 Frame = +2

Query: 287 CPFVHKQQAGSEIK---PNQESGEQAKVSSKCP-----FGYTQEAGGENKPKQVSEKPGV 442
           C   H  + G + K   P+ + G++ K  ++C           +   +N  K++     V
Sbjct: 177 CDVCHSTKQGVKRKSQPPSAQHGKRMKTIAECARINRAVKNQAQINNKNLMKEIVSCKNV 236

Query: 443 MSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
                 L  D     +  +SC IC+ +L D      C H+FC+ CI +        CP C
Sbjct: 237 HLSTKLLAVDYPVDFIKSISCQICEHILADPVETT-CRHLFCRTCILKCIKVMGSYCPSC 295



>gb:AY442926_2532647 Lepidosiren paradoxa RAG1 (Rag1) gene, partial
           cds.
          Length = 826

 Score = 35.4 bits (80), Expect = 0.81
 Identities = 29/101 (28%), Positives = 44/101 (43%), Gaps = 6/101 (5%)
 Frame = +2

Query: 323 IKPNQESGEQAK-VSSKCPFGYTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPL 499
           +K  + + E AK + SK          G N  K ++    +      L F+     +  +
Sbjct: 99  VKKFKVTNEHAKNMRSKNAKSKNNIRDGANVMKNITNCRHLHLSTKQLAFEYPADFVKSV 158

Query: 500 SCMICQALLYDCSRCVPCSHVFCKVCITR-FKD----CPLC 607
           SC +C+ LL D  +   C H+FC+ CI R FK     CP C
Sbjct: 159 SCQVCEHLLADPVQTT-CKHLFCRTCILRCFKAFGHYCPSC 198



>gb:AY057000_2510138 Lanius ludovicianus recombination activating
           protein 1 (RAG-1) gene, partial cds.
          Length = 957

 Score = 35.4 bits (80), Expect = 0.81
 Identities = 30/121 (24%), Positives = 49/121 (40%), Gaps = 13/121 (10%)
 Frame = +2

Query: 287 CPFVHKQQAGSEIK---PNQESGEQAKVSSKCPF---GYTQEAGGENKP--KQVSEKPGV 442
           C   H  + G + K   P+ + G++ K + +  +   G   +A   NK   K++     +
Sbjct: 177 CDVCHTTRRGVKRKXQPPSVQRGKRVKTTGERAWLNRGVXNQAQKNNKNIMKEIVNCKDI 236

Query: 443 MSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
                 L  D     +  +SC IC  +L D      C H+FC+ CI +        CP C
Sbjct: 237 HLSTKLLAVDYPVDFIKSISCQICDHILADPVETT-CRHLFCRTCILKCIRVMGSYCPSC 295

Query: 608 G 610
           G
Sbjct: 296 G 296



>gb:AY056978_2510116 Alauda arvensis recombination activating
           protein 1 (RAG-1) gene, partial cds.
          Length = 957

 Score = 35.4 bits (80), Expect = 0.81
 Identities = 30/120 (25%), Positives = 48/120 (40%), Gaps = 13/120 (10%)
 Frame = +2

Query: 287 CPFVHKQQAGSEIK---PNQESGEQAKVSSKCPF---GYTQEAGGENKP--KQVSEKPGV 442
           C   H  + G + K   P+ + G++ K + +C     G   +A   NK   K++     +
Sbjct: 177 CDVCHATRRGVKRKNQPPSVQRGKRVKTTGECARLNRGVKNQAQINNKNLMKEIVNCKDI 236

Query: 443 MSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
                 L  D     +  +SC IC  +L D      C H+FC+ CI +        CP C
Sbjct: 237 HLSTKLLAIDYPVDFIKSISCQICDHILADPVETT-CRHLFCRTCILKCIRVMGSYCPSC 295



>gb:AJ719505_2501692 Gallus gallus mRNA for hypothetical protein,
           clone 2o16.
          Length = 238

 Score = 35.4 bits (80), Expect = 0.81
 Identities = 14/28 (50%), Positives = 19/28 (67%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCI 580
           L+C IC +L  D  R +PCSH FC+ C+
Sbjct: 8   LTCSICYSLFED-PRVLPCSHTFCRSCL 34



>gb:AJ719450_2501637 Gallus gallus mRNA for hypothetical protein,
           clone 2h17.
          Length = 408

 Score = 35.4 bits (80), Expect = 0.81
 Identities = 14/28 (50%), Positives = 19/28 (67%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCI 580
           L+C IC +L  D  R +PCSH FC+ C+
Sbjct: 8   LTCSICYSLFED-PRVLPCSHTFCRSCL 34



>gb:AF329945_2487929 Takifugu rubripes SUN-like 1 (SUNL1), chromosome
            17 open reading frame 27 (C17orf27), transcription factor
            SOX9 (SOX9), and somatostatin receptor 2 (SSTR2) genes,
            complete cds; and ubiquitin-specific-protease-3-like
            protein (USP3L) gene, partial cds.
          Length = 4283

 Score = 35.4 bits (80), Expect = 0.81
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 5/51 (9%)
 Frame = +2

Query: 482  FKLGPLSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLCGADV 619
            F+ G   C IC     D   C+PC H++C+ C+ ++       CPLC   V
Sbjct: 3075 FRFGSGLCSICIGDPQD-PLCLPCDHIYCQACLKQWLCPGQMFCPLCTQQV 3124



>gb:FSU22375_2403462 Feldmannia sp. virus Orf1, Orf2, and Orf3
           genes, complete cds.
          Length = 673

 Score = 35.4 bits (80), Expect = 0.81
 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 7/46 (15%)
 Frame = +2

Query: 503 CMIC-QALLYDCSRCV--PCSHVFCKVCITRF----KDCPLCGADV 619
           C +C Q    D   C+  PC HVFCK C T +     +CPLC  D+
Sbjct: 441 CPVCLQHFAPDKEVCIVGPCWHVFCKDCSTSWLQQGANCPLCRCDI 486



>gb:AY509253_2354441 Ostreid herpesvirus 1, complete genome.
          Length = 465

 Score = 35.4 bits (80), Expect = 0.81
 Identities = 27/91 (29%), Positives = 39/91 (42%), Gaps = 8/91 (8%)
 Frame = +2

Query: 383 YTQEAGGENKPKQVSEKPGVMSPKCPLGFDSQTFKLGPLSCMICQALLYDCSRCVPCSHV 562
           Y  + GGE+K +       +  PK     ++   K G  SC  C     D +  +PC HV
Sbjct: 369 YIDDEGGEDKEEDGGGGGVIEFPKNNKEVENP--KRG--SCKACYERKADIA-FIPCGHV 423

Query: 563 F-CKVCITRF-------KDCPLCGADVEKIE 631
           F C +C           K CP+C   VEK++
Sbjct: 424 FSCNICTMEMFASYKKKKRCPMCRVHVEKVQ 454



>gb:AF539999_2273354 Mamestra configurata nucleopolyhedrovirus A
           90/4, complete genome.>gb:MBU59461_2441944 Mamestra
           configurata nucleopolyhedrovirus strain 90/2, complete
           genome.
          Length = 252

 Score = 35.4 bits (80), Expect = 0.81
 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 1/42 (2%)
 Frame = +2

Query: 503 CMICQALLYDCSRCVPCSH-VFCKVCITRFKDCPLCGADVEK 625
           C IC  L  D    +PC+H V C VC  R KDC +C A +++
Sbjct: 205 CKICMDLPRDTC-FLPCAHLVTCSVCAKRCKDCCVCRAKIKE 245



>gb:AY294961_2081740 Rhipidomys mastacalis recombination activating
           gene 1 (RAG1) gene, partial cds.
          Length = 1008

 Score = 35.4 bits (80), Expect = 0.81
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 5/42 (11%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           +SC IC+ +L D      C HVFC++CI R        CP C
Sbjct: 264 ISCQICEHILADPVE-TSCKHVFCRICILRCLKVMGSYCPSC 304



>gb:AY294960_2081739 Akodon boliviensis recombination activating
           gene 1 (RAG1) gene, partial cds.
          Length = 558

 Score = 35.4 bits (80), Expect = 0.81
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 5/42 (11%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           +SC IC+ +L D      C HVFC++CI R        CP C
Sbjct: 262 ISCQICEHILADPVE-TSCKHVFCRICILRCLKVMGSYCPSC 302



>gb:AY294958_2081737 Reithrodontomys fulvescens recombination
           activating gene 1 (RAG1) gene, partial cds.
          Length = 997

 Score = 35.4 bits (80), Expect = 0.81
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 5/42 (11%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           +SC IC+ +L D      C HVFC++CI R        CP C
Sbjct: 260 ISCQICEHILADPVE-TSCKHVFCRICILRCLKVMGSYCPSC 300



>gb:AY294955_2081734 Mesocricetus auratus recombination activating
           gene 1 (RAG1) gene, partial cds.
          Length = 1002

 Score = 35.4 bits (80), Expect = 0.81
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 5/42 (11%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           +SC IC+ +L D      C HVFC++CI R        CP C
Sbjct: 257 ISCQICEHILADPVE-TSCKHVFCRICILRCLKVMGSYCPSC 297



>gb:AY294953_2081732 Ondatra zibethicus recombination activating
           gene 1 (RAG1) gene, partial cds.
          Length = 992

 Score = 35.4 bits (80), Expect = 0.81
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 5/42 (11%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           +SC IC+ +L D      C HVFC++CI R        CP C
Sbjct: 248 ISCQICEHILADPVETT-CKHVFCRICILRCLKVMGSYCPSC 288



>gb:AY241497_2080442 Funisciurus carruthersi RAG1 protein (RAG1)
           gene, partial cds.
          Length = 711

 Score = 35.4 bits (80), Expect = 0.81
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 5/42 (11%)
 Frame = +2

Query: 497 LSCMICQALLYDCSRCVPCSHVFCKVCITRF-----KDCPLC 607
           +SC IC+ +L D      C HVFC++CI R        CP C
Sbjct: 258 ISCQICEHILADPVE-TSCKHVFCRICILRCLKVMGSYCPSC 298


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 672,863,067
Number of Sequences: 1806583
Number of extensions: 14294833
Number of successful extensions: 40077
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 37465
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 39800
length of database: 581,917,975
effective HSP length: 119
effective length of database: 366,934,598
effective search space used: 33757983016
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)