BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig5097
         (288 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AF506028_1806850 Poncirus trifoliata citrus tristeza virus re...    86   2e-16   
gb:AP004013_1836370 Oryza sativa (japonica cultivar-group) genom...    81   7e-15   
gb:OSJN00038_1693703 Oryza sativa genomic DNA, chromosome 4, BAC...    77   8e-14   
pir|C96837|C96837 nodulin-like protein, 38383-40406 [imported] -...    74   7e-13   Arabidopsis thaliana [mouse-ear cress]
gb:AP003019_1824209 Oryza sativa (japonica cultivar-group) genom...    64   7e-10   
gb:AP006067_1860847 Oryza sativa (japonica cultivar-group) genom...    48   5e-05   
gb:BT020278_1642673 Arabidopsis thaliana At5g45275 mRNA, complet...    43   0.002   
gb:BT006158_1639052 Arabidopsis thaliana clone RAFL19-54-D12 (R5...    43   0.002   
gb:BT000872_1635127 Arabidopsis thaliana clone C104966 unknown p...    43   0.002   
gb:AY084219_1569312 Arabidopsis thaliana clone 100165 mRNA, comp...    43   0.002   
pir|B96777|B96777 hypothetical protein F25A4.25 [imported] - Ara...    43   0.002   Arabidopsis thaliana [mouse-ear cress]
gb:AE005172_890853 Arabidopsis thaliana chromosome 1, top arm co...    42   0.004   
gb:AC144743_1744245 Oryza sativa (japonica cultivar-group) chrom...    42   0.005   
pir|G86440|G86440 hypothetical protein T8E3.15 - Arabidopsis tha...    42   0.005   Arabidopsis thaliana [mouse-ear cress]
gb:BT012649_1641719 Arabidopsis thaliana At4g34950 mRNA, complet...    40   0.014   
gb:ATM4E13_1553635 Arabidopsis thaliana DNA chromosome 4, BAC cl...    40   0.014   
pir|T10241|T10241 hypothetical protein T11I11.190 - Arabidopsis ...    40   0.014   Arabidopsis thaliana [mouse-ear cress]
pir|F84542|F84542 nodulin-like protein [imported] - Arabidopsis ...    40   0.018   Arabidopsis thaliana [mouse-ear cress]
pir|T02323|T02323 nodulin-like protein [imported] - Arabidopsis ...    38   0.054   Arabidopsis thaliana [mouse-ear cress]
gb:AP003230_1825769 Oryza sativa (japonica cultivar-group) genom...    38   0.070   
gb:AP003230_1825768 Oryza sativa (japonica cultivar-group) genom...    38   0.070   
pir|G84706|G84706 hypothetical protein At2g30300 [imported] - Ar...    38   0.070   Arabidopsis thaliana [mouse-ear cress]
gb:AC087412_1734033 Oryza sativa chromosome 3 BAC OSJNBb0070O09 ...    37   0.16    
gb:AP005529_1853561 Oryza sativa (japonica cultivar-group) genom...    35   0.35    
gb:AF031243_1762535 Lotus japonicus nodule-specific protein Nlj7...    33   2.3     
gb:CR380959_1654191 Candida glabrata strain CBS138 chromosome M ...    32   2.9     
gb:AE013598_296610 Xanthomonas oryzae pv. oryzae KACC10331, comp...    32   5.0     
gb:AC104321_1737542 Oryza sativa chromosome 3 BAC OSJNBa0052F07 ...    31   6.6     
sp|Q9H1B4|NXF5_HUMAN|NXF5_HUMAN Nuclear RNA export factor 5 (TAP-like prote...    31   6.6     Homo sapiens [man]
gb:AP005179_1848877 Oryza sativa (japonica cultivar-group) genom...    31   8.6     


>gb:AF506028_1806850 Poncirus trifoliata citrus tristeza virus
           resistance gene locus, complete sequence.
          Length = 564

 Score = 86.3 bits (212), Expect = 2e-16
 Identities = 38/53 (71%), Positives = 47/53 (88%)
 Frame = +3

Query: 129 RMVNLKGGTRPPWVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQLTML 287
           R + LK G+RPPWVGL A+VW++IAAGNAYNFPLYS  LKSV+G++QQQLT+L
Sbjct: 2   RNIALKAGSRPPWVGLAAAVWVEIAAGNAYNFPLYSPALKSVMGYNQQQLTIL 54



>gb:AP004013_1836370 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1575_B01.>gb:AP004155_1838307 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1112_D12.
          Length = 569

 Score = 80.9 bits (198), Expect = 7e-15
 Identities = 35/51 (68%), Positives = 43/51 (84%)
 Frame = +3

Query: 135 VNLKGGTRPPWVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQLTML 287
           V LK GTRPPWVGL A+VW+Q+AAGNAY FPLYS  +K+ LG++QQQL +L
Sbjct: 8   VRLKAGTRPPWVGLAAAVWVQMAAGNAYTFPLYSPAIKAALGYTQQQLAVL 58



>gb:OSJN00038_1693703 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0014K14, complete sequence.
          Length = 582

 Score = 77.4 bits (189), Expect = 8e-14
 Identities = 32/49 (65%), Positives = 42/49 (85%)
 Frame = +3

Query: 141 LKGGTRPPWVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQLTML 287
           +K G+RPPWVGL A+VW+Q+AAG+AY FPLYSH +K  LG++Q+ LTML
Sbjct: 15  VKAGSRPPWVGLAAAVWVQVAAGSAYVFPLYSHAIKEALGYNQKALTML 63



>pir|C96837|C96837 nodulin-like protein, 38383-40406 [imported] -
           Arabidopsis thaliana>gb:AE005173_895565 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC018849_1538424 Arabidopsis thaliana
           chromosome 1 BAC T21F11 genomic sequence, complete
           sequence.>gb:AY035113_1559884 Arabidopsis thaliana
           putative nodulin protein (At1g80530) mRNA, complete
           cds.>gb:AY056342_1563652 Arabidopsis thaliana putative
           nodulin protein (At1g80530) mRNA, complete cds.
          Length = 561

 Score = 74.3 bits (181), Expect = 7e-13
 Identities = 32/48 (66%), Positives = 40/48 (83%)
 Frame = +3

Query: 144 KGGTRPPWVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQLTML 287
           K G+RPPWVGL A+ W+Q++AG+   FPLYS  LKSVLGFSQQQ+T+L
Sbjct: 7   KSGSRPPWVGLAAAAWVQVSAGSGSTFPLYSSALKSVLGFSQQQVTIL 54



>gb:AP003019_1824209 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OSJNBa0035I03.
          Length = 567

 Score = 64.3 bits (155), Expect = 7e-10
 Identities = 28/51 (54%), Positives = 37/51 (72%)
 Frame = +3

Query: 135 VNLKGGTRPPWVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQLTML 287
           V +K G+RPPWVGLGA+VW+Q+A G +  F LYSH LK  L   Q++L +L
Sbjct: 5   VAVKAGSRPPWVGLGAAVWVQVAGGASSTFALYSHALKVALAADQRRLALL 55



>gb:AP006067_1860847 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC
           clone:P0569E11.>gb:AP006174_1861358 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, PAC
           clone:P0229B10.
          Length = 552

 Score = 48.1 bits (113), Expect = 5e-05
 Identities = 23/56 (41%), Positives = 36/56 (64%), Gaps = 1/56 (1%)
 Frame = +3

Query: 123 VSRMVNLKGGTR-PPWVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQLTML 287
           V+  ++   GTR   W+GL  +VW+Q  +GN Y F  YSH++K+++G +Q QL  L
Sbjct: 2   VAAALDAMAGTRWGRWLGLVTAVWVQCISGNNYTFSNYSHSIKTLMGLTQLQLNGL 57



>gb:BT020278_1642673 Arabidopsis thaliana At5g45275 mRNA, complete
           cds.>gb:BT020457_1642851 Arabidopsis thaliana At5g45275
           mRNA, complete cds.
          Length = 570

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 21/46 (45%), Positives = 27/46 (58%)
 Frame = +3

Query: 150 GTRPPWVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQLTML 287
           G    W+ L A++W+Q   G  ++F  YS  LKSVLG SQ QL  L
Sbjct: 3   GQSRKWMILVATIWIQAFTGTNFDFSTYSSNLKSVLGISQVQLNYL 48



>gb:BT006158_1639052 Arabidopsis thaliana clone RAFL19-54-D12
           (R50668) unknown protein (At1g74780) mRNA, complete cds.
          Length = 533

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 18/41 (43%), Positives = 25/41 (60%)
 Frame = +3

Query: 156 RPPWVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQL 278
           R  WV + AS+W+Q A+G +Y F +YS  LKS   + Q  L
Sbjct: 5   RTKWVAMTASIWIQCASGASYTFGIYSAVLKSTQSYDQSTL 45



>gb:BT000872_1635127 Arabidopsis thaliana clone C104966 unknown
           protein (At4g19450) mRNA, complete cds.
          Length = 572

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 21/46 (45%), Positives = 27/46 (58%)
 Frame = +3

Query: 150 GTRPPWVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQLTML 287
           G    W+ L A++W+Q   G  ++F  YS  LKSVLG SQ QL  L
Sbjct: 3   GQSRKWMILVATIWIQAFTGTNFDFSAYSSDLKSVLGISQVQLNYL 48



>gb:AY084219_1569312 Arabidopsis thaliana clone 100165 mRNA,
           complete sequence.
          Length = 572

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 21/46 (45%), Positives = 27/46 (58%)
 Frame = +3

Query: 150 GTRPPWVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQLTML 287
           G    W+ L A++W+Q   G  ++F  YS  LKSVLG SQ QL  L
Sbjct: 3   GQSRKWMILVATIWIQAFTGTNFDFSAYSSDLKSVLGISQVQLNYL 48



>pir|B96777|B96777 hypothetical protein F25A4.25 [imported] -
           Arabidopsis thaliana>gb:AE005173_895020 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:F25A4_1678035 Arabidopsis thaliana
           chromosome 1 BAC F25A4 sequence, complete sequence.
          Length = 533

 Score = 42.7 bits (99), Expect = 0.002
 Identities = 18/41 (43%), Positives = 25/41 (60%)
 Frame = +3

Query: 156 RPPWVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQL 278
           R  WV + AS+W+Q A+G +Y F +YS  LKS   + Q  L
Sbjct: 5   RTKWVAMTASIWIQCASGASYTFGIYSAVLKSTQSYDQSTL 45



>gb:AE005172_890853 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC068602_1540382 Genomic sequence
           for Arabidopsis thaliana BAC F14D16 from chromosome I,
           complete sequence.
          Length = 526

 Score = 42.0 bits (97), Expect = 0.004
 Identities = 17/41 (41%), Positives = 25/41 (60%)
 Frame = +3

Query: 156 RPPWVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQL 278
           R  W+ + AS+W+Q +AG +Y F +YS  LKS   + Q  L
Sbjct: 7   RTKWMAMTASIWIQCSAGGSYTFGIYSAILKSTQSYDQSTL 47



>gb:AC144743_1744245 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0009H09, complete sequence.
          Length = 561

 Score = 41.6 bits (96), Expect = 0.005
 Identities = 20/41 (48%), Positives = 24/41 (58%)
 Frame = +3

Query: 165 WVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQLTML 287
           W+ L  SVW+Q   G   +FP+YS  LK V G SQ QL  L
Sbjct: 9   WLSLVGSVWLQTINGPNADFPVYSSQLKEVKGISQVQLNFL 49



>pir|G86440|G86440 hypothetical protein T8E3.15 - Arabidopsis
           thaliana>gb:AE005172_892012 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC027135_1539884 Arabidopsis thaliana
           chromosome 1 BAC T8E3 genomic sequence, complete
           sequence.
          Length = 546

 Score = 41.6 bits (96), Expect = 0.005
 Identities = 19/41 (46%), Positives = 26/41 (63%)
 Frame = +3

Query: 165 WVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQLTML 287
           W  L A++W+Q + G  ++F  YS  LKSVLG SQ +L  L
Sbjct: 8   WTVLVAAIWIQASTGTNFDFSAYSSHLKSVLGISQVRLNYL 48



>gb:BT012649_1641719 Arabidopsis thaliana At4g34950 mRNA, complete
           cds.
          Length = 411

 Score = 40.0 bits (92), Expect = 0.014
 Identities = 17/41 (41%), Positives = 25/41 (60%)
 Frame = +3

Query: 165 WVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQLTML 287
           W+G   +VW+Q  +GN Y F  YS  LKS++  +Q +L  L
Sbjct: 17  WLGFVTAVWVQSISGNNYTFSNYSGALKSLMNLTQLELNSL 57



>gb:ATM4E13_1553635 Arabidopsis thaliana DNA chromosome 4, BAC clone
           M4E13 (ESSAII project).
          Length = 164

 Score = 40.0 bits (92), Expect = 0.014
 Identities = 17/41 (41%), Positives = 25/41 (60%)
 Frame = +3

Query: 165 WVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQLTML 287
           W+G   +VW+Q  +GN Y F  YS  LKS++  +Q +L  L
Sbjct: 17  WLGFVTAVWVQSISGNNYTFSNYSGALKSLMNLTQLELNSL 57



>pir|T10241|T10241 hypothetical protein T11I11.190 - Arabidopsis
           thaliana>gb:ATCHRIV82_1547456 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           82.>gb:ATF11I11_1548289 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F11I11 (ESSA project).
          Length = 567

 Score = 40.0 bits (92), Expect = 0.014
 Identities = 17/41 (41%), Positives = 25/41 (60%)
 Frame = +3

Query: 165 WVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQLTML 287
           W+G   +VW+Q  +GN Y F  YS  LKS++  +Q +L  L
Sbjct: 17  WLGFVTAVWVQSISGNNYTFSNYSGALKSLMNLTQLELNSL 57



>pir|F84542|F84542 nodulin-like protein [imported] - Arabidopsis
           thaliana>gb:AC005825_1533067 Arabidopsis thaliana
           chromosome 2 clone T24I21 map mi398, complete
           sequence.>gb:AY070369_1566773 Arabidopsis thaliana
           putative nodulin protein (At2g16660) mRNA, complete
           cds.>gb:AY095988_1575863 Arabidopsis thaliana
           At2g16660/T24I21.7 mRNA, complete
           cds.>gb:BT000835_1635090 Arabidopsis thaliana
           nodulin-like protein (At2g16660/T24I21.7) mRNA, complete
           cds.
          Length = 546

 Score = 39.7 bits (91), Expect = 0.018
 Identities = 17/41 (41%), Positives = 25/41 (60%)
 Frame = +3

Query: 165 WVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQLTML 287
           W+G   +VW+Q  +GN Y F  YS  LKS++  +Q +L  L
Sbjct: 15  WLGFVTAVWVQSISGNNYTFSNYSGALKSLMNLNQLELNNL 55



>pir|T02323|T02323 nodulin-like protein [imported] - Arabidopsis
           thaliana>gb:AC004481_1531736 Arabidopsis thaliana
           chromosome 2 clone F13P17 map ve016, complete sequence.
          Length = 2301

 Score = 38.1 bits (87), Expect = 0.054
 Identities = 16/38 (42%), Positives = 22/38 (57%)
 Frame = +3

Query: 165 WVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQL 278
           WV   AS+W+Q  +G +Y F +YS  LKS   + Q  L
Sbjct: 8   WVAAAASIWIQSFSGASYTFGIYSSVLKSSQSYDQSTL 45



 Score = 37.7 bits (86), Expect = 0.070
 Identities = 16/38 (42%), Positives = 21/38 (55%)
 Frame = +3

Query: 165 WVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQL 278
           WV   AS+W+Q  +G  Y F +YS  LKS   + Q  L
Sbjct: 624 WVAAAASIWIQSFSGATYTFAIYSSILKSSQSYDQSTL 661



>gb:AP003230_1825769 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0031D02.>gb:AP003315_1827898 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0439E11.
          Length = 385

 Score = 37.7 bits (86), Expect = 0.070
 Identities = 17/41 (41%), Positives = 23/41 (56%)
 Frame = +3

Query: 165 WVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQLTML 287
           W+ L  S+W+Q   G   +FP+YS  LK +   SQ QL  L
Sbjct: 9   WLSLVGSIWLQTINGPNSDFPVYSSQLKELKSISQVQLNFL 49



>gb:AP003230_1825768 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0031D02.>gb:AP003315_1827897 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0439E11.
          Length = 540

 Score = 37.7 bits (86), Expect = 0.070
 Identities = 17/41 (41%), Positives = 23/41 (56%)
 Frame = +3

Query: 165 WVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQLTML 287
           W+ L  S+W+Q   G   +FP+YS  LK +   SQ QL  L
Sbjct: 9   WLSLVGSIWLQTINGPNSDFPVYSSQLKELKSISQVQLNFL 49



>pir|G84706|G84706 hypothetical protein At2g30300 [imported] -
           Arabidopsis thaliana>gb:AC002338_1530486 Arabidopsis
           thaliana chromosome 2 clone T9D9 map m283, complete
           sequence.
          Length = 500

 Score = 37.7 bits (86), Expect = 0.070
 Identities = 18/42 (42%), Positives = 24/42 (57%)
 Frame = +3

Query: 162 PWVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQLTML 287
           PW+ L A +W+Q   G   +FP YS  LK +L  SQ +L  L
Sbjct: 7   PWLSLVAILWLQSFNGTNLSFPAYSSQLKELLKISQFKLNYL 48



>gb:AC087412_1734033 Oryza sativa chromosome 3 BAC OSJNBb0070O09
           genomic sequence, complete sequence.
          Length = 606

 Score = 36.6 bits (83), Expect = 0.16
 Identities = 18/44 (40%), Positives = 24/44 (54%)
 Frame = +3

Query: 156 RPPWVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQLTML 287
           R  W    AS+ +  AAG  Y F +YS  +K+ LG+ QQ L  L
Sbjct: 26  RGRWFMFFASILIMAAAGGTYIFGIYSKAIKTSLGYDQQTLNTL 69



>gb:AP005529_1853561 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0702E04.
          Length = 595

 Score = 35.4 bits (80), Expect = 0.35
 Identities = 17/49 (34%), Positives = 29/49 (59%)
 Frame = +3

Query: 141 LKGGTRPPWVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQLTML 287
           ++G  R  W+   A++WMQ  AG  Y F   S  +K+ LG++Q+++  L
Sbjct: 8   VRGFVRNRWLVFVAAMWMQSFAGVGYLFGSISPVIKASLGYNQREVAGL 56



>gb:AF031243_1762535 Lotus japonicus nodule-specific protein Nlj70
           mRNA, complete cds.
          Length = 575

 Score = 32.7 bits (73), Expect = 2.3
 Identities = 15/41 (36%), Positives = 22/41 (53%)
 Frame = +3

Query: 165 WVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQLTML 287
           W  + AS  +   +G +Y F LYS  +K  LG+ Q  L +L
Sbjct: 27  WFMMLASFMIMAVSGASYMFSLYSREIKFALGYDQSTLNLL 67



>gb:CR380959_1654191 Candida glabrata strain CBS138 chromosome M
           complete sequence.
          Length = 444

 Score = 32.3 bits (72), Expect = 2.9
 Identities = 19/42 (45%), Positives = 26/42 (61%)
 Frame = +3

Query: 24  LLSSILPPSLQNQIRSKPTLSSAIP*FLRAKQRVSRMVNLKG 149
           L+ SI+PPSL  Q++  P +SS +P F   K   S +V LKG
Sbjct: 22  LVGSIVPPSLVLQVKMLPPMSSMVPPFQLIK---SCVVTLKG 60



>gb:AE013598_296610 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 501

 Score = 31.6 bits (70), Expect = 5.0
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 2/62 (3%)
 Frame = +3

Query: 108 RAKQRVSRMVNLKGGTRPP--WVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQLT 281
           R K + S ++N   G   P  W+G+G +V+ Q+   N   +  Y   L   +GFS+Q   
Sbjct: 277 RHKPKFSDLINQATGKIRPIVWIGIGLAVFQQLVGINVVFY--YGAVLWQAVGFSEQDAL 334

Query: 282 ML 287
           ++
Sbjct: 335 LI 336



>gb:AC104321_1737542 Oryza sativa chromosome 3 BAC OSJNBa0052F07
           genomic sequence, complete sequence.
          Length = 628

 Score = 31.2 bits (69), Expect = 6.6
 Identities = 16/41 (39%), Positives = 23/41 (56%)
 Frame = +3

Query: 165 WVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQLTML 287
           W  + A + +  A+G  Y F +YS  LKS LG+ Q+ L  L
Sbjct: 36  WFMVFACLLILSASGATYIFGIYSKVLKSSLGYDQRTLNTL 76



>sp|Q9H1B4|NXF5_HUMAN Nuclear RNA export factor 5 (TAP-like protein
           1) (TAPL-1).>gb:AL672207_1932315 Human DNA sequence from
           clone RP1-232L22 on chromosome X Contains the 3' end of
           the NXF5 gene for nuclear RNA export factor 5 and a
           glycerol kinase (GK) pseudogene, complete
           sequence.>gb:HSA277654_2002231 Homo sapiens mRNA for
           nuclear RNA export factor 5, isoform a (NXF5 gene).
          Length = 397

 Score = 31.2 bits (69), Expect = 6.6
 Identities = 15/43 (34%), Positives = 26/43 (60%)
 Frame = -2

Query: 269 LTETQN*FQSVGIEWEIVSISCCYLHPN*GPKTHPWWPCPSLQ 141
           L ETQ+ F S+ ++    +++ C+L P  GP++  WW   SL+
Sbjct: 328 LPETQHDFTSILVDMWYQTVNTCFL-PRAGPESQRWWCLLSLK 369



>gb:AP005179_1848877 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OSJNBb0084L07.>gb:AP005877_1859501 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OSJNBb0002L09.
          Length = 624

 Score = 30.8 bits (68), Expect = 8.6
 Identities = 15/38 (39%), Positives = 22/38 (57%)
 Frame = +3

Query: 165 WVGLGASVWMQIAAGNAYNFPLYSHTLKSVLGFSQQQL 278
           W  + AS+ +  A+G  Y F +YS  LK+ LG+ Q  L
Sbjct: 45  WFTVFASLLILTASGATYIFGIYSPALKASLGYDQHTL 82


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 349,978,604
Number of Sequences: 1806583
Number of extensions: 7010894
Number of successful extensions: 17184
Number of sequences better than 10.0: 30
Number of HSP's better than 10.0 without gapping: 16886
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17182
length of database: 581,917,975
effective HSP length: 64
effective length of database: 466,296,663
effective search space used: 14455196553
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)