BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig5061
         (653 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB028617_1518019 Arabidopsis thaliana genomic DNA, chromosome...    42   0.007   
gb:BX571857_784753 Staphylococcus aureus strain MSSA476, complet...    39   0.059   
gb:BA000033_712843 Staphylococcus aureus subsp. aureus MW2 DNA, ...    39   0.059   
gb:AY510087_623856 Staphylococcus capitis serine-aspartate repea...    38   0.13    
gb:AF245043_492220 Staphylococcus epidermidis SdrH (sdrH) gene, ...    38   0.13    
gb:AE016749_323282 Staphylococcus epidermidis ATCC 12228, sectio...    38   0.13    
gb:CP000029_82081 Staphylococcus epidermidis RP62A, complete gen...    38   0.13    
gb:AY048595_586655 Staphylococcus caprae strain 96007 serine-asp...    38   0.17    
gb:AJ842180_533315 Staphylococcus aureus partial clfB gene for c...    37   0.22    
gb:AJ744765_530001 Staphylococcus aureus partial clfB gene for c...    37   0.22    
gb:AJ744764_530000 Staphylococcus aureus partial clfB gene for c...    37   0.22    
gb:AJ744763_529999 Staphylococcus aureus partial clfB gene for c...    37   0.22    
gb:SAA224764_169294 Staphylococcus aureus strain Newman clumping...    37   0.22    
gb:CP000046_92719 Staphylococcus aureus subsp. aureus COL, compl...    37   0.22    
pir|F90070|F90070 Clumping factor B [imported] - Staphylococcus ...    37   0.22    Staphylococcus aureus subsp. aureus N315
gb:AF325155_2234904 Spodoptera litura nucleopolyhedrovirus strai...    37   0.29    
gb:CR382125_1657801 Kluyveromyces lactis strain NRRL Y-1140 chro...    37   0.29    
gb:BX571856_780295 Staphylococcus aureus subsp. aureus strain MR...    37   0.38    
gb:BA000033_710810 Staphylococcus aureus subsp. aureus MW2 DNA, ...    37   0.38    
gb:AE016752_324045 Staphylococcus epidermidis ATCC 12228, sectio...    37   0.38    
gb:SAU18653_172047 Staphylococcus aureus bbp gene, strain 024.         37   0.38    
gb:BX571856_782131 Staphylococcus aureus subsp. aureus strain MR...    36   0.50    
gb:AF245041_492218 Staphylococcus epidermidis putative cell-surf...    36   0.50    
gb:CP000046_90239 Staphylococcus aureus subsp. aureus COL, compl...    36   0.50    
gb:NCB24G20_1689827 Neurospora crassa DNA linkage group V BAC cl...    36   0.65    
gb:BX571857_782970 Staphylococcus aureus strain MSSA476, complet...    35   0.85    
gb:BA000033_711056 Staphylococcus aureus subsp. aureus MW2 DNA, ...    35   0.85    
gb:AY510088_623857 Staphylococcus capitis serine-aspartate repea...    35   0.85    
gb:AL935255_551144 Lactobacillus plantarum strain WCFS1 complete...    35   0.85    
gb:SAU5645_172531 Staphylococcus aureus sdrC gene.                     35   0.85    
gb:AB033763_5281 Staphylococcus aureus DNA, type-I staphylococcc...    35   0.85    
gb:BX571856_780031 Staphylococcus aureus subsp. aureus strain MR...    35   1.1     
gb:BA000017_676507 Staphylococcus aureus subsp. aureus Mu50 DNA,...    35   1.1     
gb:CP000046_91008 Staphylococcus aureus subsp. aureus COL, compl...    35   1.1     
pir|D89852|D89852 fibrinogen-binding protein A, clumping factor ...    35   1.1     Staphylococcus aureus subsp. aureus N315
pir|S41539|S41539 fibrinogen-binding protein - Staphylococcus au...    35   1.1     Staphylococcus aureus subsp. aureus str. Newman
sp|P80544|PLS_STAAU|PLS_STAAU Surface protein precursor (Plasmin-sensitive...    35   1.1     Staphylococcus aureus
gb:BC076799_2559542 Xenopus laevis cDNA clone MGC:83736 IMAGE:66...    35   1.5     
gb:BX571857_782739 Staphylococcus aureus strain MSSA476, complet...    35   1.5     
gb:BA000033_710809 Staphylococcus aureus subsp. aureus MW2 DNA, ...    35   1.5     
gb:AF404823_507798 Staphylococcus lugdunensis strain 2342 recept...    35   1.5     
pir|C89824|C89824 hypothetical protein sdrC [imported] - Staphyl...    35   1.5     Staphylococcus aureus subsp. aureus N315
pir|T30214|T30214 fibrinogen-binding protein - Staphylococcus ep...    35   1.5     Staphylococcus epidermidis
gb:AY372242_2530520 Danio rerio starmaker mRNA, complete cds.          34   1.9     
gb:AK175783_1817771 Arabidopsis thaliana mRNA for putative RNA-b...    34   1.9     
pir|F96576|F96576 probable RNA-binding protein, 40942-42923 [imp...    34   1.9     Arabidopsis thaliana [mouse-ear cress]
gb:BX571857_782738 Staphylococcus aureus strain MSSA476, complet...    34   2.5     
gb:BA000033_710808 Staphylococcus aureus subsp. aureus MW2 DNA, ...    34   2.5     
gb:AF035443_2469792 Xenopus laevis wee1 homolog mRNA, complete cds.    33   3.2     
gb:ATH277884_1552254 Arabidopsis thaliana mRNA for inositol 1,4,...    33   3.2     
gb:AY572435_1338117 Plasmodium reichenowi erythrocyte invasion l...    33   3.2     
gb:AB188680_1202843 Cotesia glomerata mRNA for asparagine-rich c...    33   3.2     
pir|T00670|T00670 probable inositol polyphosphate 5'-phosphatase...    33   3.2     Arabidopsis thaliana [mouse-ear cress]
gb:BC081031_2561940 Xenopus laevis Wee1A kinase, mRNA (cDNA clon...    33   4.2     
gb:CR380953_1650720 Candida glabrata strain CBS138 chromosome G ...    33   4.2     
sp|P47817|WEE1_XENLA|WEE1_XENLA Wee1-like protein kinase (EC 2.7.1.112).>pi...    33   4.2     Xenopus laevis [clawed frog]
gb:AP002093_1821998 Oryza sativa (japonica cultivar-group) genom...    33   5.5     
gb:CR382137_1670011 Debaryomyces hansenii chromosome E of strain...    33   5.5     
gb:AF402316_507690 Staphylococcus saprophyticus surface protein ...    33   5.5     
gb:AF434681_1799705 Arabidopsis thaliana arogenate dehydrogenase...    32   9.4     
gb:AX457119_1468871 Sequence 4 from Patent WO0246441.                  32   9.4     
gb:AX457117_1468870 Sequence 2 from Patent WO0246441.                  32   9.4     
pir|T01952|T01952 hypothetical protein T2L5.1 - Arabidopsis thal...    32   9.4     Arabidopsis thaliana [mouse-ear cress]


>gb:AB028617_1518019 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone:MOA2.
          Length = 327

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 25/54 (46%), Positives = 32/54 (59%)
 Frame = +1

Query: 472 NAKSESMLDGDKGSNSDPNSILNSKSEYQMQDLVDMLKTLKLNPLAKEFFPSSY 633
           + KSE ++D     +S  +S   ++S   M  LV M K  KLNPLAKEFFPS Y
Sbjct: 21  STKSEKIIDEGIEKSSITDSKTETESRLDMHKLVAMFK--KLNPLAKEFFPSYY 72



>gb:BX571857_784753 Staphylococcus aureus strain MSSA476, complete
           genome.
          Length = 905

 Score = 39.3 bits (90), Expect = 0.059
 Identities = 21/53 (39%), Positives = 32/53 (60%)
 Frame = +1

Query: 394 TENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           T +    PD   DS   SD+GSD  +++ S+S  D D GS+SD +S  +S+S+
Sbjct: 573 TPDPEPSPDPDPDSDSDSDSGSDSDSDSDSDSDSDSDSGSDSDSDSDSDSESD 625



 Score = 36.2 bits (82), Expect = 0.50
 Identities = 21/51 (41%), Positives = 30/51 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DSG  SD+ SD  + + SES  D D  S+SD +S   S S+
Sbjct: 599 DSDSDSDSDSDSGSDSDSDSDSDSESDSESDSDSDSESDSDSDSDSESDSD 649



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 773 DSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSD 823



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 739 DSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSD 789



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 701 DSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSD 751



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 665 DSDSDSDSDSDSDSDSDSESDSDSDSDSESDSDSDSDSDSDSDSDSDSDSD 715



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 20/51 (39%), Positives = 30/51 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S SD +S  +S S+
Sbjct: 655 DSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSESDSDSDSDSDSD 705



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 18/45 (40%), Positives = 27/45 (60%)
 Frame = +1

Query: 418 DNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           D+ +DSG  SD+ SD  +++ S+S  D D  S+SD  S   S S+
Sbjct: 587 DSDSDSGSDSDSDSDSDSDSDSDSGSDSDSDSDSDSESDSESDSD 631



>gb:BA000033_712843 Staphylococcus aureus subsp. aureus MW2 DNA,
           complete genome, strain:MW2.
          Length = 907

 Score = 39.3 bits (90), Expect = 0.059
 Identities = 21/53 (39%), Positives = 32/53 (60%)
 Frame = +1

Query: 394 TENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           T +    PD   DS   SD+GSD  +++ S+S  D D GS+SD +S  +S+S+
Sbjct: 573 TPDPEPSPDPDPDSDSDSDSGSDSDSDSDSDSDSDSDSGSDSDSDSDSDSESD 625



 Score = 36.2 bits (82), Expect = 0.50
 Identities = 21/51 (41%), Positives = 30/51 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DSG  SD+ SD  + + SES  D D  S+SD +S   S S+
Sbjct: 599 DSDSDSDSDSDSGSDSDSDSDSDSESDSESDSDSDSESDSDSDSDSESDSD 649



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 775 DSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSD 825



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 739 DSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSD 789



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 701 DSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSD 751



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 665 DSDSDSDSDSDSDSDSDSESDSDSDSDSESDSDSDSDSDSDSDSDSDSDSD 715



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 20/51 (39%), Positives = 30/51 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S SD +S  +S S+
Sbjct: 655 DSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSESDSDSDSDSDSD 705



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 18/45 (40%), Positives = 27/45 (60%)
 Frame = +1

Query: 418 DNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           D+ +DSG  SD+ SD  +++ S+S  D D  S+SD  S   S S+
Sbjct: 587 DSDSDSGSDSDSDSDSDSDSDSDSGSDSDSDSDSDSESDSESDSD 631



>gb:AY510087_623856 Staphylococcus capitis serine-aspartate repeat
           family protein (sdrZL) gene, complete cds.
          Length = 565

 Score = 38.1 bits (87), Expect = 0.13
 Identities = 20/51 (39%), Positives = 33/51 (64%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+Y+DS   SD+ SD ++++ S+S  D D  S+SD +S  +S S+
Sbjct: 138 DSDSDSDSYSDSHSDSDSDSDSNSDSASDSDSDSDSDSDSDSDSASDSDSD 188



 Score = 35.0 bits (79), Expect = 1.1
 Identities = 20/50 (40%), Positives = 30/50 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKS 549
           +S+S  D+ +DS   SD+GSD  + + S+S  D D  S SD +S  +S S
Sbjct: 180 DSASDSDSDSDSDSDSDSGSDSDSGSDSDSASDSDSDSASDSDSDSDSDS 229



 Score = 32.7 bits (73), Expect = 5.5
 Identities = 20/51 (39%), Positives = 28/51 (54%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  + + S S  D D  SNSD  S  +S S+
Sbjct: 122 DSDSDSDSDSDSASDSDSDSDSDSYSDSHSDSDSDSDSNSDSASDSDSDSD 172



>gb:AF245043_492220 Staphylococcus epidermidis SdrH (sdrH) gene,
           complete cds.
          Length = 487

 Score = 38.1 bits (87), Expect = 0.13
 Identities = 21/51 (41%), Positives = 30/51 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           NS S  D Y DS   SD+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 81  NSDSENDTYLDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 131



>gb:AE016749_323282 Staphylococcus epidermidis ATCC 12228, section 6
           of 9 of the complete genome.>gb:AE015929_1147951
           Staphylococcus epidermidis ATCC 12228, complete genome.
          Length = 485

 Score = 38.1 bits (87), Expect = 0.13
 Identities = 21/51 (41%), Positives = 30/51 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           NS S  D Y DS   SD+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 85  NSDSENDTYLDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 135



>gb:CP000029_82081 Staphylococcus epidermidis RP62A, complete
           genome.
          Length = 481

 Score = 38.1 bits (87), Expect = 0.13
 Identities = 21/51 (41%), Positives = 30/51 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           NS S  D Y DS   SD+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 81  NSDSENDTYLDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 131



>gb:AY048595_586655 Staphylococcus caprae strain 96007
           serine-aspartate repeat protein (sdrZ) gene, complete
           cds.
          Length = 540

 Score = 37.7 bits (86), Expect = 0.17
 Identities = 20/54 (37%), Positives = 35/54 (64%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +  +S+S  D+ +DS   SDA SD ++++ S+S  D D+GS+SD +S  +  S+
Sbjct: 102 SNSDSNSDADSDSDSNSDSDADSDHNSDSDSDSHSDSDQGSDSDSDSDSDHNSD 155



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 20/55 (36%), Positives = 30/55 (54%)
 Frame = +1

Query: 388 TATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           T+  NS    D+ +DS   SD+ SD  +++ S S  D D   NSD +S  +S S+
Sbjct: 85  TSEVNSDLDSDSDSDSDSNSDSNSDADSDSDSNSDSDADSDHNSDSDSDSHSDSD 139



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
 Frame = +1

Query: 400 NSSSLPDNYADS--GKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           NS S  D+++DS  G  SD+ SD   N+ S+S  D D    SD  S  +S S+
Sbjct: 127 NSDSDSDSHSDSDQGSDSDSDSDSDHNSDSDSDSDSDSDQGSDSGSDSDSDSD 179



>gb:AJ842180_533315 Staphylococcus aureus partial clfB gene for
           clumping factor B, tandem-repeat region, allele clfB-4.
          Length = 198

 Score = 37.4 bits (85), Expect = 0.22
 Identities = 21/51 (41%), Positives = 32/51 (62%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D  +DSG  SD+ SD  +++ S+S LD D  S+SD +S  +S S+
Sbjct: 8   DSDSNSDLDSDSGSDSDSDSDSDSDSDSDSDLDSDSDSDSDSDSDSDSDSD 58



 Score = 35.8 bits (81), Expect = 0.65
 Identities = 20/51 (39%), Positives = 32/51 (62%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SDL +++ S+S  D D  S+SD +S  +S S+
Sbjct: 18  DSGSDSDSDSDSDSDSDSDSDLDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 68



 Score = 35.0 bits (79), Expect = 1.1
 Identities = 18/42 (42%), Positives = 28/42 (66%)
 Frame = +1

Query: 427 ADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +DS   SD+ SDL +++ S+S  D D  S+SD +S L+S S+
Sbjct: 3   SDSDSDSDSNSDLDSDSGSDSDSDSDSDSDSDSDSDLDSDSD 44



>gb:AJ744765_530001 Staphylococcus aureus partial clfB gene for
           clumping factor B, tandem-repeat region, allele clfB-3.
          Length = 252

 Score = 37.4 bits (85), Expect = 0.22
 Identities = 19/45 (42%), Positives = 29/45 (64%)
 Frame = +1

Query: 418 DNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           D+ +DSG  SD+GSD  + + S+S  D D  S+SD  S  +S+S+
Sbjct: 2   DSDSDSGSDSDSGSDSDSESDSDSDSDSDSDSDSDSESDSDSESD 46



 Score = 35.0 bits (79), Expect = 1.1
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 16  DSDSESDSDSDSDSDSDSDSDSESDSDSESDSDSDSDSDSDSDSDSDSDSD 66



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 20/51 (39%), Positives = 30/51 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  + + SES  D D  S+SD +S  +S S+
Sbjct: 62  DSDSDSDSDSDSDSDSDSESDSDSESDSESDSDSDSDSDSDSDSDSDSDSD 112



 Score = 32.3 bits (72), Expect = 7.2
 Identities = 19/51 (37%), Positives = 30/51 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S   + +DSG  SD+ SD  +++ S+S  D D  S+SD  S  +S S+
Sbjct: 2   DSDSDSGSDSDSGSDSDSESDSDSDSDSDSDSDSDSESDSDSESDSDSDSD 52



>gb:AJ744764_530000 Staphylococcus aureus partial clfB gene for
           clumping factor B, tandem-repeat region, allele clfB-2.
          Length = 216

 Score = 37.4 bits (85), Expect = 0.22
 Identities = 19/45 (42%), Positives = 29/45 (64%)
 Frame = +1

Query: 418 DNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           D+ +DSG  SD+GSD  + + S+S  D D  S+SD  S  +S+S+
Sbjct: 2   DSDSDSGSDSDSGSDSDSESDSDSDSDSDSDSDSDSESDSDSESD 46



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 100 DSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSD 150



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 30/51 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S   S S+
Sbjct: 16  DSDSESDSDSDSDSDSDSDSDSESDSDSESDSDSDSDSDSDSDSDSESDSD 66



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +1

Query: 403 SSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           S S  D+ +DS   SD+ SD  + + SES  D D  S+SD +S  +S S+
Sbjct: 63  SDSDSDSDSDSDSDSDSESDSDSESDSESDSDSDSDSDSDSDSDSDSDSD 112



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 19/51 (37%), Positives = 30/51 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ ++S   SD+ SD  +++ SES  D D  S+SD +S   S S+
Sbjct: 34  DSDSESDSDSESDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSESDSD 84



 Score = 32.3 bits (72), Expect = 7.2
 Identities = 19/51 (37%), Positives = 30/51 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S   + +DSG  SD+ SD  +++ S+S  D D  S+SD  S  +S S+
Sbjct: 2   DSDSDSGSDSDSGSDSDSESDSDSDSDSDSDSDSDSESDSDSESDSDSDSD 52



>gb:AJ744763_529999 Staphylococcus aureus partial clfB gene for
           clumping factor B, tandem-repeat region, allele clfB-1.
          Length = 216

 Score = 37.4 bits (85), Expect = 0.22
 Identities = 19/45 (42%), Positives = 29/45 (64%)
 Frame = +1

Query: 418 DNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           D+ +DSG  SD+GSD  + + S+S  D D  S+SD  S  +S+S+
Sbjct: 2   DSDSDSGSDSDSGSDSDSESDSDSDSDSDSDSDSDSESDSDSESD 46



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 30/51 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S   S S+
Sbjct: 16  DSDSESDSDSDSDSDSDSDSDSESDSDSESDSDSDSDSDSDSDSDSESDSD 66



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +1

Query: 403 SSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           S S  D+ +DS   SD+ SD  + + SES  D D  S+SD +S  +S S+
Sbjct: 63  SDSDSDSDSDSDSDSDSESDSDSESDSESDSDSDSDSDSDSDSDSDSDSD 112



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 19/51 (37%), Positives = 30/51 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ ++S   SD+ SD  +++ SES  D D  S+SD +S   S S+
Sbjct: 34  DSDSESDSDSESDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSESDSD 84



 Score = 32.3 bits (72), Expect = 7.2
 Identities = 19/51 (37%), Positives = 30/51 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S   + +DSG  SD+ SD  +++ S+S  D D  S+SD  S  +S S+
Sbjct: 2   DSDSDSGSDSDSGSDSDSESDSDSDSDSDSDSDSDSESDSDSESDSDSDSD 52



>gb:SAA224764_169294 Staphylococcus aureus strain Newman clumping
           factor B (clfB) gene.
          Length = 913

 Score = 37.4 bits (85), Expect = 0.22
 Identities = 19/45 (42%), Positives = 29/45 (64%)
 Frame = +1

Query: 418 DNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           D+ +DSG  SD+GSD  + + S+S  D D  S+SD  S  +S+S+
Sbjct: 587 DSDSDSGSDSDSGSDSDSESDSDSDSDSDSDSDSDSESDSDSESD 631



 Score = 36.2 bits (82), Expect = 0.50
 Identities = 19/46 (41%), Positives = 28/46 (60%)
 Frame = +1

Query: 415 PDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           PD   DS   SD+GSD  + + S+S  D D  S+SD +S  +S+S+
Sbjct: 580 PDPDPDSDSDSDSGSDSDSGSDSDSESDSDSDSDSDSDSDSDSESD 625



 Score = 35.0 bits (79), Expect = 1.1
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 601 DSDSESDSDSDSDSDSDSDSDSESDSDSESDSDSDSDSDSDSDSDSDSDSD 651



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 20/51 (39%), Positives = 30/51 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  + + SES  D D  S+SD +S  +S S+
Sbjct: 647 DSDSDSDSDSDSDSDSDSESDSDSESDSESDSDSDSDSDSDSDSDSDSDSD 697



 Score = 32.3 bits (72), Expect = 7.2
 Identities = 19/51 (37%), Positives = 30/51 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S   + +DSG  SD+ SD  +++ S+S  D D  S+SD  S  +S S+
Sbjct: 587 DSDSDSGSDSDSGSDSDSESDSDSDSDSDSDSDSDSESDSDSESDSDSDSD 637



>gb:CP000046_92719 Staphylococcus aureus subsp. aureus COL, complete
           genome.
          Length = 913

 Score = 37.4 bits (85), Expect = 0.22
 Identities = 19/45 (42%), Positives = 29/45 (64%)
 Frame = +1

Query: 418 DNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           D+ +DSG  SD+GSD  + + S+S  D D  S+SD  S  +S+S+
Sbjct: 587 DSDSDSGSDSDSGSDSDSESDSDSDSDSDSDSDSDSESDSDSESD 631



 Score = 36.2 bits (82), Expect = 0.50
 Identities = 19/46 (41%), Positives = 28/46 (60%)
 Frame = +1

Query: 415 PDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           PD   DS   SD+GSD  + + S+S  D D  S+SD +S  +S+S+
Sbjct: 580 PDPDPDSDSDSDSGSDSDSGSDSDSESDSDSDSDSDSDSDSDSESD 625



 Score = 35.0 bits (79), Expect = 1.1
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 601 DSDSESDSDSDSDSDSDSDSDSESDSDSESDSDSDSDSDSDSDSDSDSDSD 651



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 20/51 (39%), Positives = 30/51 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  + + SES  D D  S+SD +S  +S S+
Sbjct: 647 DSDSDSDSDSDSDSDSDSESDSDSESDSESDSDSDSDSDSDSDSDSDSDSD 697



 Score = 32.3 bits (72), Expect = 7.2
 Identities = 19/51 (37%), Positives = 30/51 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S   + +DSG  SD+ SD  +++ S+S  D D  S+SD  S  +S S+
Sbjct: 587 DSDSDSGSDSDSGSDSDSESDSDSDSDSDSDSDSDSESDSDSESDSDSDSD 637



>pir|F90070|F90070 Clumping factor B [imported] - Staphylococcus
           aureus (strain N315)>gb:BA000017_678315 Staphylococcus
           aureus subsp. aureus Mu50 DNA, complete
           genome.>gb:BA000018_680909 Staphylococcus aureus subsp.
           aureus N315 genomic DNA, complete genome.
          Length = 877

 Score = 37.4 bits (85), Expect = 0.22
 Identities = 19/45 (42%), Positives = 29/45 (64%)
 Frame = +1

Query: 418 DNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           D+ +DSG  SD+GSD  + + S+S  D D  S+SD  S  +S+S+
Sbjct: 587 DSDSDSGSDSDSGSDSDSESDSDSDSDSDSDSDSDSESDSDSESD 631



 Score = 36.2 bits (82), Expect = 0.50
 Identities = 19/46 (41%), Positives = 28/46 (60%)
 Frame = +1

Query: 415 PDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           PD   DS   SD+GSD  + + S+S  D D  S+SD +S  +S+S+
Sbjct: 580 PDPDPDSDSDSDSGSDSDSGSDSDSESDSDSDSDSDSDSDSDSESD 625



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 685 DSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSD 735



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 30/51 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S   S S+
Sbjct: 601 DSDSESDSDSDSDSDSDSDSDSESDSDSESDSDSDSDSDSDSDSDSESDSD 651



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 20/50 (40%), Positives = 29/50 (58%)
 Frame = +1

Query: 403 SSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           S S  D+ +DS   SD+ SD  + + SES  D D  S+SD +S  +S S+
Sbjct: 648 SDSDSDSDSDSDSDSDSESDSDSESDSESDSDSDSDSDSDSDSDSDSDSD 697



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 19/51 (37%), Positives = 30/51 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ ++S   SD+ SD  +++ SES  D D  S+SD +S   S S+
Sbjct: 619 DSDSESDSDSESDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSESDSD 669



 Score = 32.3 bits (72), Expect = 7.2
 Identities = 19/51 (37%), Positives = 30/51 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S   + +DSG  SD+ SD  +++ S+S  D D  S+SD  S  +S S+
Sbjct: 587 DSDSDSGSDSDSGSDSDSESDSDSDSDSDSDSDSDSESDSDSESDSDSDSD 637



>gb:AF325155_2234904 Spodoptera litura nucleopolyhedrovirus strain
           G2, complete genome.
          Length = 401

 Score = 37.0 bits (84), Expect = 0.29
 Identities = 19/52 (36%), Positives = 33/52 (63%), Gaps = 3/52 (5%)
 Frame = +3

Query: 45  IHLLVSFPEI--CHNLECIYYSFFFFHNNFINLC-ERINIVLPFK*INKYGD 191
           + ++V  PEI  C  LEC++Y+ F+F+ N I +C  RI+ +     I+++GD
Sbjct: 257 VDMIVDAPEIIVCDQLECLFYNVFYFNENKIQVCVSRISQL-----IDRFGD 303



>gb:CR382125_1657801 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 368

 Score = 37.0 bits (84), Expect = 0.29
 Identities = 22/59 (37%), Positives = 32/59 (54%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSEYQMQDLVD 576
           NSSS   + +DS   S + SD S+++ S+S  D D  S+SD +S  +S S     D  D
Sbjct: 185 NSSSSSSSDSDSDSSSSSSSDSSSDSSSDSDSDSDSDSDSDSDSSSDSSSSSSDSDSSD 243



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 23/76 (30%), Positives = 41/76 (53%)
 Frame = +1

Query: 388 TATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSEYQMQD 567
           +++ +SSS   + +DS   SD+ S  S+++ S S  D D  S+S  +S  + + E   +D
Sbjct: 77  SSSSSSSSSSSSSSDSDSSSDSDSSSSSDSSSSSDSDSDSDSSSSASSESDDEDE---KD 133

Query: 568 LVDMLKTLKLNPLAKE 615
           +   +K  K  P+A E
Sbjct: 134 IKIKIKDEKSEPVAVE 149



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 18/54 (33%), Positives = 33/54 (61%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           ++ +SSS  ++ +DS   S + S  S+++ S+S  D D  S+SD +S  +S S+
Sbjct: 62  SSSSSSSDSESNSDSSSSSSSSSSSSSSSDSDSSSDSDSSSSSDSSSSSDSDSD 115



 Score = 32.7 bits (73), Expect = 5.5
 Identities = 20/53 (37%), Positives = 33/53 (62%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKS 549
           ++ +SSS  D+ + S   SD+ SD S+++ S+S  D D  S+SD +S  +S S
Sbjct: 186 SSSSSSSDSDSDSSSSSSSDSSSDSSSDSDSDS--DSDSDSDSDSSSDSSSSS 236



>gb:BX571856_780295 Staphylococcus aureus subsp. aureus strain
           MRSA252, complete genome.
          Length = 1029

 Score = 36.6 bits (83), Expect = 0.38
 Identities = 19/51 (37%), Positives = 33/51 (64%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS  +SD+ SD  ++++S+S  D D  S+SD +S  +S S+
Sbjct: 716 DSDSDSDSDSDSDSVSDSDSDSDSDSESDSDSDSDSDSDSDSDSESDSDSD 766



 Score = 36.2 bits (82), Expect = 0.50
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 878  DSDSDSDSDSDSDSASDSDSDSDSDSDSESDSDSDSDSDSDSDSASDSDSD 928



 Score = 35.8 bits (81), Expect = 0.65
 Identities = 20/51 (39%), Positives = 32/51 (62%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SDL +++ S+S  D D  S+SD +S  +S S+
Sbjct: 824 DSDSDSDSDSDSDSDSDSDSDLDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 874



 Score = 35.0 bits (79), Expect = 1.1
 Identities = 21/50 (42%), Positives = 32/50 (64%)
 Frame = +1

Query: 403 SSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           S S  D+ +DSG  SD+GSD ++++ S+S  D D  S+SD  S  +S S+
Sbjct: 571 SDSGSDSNSDSG--SDSGSDSTSDSGSDSASDSDSASDSDSASDSDSASD 618



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SD+ SDL +++ S+S  D D  S SD +S  +S S+
Sbjct: 854  DSDSDSDSDSDSDSDSDSDSDLDSDSDSDSDSDSDSDSASDSDSDSDSDSD 904



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 788 DSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSD 838



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 678 DSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSD 728



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 17/38 (44%), Positives = 25/38 (65%), Gaps = 3/38 (7%)
 Frame = +1

Query: 427  ADSGKISDAGSDLSANAKSESMLDGDKGSNSD---PNS 531
            +DS   SD GSD  ++++S+S  D D GSN++   PNS
Sbjct: 935  SDSDSTSDTGSDNDSDSESDSNSDSDSGSNNNVVPPNS 972



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +  +S S  D+ ++S   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 729 SVSDSDSDSDSDSESDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSD 782



>gb:BA000033_710810 Staphylococcus aureus subsp. aureus MW2 DNA,
            complete genome, strain:MW2.>gb:BX571857_782740
            Staphylococcus aureus strain MSSA476, complete genome.
          Length = 1141

 Score = 36.6 bits (83), Expect = 0.38
 Identities = 21/55 (38%), Positives = 33/55 (60%)
 Frame = +1

Query: 388  TATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            T+  +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 935  TSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSD 989



>gb:AE016752_324045 Staphylococcus epidermidis ATCC 12228, section 9
            of 9 of the complete genome.>gb:AE015929_1148714
            Staphylococcus epidermidis ATCC 12228, complete genome.
          Length = 1633

 Score = 36.6 bits (83), Expect = 0.38
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   SD+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1254 ADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSD 1307



 Score = 36.6 bits (83), Expect = 0.38
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   SD+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1242 ADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSD 1295



 Score = 36.2 bits (82), Expect = 0.50
 Identities = 19/51 (37%), Positives = 32/51 (62%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S +  D+Y+DS   SD+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1475 DSDADSDSYSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1525



 Score = 36.2 bits (82), Expect = 0.50
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   SD+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1278 ADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1331



 Score = 36.2 bits (82), Expect = 0.50
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   SD+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1266 ADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDSDSDSD 1319



 Score = 35.8 bits (81), Expect = 0.65
 Identities = 21/51 (41%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  A++ S+S  D D  S+SD +S  +S S+
Sbjct: 1341 DSDSDADSDSDSDSDSDADSDSDADSDSDSDSDSDSDSDSDADSDSDSDSD 1391



 Score = 35.8 bits (81), Expect = 0.65
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   SD+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1290 ADSDSDSDSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1343



 Score = 35.8 bits (81), Expect = 0.65
 Identities = 21/51 (41%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  A++ S+S  D D  S+SD +S  +S S+
Sbjct: 1169 DSDSDSDSDSDSDSDSDADSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSD 1219



 Score = 35.8 bits (81), Expect = 0.65
 Identities = 21/51 (41%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  A++ S+S  D D  S+SD +S  +S S+
Sbjct: 1131 DSDSDADSDSDSDSDSDADSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSD 1181



 Score = 35.4 bits (80), Expect = 0.85
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ ADS   SD+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1469 DSDSDSDSDADSDSYSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1519



 Score = 35.4 bits (80), Expect = 0.85
 Identities = 20/54 (37%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S +  D+ ADS   SD+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1230 ADSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSD 1283



 Score = 35.0 bits (79), Expect = 1.1
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ ADS   SD+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1391 DSDSDSDSDADSDSDSDSDSDAESDSDSDSDSDSDSDSDSDSDSDSDSDSD 1441



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SD+ SD  +++ S+S  D D  S+SD +S  N+K +
Sbjct: 1543 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDKNAKDK 1593



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/54 (37%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   +D+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1346 ADSDSDSDSDSDADSDSDADSDSDSDSDSDSDSDSDADSDSDSDSDSDSDSDSD 1399



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1285 DSDSDADSDSDSDSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1335



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ ADS   SD+ SD  +++ S+S  D D  S++D +S  +S S+
Sbjct: 1439 DSDSDSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSDADSDSYSDSDSD 1489



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1395 DSDSDADSDSDSDSDSDAESDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1445



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ ADS   SD+ SD  +++ ++S  D D  S+SD +S  +S S+
Sbjct: 1337 DSDSDSDSDADSDSDSDSDSDADSDSDADSDSDSDSDSDSDSDSDADSDSD 1387



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1461 DSDSDSDSDSDSDSDSDADSDSYSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1511



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S++  D D  S+SD +S  +S S+
Sbjct: 1383 DSDSDSDSDSDSDSDSDADSDSDSDSDSDAESDSDSDSDSDSDSDSDSDSD 1433



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 19/51 (37%), Positives = 32/51 (62%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S+S  D D  S+SD +S  +++S+
Sbjct: 1365 DSDSDSDSDSDSDSDSDADSDSDSDSDSDSDSDSDADSDSDSDSDSDAESD 1415



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S+S  D D  S+SD +S  ++ S+
Sbjct: 1431 DSDSDSDSDSDSDSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSDADSD 1481



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S++  D D  S+SD +S  +S S+
Sbjct: 1273 DSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDSDSDSDSDSD 1323



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S++  D D  S+SD +S  +S S+
Sbjct: 1261 DSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSD 1311



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S++  D D  S+SD +S  +S S+
Sbjct: 1249 DSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSD 1299



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S++  D D  S+SD +S  +S S+
Sbjct: 1237 DSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSD 1287



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  +S S+
Sbjct: 1213 DSDSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSDSDSDSD 1263



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   +D+ SD  +++ S+S  D D  S+SD +S  ++ S+
Sbjct: 1136 ADSDSDSDSDSDADSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDADSD 1189



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S++  D D  S+SD +S  +S S+
Sbjct: 1329 DSDSDSDSDSDSDSDSDADSDSDSDSDSDADSDSDADSDSDSDSDSDSDSD 1379



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S +  D+ ADS   +D+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1221 DSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSD 1271



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +D+   SDA SD  A++ S+S  D D  S+SD +S  ++ S+
Sbjct: 1219 DSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSDADSD 1269



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 1207 DSDSDSDSDSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSD 1257



 Score = 32.7 bits (73), Expect = 5.5
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S +  D+ ADS   SD+ SD  +++ ++S  D D  S+SD +S  +S S+
Sbjct: 1355 DSDADSDSDADSDSDSDSDSDSDSDSDADSDSDSDSDSDSDSDSDADSDSD 1405



 Score = 32.3 bits (72), Expect = 7.2
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +D+   SDA SD  +++ S++  D D  S+SD +S  +S S+
Sbjct: 1225 DSDSDADSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSD 1275



 Score = 32.3 bits (72), Expect = 7.2
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S +  D+ ADS   SD+ SD  +++ S+S  D D  S+SD +S  ++ S+
Sbjct: 1183 DSDADSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDADSDSDADSD 1233



 Score = 32.3 bits (72), Expect = 7.2
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ ADS   +D+ SD  +++ S+S  D D  S+SD +S  ++ S+
Sbjct: 1177 DSDSDSDSDADSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDADSD 1227



 Score = 32.3 bits (72), Expect = 7.2
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +D+   SDA SD  +++ S+S  D D  S+SD +S  +S ++
Sbjct: 1175 DSDSDSDSDSDADSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDAD 1225



 Score = 32.3 bits (72), Expect = 7.2
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S +  D+ ADS   SD+ SD  +++ S+S  D D  S+SD +S  ++ S+
Sbjct: 1145 DSDADSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDADSDSDADSD 1195



>gb:SAU18653_172047 Staphylococcus aureus bbp gene, strain 024.
          Length = 1171

 Score = 36.6 bits (83), Expect = 0.38
 Identities = 21/55 (38%), Positives = 33/55 (60%)
 Frame = +1

Query: 388  TATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            T+  +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 935  TSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSD 989



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 969  DSDSDSDSDSDSDSDSDSDSDSESDSDSESDSDSDSDSDSDSDSDSDSDSD 1019



>gb:BX571856_782131 Staphylococcus aureus subsp. aureus strain
           MRSA252, complete genome.
          Length = 873

 Score = 36.2 bits (82), Expect = 0.50
 Identities = 18/45 (40%), Positives = 30/45 (66%)
 Frame = +1

Query: 418 DNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           D+ +DSG  SD+GSD  +++ S+S  D D  S+S+ +S  +S S+
Sbjct: 589 DSDSDSGSDSDSGSDSDSDSDSDSDSDSDSNSDSESDSDSDSDSD 633



 Score = 35.4 bits (80), Expect = 0.85
 Identities = 20/53 (37%), Positives = 28/53 (52%)
 Frame = +1

Query: 394 TENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           T +    P+   DS   SD+GSD  + + S+S  D D  S+SD NS   S S+
Sbjct: 575 TPDPEPSPEPDPDSDSDSDSGSDSDSGSDSDSDSDSDSDSDSDSNSDSESDSD 627



 Score = 35.0 bits (79), Expect = 1.1
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 675 DSDSNSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSD 725



 Score = 35.0 bits (79), Expect = 1.1
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ S+S  D D  SNSD +S  +S S+
Sbjct: 641 DSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSD 691



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 625 DSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSD 675



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 18/42 (42%), Positives = 26/42 (61%)
 Frame = +1

Query: 427 ADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +DS   SD+ SD  +N+ SES  D D  S+SD +S  +S S+
Sbjct: 604 SDSDSDSDSDSDSDSNSDSESDSDSDSDSDSDSDSDSDSDSD 645



 Score = 32.3 bits (72), Expect = 7.2
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 2/53 (3%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGD--KGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  + + SES  D D    S+SDP+S  +S S+
Sbjct: 715 DSDSDSDSDSDSDSDSDSDSDSDSESDSESDSDSDSESDSDSDPDSESDSDSD 767



>gb:AF245041_492218 Staphylococcus epidermidis putative cell-surface
            adhesin SdrF (sdrF) gene, complete cds.
          Length = 1733

 Score = 36.2 bits (82), Expect = 0.50
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   SD+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1436 ADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDSDSDSD 1489



 Score = 36.2 bits (82), Expect = 0.50
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   SD+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1370 ADSDSDSDSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDADSDSD 1423



 Score = 35.8 bits (81), Expect = 0.65
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   SD+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1622 ADSDSDSDSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1675



 Score = 35.8 bits (81), Expect = 0.65
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   SD+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1190 ADSDSDSDSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1243



 Score = 35.4 bits (80), Expect = 0.85
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ ADS   SD+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1427 DSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSD 1477



 Score = 35.0 bits (79), Expect = 1.1
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ ADS   SD+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1613 DSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1663



 Score = 35.0 bits (79), Expect = 1.1
 Identities = 20/54 (37%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   SD+ SD  +++ S+S  D D  S++D +S  +S S+
Sbjct: 1448 ADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDSDSDSDADSDSDSDSDSD 1501



 Score = 35.0 bits (79), Expect = 1.1
 Identities = 20/54 (37%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S +  D+ ADS   SD+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1358 ADSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1411



 Score = 35.0 bits (79), Expect = 1.1
 Identities = 20/54 (37%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   SD+ SD  +++ S+S  D D  S++D +S  +S S+
Sbjct: 1252 ADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDSDSDSDADSDSDSDSDSD 1305



 Score = 35.0 bits (79), Expect = 1.1
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ ADS   SD+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1181 DSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1231



 Score = 35.0 bits (79), Expect = 1.1
 Identities = 20/54 (37%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   +D+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1136 ADSDSDSDSDSDADSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSDSDSDSD 1189



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SD+ SD  +++ S+S  D D  S+SD +S  N+K +
Sbjct: 1643 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDKNAKDK 1693



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1617 DSDSDADSDSDSDSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1667



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ ADS   SD+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1481 DSDSDSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1531



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1473 DSDSDSDSDSDSDSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1523



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/54 (37%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   SD+ SD  +++ ++S  D D  S+SD +S  +S S+
Sbjct: 1460 ADSDSDSDSDSDADSDSDSDSDSDSDSDSDADSDSDSDSDSDSDSDSDSDSDSD 1513



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1365 DSDSDADSDSDSDSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1415



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/54 (37%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   SD+ SD  +++ ++S  D D  S+SD +S  +S S+
Sbjct: 1264 ADSDSDSDSDSDADSDSDSDSDSDSDSDSDADSDSDSDSDSDSDSDSDSDSDSD 1317



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1185 DSDSDADSDSDSDSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSD 1235



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  A++ S++  D D  S+SD +S  +S S+
Sbjct: 1131 DSDSDADSDSDSDSDSDADSDSDADSDSDADSDSDSDSDSDADSDSDSDSD 1181



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1455 DSDSDADSDSDSDSDSDADSDSDSDSDSDSDSDSDADSDSDSDSDSDSDSD 1505



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  A++ S++  D D  S+SD +S  +S S+
Sbjct: 1341 DSDSDSDSDSDSDADSDADSDSDADSDSDADSDSDSDSDSDADSDSDSDSD 1391



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ ++S  D D  S+SD +S  +S S+
Sbjct: 1337 DSDSDSDSDSDSDSDSDADSDADSDSDADSDSDADSDSDSDSDSDADSDSD 1387



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1259 DSDSDADSDSDSDSDSDADSDSDSDSDSDSDSDSDADSDSDSDSDSDSDSD 1309



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  A++ S+S  D D  S+SD +S  ++ S+
Sbjct: 1229 DSDSDSDSDSDSDSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSDADSD 1279



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ ADS   +D+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1349 DSDSDADSDADSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSDSDSDSD 1399



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S +  D+ ADS   SD+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1243 DSDADSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDSDSDSD 1293



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S +  D+ ADS   SD+ SD  +++ S+S  D D  S++D +S  +S S+
Sbjct: 1148 ADSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSDSDSDSDADSDSDSDSDSD 1201



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S++  D D  S+SD +S  +S S+
Sbjct: 1605 DSDSDSDSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDSDSDSDSDSD 1655



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S++  D D  S+SD +S  +S S+
Sbjct: 1431 DSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSD 1481



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S++  D D  S+SD +S  +S S+
Sbjct: 1419 DSDSDSDSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSD 1469



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S+S  D D  S+SD +S  ++ S+
Sbjct: 1307 DSDSDSDSDSDSDSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSDADSD 1357



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ ADS   SD+ SD  +++ S+S  D D  S++D +S  +S S+
Sbjct: 1285 DSDSDSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSDADSDSDSDSDSD 1335



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S+S  D D  S+SD +S  ++ S+
Sbjct: 1277 DSDSDSDSDSDSDSDSDADSDSDSDSDSDSDSDSDSDSDSDSDSDSDADSD 1327



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S++  D D  S+SD +S  +S S+
Sbjct: 1173 DSDSDSDSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDSDSDSDSDSD 1223



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   SD+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 1160 ADSDSDSDSDSDADSDSDSDSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSD 1213



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S+S  D D  S+SD +S  ++ S+
Sbjct: 1401 DSDSDSDSDSDSDSDSDADSDSDSDSDSDSDSDSDADSDSDSDSDSDADSD 1451



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 20/51 (39%), Positives = 30/51 (58%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D  +D+   SDA SD  A++ S+S  D D  S+SD +S  +S S+
Sbjct: 1347 DSDSDSDADSDADSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSDSDSD 1397



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ ADS   SD+ +D  ++A S+S  D D  ++SD +S  +S S+
Sbjct: 1345 DSDSDSDSDADSDADSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSDSD 1395



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S+S  D D  S+SD +S  ++ S+
Sbjct: 1155 DSDSDADSDSDSDSDSDADSDSDSDSDSDSDSDSDADSDSDSDSDSDADSD 1205



 Score = 32.3 bits (72), Expect = 7.2
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S++  D D  S+SD +S  ++ S+
Sbjct: 1443 DSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDSDSDSDADSD 1493



 Score = 32.3 bits (72), Expect = 7.2
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ ADS   SD+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 1409 DSDSDSDSDADSDSDSDSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSD 1459



 Score = 32.3 bits (72), Expect = 7.2
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S++  D D  S+SD +S  ++ S+
Sbjct: 1247 DSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSDSDSDSDSDADSD 1297



 Score = 32.3 bits (72), Expect = 7.2
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +D+   SDA SD  +++ S++  D D  S+SD +S  +S S+
Sbjct: 1235 DSDSDSDSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDSDSD 1285



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ ADS   SD+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1315 DSDSDSDSDADSDSDSDSDSDSDSDSDSDS--DSDSDSDSDADSDADSDSD 1363



>gb:CP000046_90239 Staphylococcus aureus subsp. aureus COL, complete
            genome.
          Length = 1548

 Score = 36.2 bits (82), Expect = 0.50
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   SD+ SD  A++ S+S  D D  S++D +S  +S S+
Sbjct: 1309 ADSDSDSDSDSDADSDSDSDSDSDSDADSDSDSDSDADSDSDADSDSDADSDSD 1362



 Score = 35.4 bits (80), Expect = 0.85
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ +DS   SDA SD  A++ S++  D D  S+SD +S  +S S+
Sbjct: 1425 ADSDSDSDADSDSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDSDSD 1478



 Score = 35.0 bits (79), Expect = 1.1
 Identities = 20/51 (39%), Positives = 32/51 (62%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS + SDA SD  A++ S+S  D D  S+SD +S  ++ S+
Sbjct: 1372 DSDSDSDSDSDSDRDSDADSDSDADSDSDSDSDSDADSDSDSDSDSDADSD 1422



 Score = 35.0 bits (79), Expect = 1.1
 Identities = 20/54 (37%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S +  D+ ADS   SD+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1297 ADSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSDSDADSDSDSDSDADSDSD 1350



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   +D+ SD  +++ ++S  D D  S+SD +S  +S S+
Sbjct: 1433 ADSDSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDSDSDSDADSDSD 1486



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 20/54 (37%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   +D+ SD  A++ S+S  D D  S+SD +S  ++ S+
Sbjct: 1407 ADSDSDSDSDSDADSDSDADSDSDSDADSDSDSDSDSDADSDSDADSDSDADSD 1460



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 20/54 (37%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S +  D+ ADS   SD+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1351 ADSDSDADSDSDADSDSDSDSDSDSDSDSDSDSDRDSDADSDSDADSDSDSDSD 1404



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S +  D+ ADS   SD+ SD  +++ S+S  D D  S++D +S  +S S+
Sbjct: 1255 ADSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDADSDSDADSDSD 1308



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  A++ S+S  D D  S+SD +S  ++ S+
Sbjct: 1214 DSDSDSDSDSDSDSDSDADSDSDADSDSDSDSDSDADSDSDADSDSDADSD 1264



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  A++ S+S  D D  S+SD ++  +S ++
Sbjct: 1402 DSDSDADSDSDSDSDSDADSDSDADSDSDSDADSDSDSDSDSDADSDSDAD 1452



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ ADS   SD+ +D  ++A S+S  D D  ++SD +S  +S S+
Sbjct: 1326 DSDSDSDSDADSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDSD 1376



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S+S  D D  S+SD +S  ++ S+
Sbjct: 1304 DSDSDADSDSDSDSDSDADSDSDSDSDSDSDADSDSDSDSDADSDSDADSD 1354



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   SD+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 1267 ADSDSDSDSDSDADSDSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSD 1320



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S +  D+ ADS   SD+ SD  +++ ++S  D D  S+SD +S  +S S+
Sbjct: 1201 ADSDSDADSDSDADSDSDSDSDSDSDSDSDADSDSDADSDSDSDSDSDADSDSD 1254



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 18/54 (33%), Positives = 33/54 (61%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A ++S +  D+ ADS   +D+ SD  +++ ++S  D D  S+SD +S  +S S+
Sbjct: 1183 AKDDSDADSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDSDSDSDADSDSD 1236



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +D+   SDA SD  A++ S+S  D D  S+SD +S  ++ S+
Sbjct: 1440 DSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDSDSDSDADSDSDADSD 1490



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   SD+ SD  +++ ++S  D D  S+SD +S  ++ S+
Sbjct: 1395 ADSDSDSDSDSDADSDSDSDSDSDADSDSDADSDSDSDADSDSDSDSDSDADSD 1448



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +D+   SDA SD  A++ S+S  D D  S+SD +S  +S ++
Sbjct: 1340 DSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDSDSDSDSDSDRDSDAD 1390



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  +S S+
Sbjct: 1280 DSDSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSDSDSDSD 1330



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  +S S+
Sbjct: 1238 DSDSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSDSDSDSD 1288



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +D+   SDA SD  A++ S+S  D D  S+SD +S  ++ S+
Sbjct: 1190 DSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDSDSDSDADSDSDADSD 1240



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 20/51 (39%), Positives = 30/51 (58%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D  +DS   SDA SD  A++ S++  D D  S+SD +S  +S S+
Sbjct: 1328 DSDSDSDADSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDSDSD 1378



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +D+   SDA SD  A++ S+S  D D  S+SD +S  +S ++
Sbjct: 1286 DSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSDSDAD 1336



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 1274 DSDSDADSDSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSD 1324



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S +  D+ ADS   +D+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1246 DSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSD 1296



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +D+   SDA SD  A++ S+S  D D  S+SD +S  ++ S+
Sbjct: 1244 DSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSDADSD 1294



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 1232 DSDSDADSDSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSD 1282



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +D+   SDA SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1196 DSDSDADSDSDADSDSDADSDSDSDSDSDSDSDSDADSDSDADSDSDSDSD 1246



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 18/54 (33%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S +  D+ ADS   +D+ SD  +++ S+S  D D  S++D +S  +S S+
Sbjct: 1189 ADSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDSDSDSDADSDSDADSDSD 1242



 Score = 32.7 bits (73), Expect = 5.5
 Identities = 18/54 (33%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 1279 ADSDSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSD 1332



 Score = 32.7 bits (73), Expect = 5.5
 Identities = 18/54 (33%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 1237 ADSDSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSD 1290



 Score = 32.3 bits (72), Expect = 7.2
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            ++ S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  +S S+
Sbjct: 1334 DADSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDSDSDSDSDSD 1384



 Score = 32.3 bits (72), Expect = 7.2
 Identities = 18/54 (33%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S+SD +S  +S S+
Sbjct: 1291 ADSDSDADSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSDSDADSDSDSDSD 1344



 Score = 32.3 bits (72), Expect = 7.2
 Identities = 18/54 (33%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S +  D+ ADS   +D+ SD  +++ S+S  D D  S++D +S  +S S+
Sbjct: 1195 ADSDSDADSDSDADSDSDADSDSDSDSDSDSDSDSDADSDSDADSDSDSDSDSD 1248



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/51 (33%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S +  D+ ADS   +D+ SD  +++ S+S  D D  S++D +S  +S S+
Sbjct: 1442 DSDADSDSDADSDSDADSDSDADSDSDSDSDSDSDSDSDADSDSDADSDSD 1492



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S +  D+ ADS   SDA SD  +++ S++  D D  S+SD +S  ++ S+
Sbjct: 1416 DSDADSDSDADSDSDSDADSDSDSDSDSDADSDSDADSDSDADSDSDADSD 1466



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S++  D D  S+SD ++  +S S+
Sbjct: 1390 DSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDADSDSDSDADSDSDSD 1440



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S++  D D  S+SD +S  ++ S+
Sbjct: 1262 DSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDADSDSDADSDSDADSD 1312



>gb:NCB24G20_1689827 Neurospora crassa DNA linkage group V BAC clone
           B24G20.
          Length = 878

 Score = 35.8 bits (81), Expect = 0.65
 Identities = 21/59 (35%), Positives = 36/59 (61%)
 Frame = +1

Query: 394 TENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSEYQMQDL 570
           + +S S  D+ +DSG  S + SD S ++ S+S  D D  S+SD +S   S+SE + +++
Sbjct: 585 SSSSDSSSDSSSDSGPSSSSESDSSFDSSSDSSSDSDPSSSSDSDS---SESEAEKKEV 640



>gb:BX571857_782970 Staphylococcus aureus strain MSSA476, complete
           genome.
          Length = 928

 Score = 35.4 bits (80), Expect = 0.85
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ S+S  D D  SNSD +S  +S S+
Sbjct: 693 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSD 743



 Score = 35.0 bits (79), Expect = 1.1
 Identities = 21/50 (42%), Positives = 32/50 (64%)
 Frame = +1

Query: 403 SSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           S S  D+ +DSG  SD+GSD ++++ S+S  D D  S+SD  S  +S S+
Sbjct: 566 SDSGSDSNSDSG--SDSGSDSTSDSGSDSASDSDSASDSDSASDSDSASD 613



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 785 DSDSDSDSDSDSDSDSDSDSDSESDSDSESDSDSDSDSDSDSDSDSDSASD 835



>gb:BA000033_711056 Staphylococcus aureus subsp. aureus MW2 DNA,
           complete genome, strain:MW2.
          Length = 946

 Score = 35.4 bits (80), Expect = 0.85
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ S+S  D D  SNSD +S  +S S+
Sbjct: 711 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSD 761



 Score = 35.0 bits (79), Expect = 1.1
 Identities = 21/50 (42%), Positives = 32/50 (64%)
 Frame = +1

Query: 403 SSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           S S  D+ +DSG  SD+GSD ++++ S+S  D D  S+SD  S  +S S+
Sbjct: 566 SDSGSDSNSDSG--SDSGSDSTSDSGSDSASDSDSASDSDSASDSDSASD 613



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 803 DSDSDSDSDSDSDSDSDSDSDSESDSDSESDSDSDSDSDSDSDSDSDSASD 853



>gb:AY510088_623857 Staphylococcus capitis serine-aspartate repeat
           family protein (sdrX) gene, complete cds.
          Length = 710

 Score = 35.4 bits (80), Expect = 0.85
 Identities = 20/51 (39%), Positives = 30/51 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD GSD   ++ S+S  D D  S+SD +S  +S S+
Sbjct: 578 DSDSDSDSDSDSDSDSDCGSDSDCDSDSDSDSDSDSDSDSDSDSDSDSDSD 628



 Score = 35.4 bits (80), Expect = 0.85
 Identities = 20/51 (39%), Positives = 30/51 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD GSD   ++ S+S  D D  S+SD +S  +S S+
Sbjct: 542 DSDSDSDSDSDSDSDSDCGSDSDCDSDSDSDSDSDSDSDSDSDSDSDSDSD 592



 Score = 35.4 bits (80), Expect = 0.85
 Identities = 20/51 (39%), Positives = 30/51 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD GSD   ++ S+S  D D  S+SD +S  +S S+
Sbjct: 476 DSDSDSDSDSDSDSDSDCGSDSDCDSDSDSDSDSDSDSDSDSDSDSDSDSD 526



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 18/44 (40%), Positives = 26/44 (59%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNS 531
           +S S  D+ +DS   SD GSD   ++ S+S  D D  S+SD +S
Sbjct: 446 DSDSDSDSDSDSDSDSDCGSDSDCDSDSDSDSDSDSDSDSDSDS 489



>gb:AL935255_551144 Lactobacillus plantarum strain WCFS1 complete
            genome; segment 4/11.
          Length = 3360

 Score = 35.4 bits (80), Expect = 0.85
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SD+ SD  +++ S+S  D D  SNSD +S  +S S+
Sbjct: 2069 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSD 2119



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 18/44 (40%), Positives = 27/44 (61%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNS 531
            +S S  D+ +DS   SD+ SD  ++A S+S  D D  SN+D +S
Sbjct: 3111 DSDSDSDSDSDSDSDSDSDSDSDSDADSDSDSDSDSDSNNDSDS 3154



>gb:SAU5645_172531 Staphylococcus aureus sdrC gene.
          Length = 947

 Score = 35.4 bits (80), Expect = 0.85
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ S+S  D D  SNSD +S  +S S+
Sbjct: 729 DSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSDSNSDSDSDSDSDSD 779



>gb:AB033763_5281 Staphylococcus aureus DNA, type-I staphylococccal
            cassette chromosome mec, strain:NCTC10442.
          Length = 1698

 Score = 35.4 bits (80), Expect = 0.85
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ +DS   SDA SD  A++ S++  D D  S+SD +S  +S S+
Sbjct: 1575 ADSDSDSDADSDSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDSDSD 1628



 Score = 35.4 bits (80), Expect = 0.85
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   SD+ SD  A++ S++  D D  S+SD +S  +S S+
Sbjct: 1519 ADSDSDSDSDSDADSDSDSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSD 1572



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +D+   SDA SD  A++ S+S  D D  S+SD +S  +S S+
Sbjct: 1446 DSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDSDSDSDADSDSDSDSD 1496



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   +D+ SD  +++ ++S  D D  S+SD +S  +S S+
Sbjct: 1583 ADSDSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDSDSDSDADSDSD 1636



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 20/54 (37%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   SDA SD  +++ S++  D D  S+SD +S  ++ S+
Sbjct: 1563 ADSDSDSDSDSDADSDSDSDADSDSDSDSDSDADSDSDADSDSDADSDSDADSD 1616



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +D+   SDA SD  A++ S+S  D D  S+SD ++  +S S+
Sbjct: 1488 DSDSDSDSDSDADSDSDADSDSDADSDSDSDADSDSDSDSDSDADSDSDSD 1538



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   +D+ SD  +++ S++  D D  S+SD +S  +S S+
Sbjct: 1487 ADSDSDSDSDSDADSDSDADSDSDADSDSDSDADSDSDSDSDSDADSDSDSDSD 1540



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ ADS   SD+ SD  +++ ++S  D D  S+SD +S  +S S+
Sbjct: 1478 DSDSDSDSDADSDSDSDSDSDADSDSDADSDSDADSDSDSDADSDSDSDSD 1528



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S +  D+ ADS   +D+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1451 ADSDSDADSDSDADSDSDADSDSDSDSDSDSDSDSDADSDSDSDSDSDADSDSD 1504



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 18/54 (33%), Positives = 33/54 (61%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A ++S +  D+ ADS   +D+ SD  +++ ++S  D D  S+SD +S  +S S+
Sbjct: 1439 AKDDSDADSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDSDSDSDADSDSD 1492



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +D+   SDA SD  A++ S+S  D D  S+SD +S  ++ S+
Sbjct: 1590 DSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDSDSDSDADSDSDADSD 1640



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  +S ++
Sbjct: 1531 ADSDSDSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSDSDSDAD 1584



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +D+   SDA SD  ++A S+S  D D  ++SD +S  +S S+
Sbjct: 1494 DSDSDADSDSDADSDSDADSDSDSDADSDSDSDSDSDADSDSDSDSDSDSD 1544



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +D+   SDA SD  A++ S+S  D D  S+SD ++  +S S+
Sbjct: 1540 DSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSDSDSDADSDSDSD 1590



 Score = 32.7 bits (73), Expect = 5.5
 Identities = 18/54 (33%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S +  D+ ADS   SD+ SD  +++ S++  D D  S+SD +S  ++ S+
Sbjct: 1551 ADSDSDADSDSDADSDSDSDSDSDADSDSDSDADSDSDSDSDSDADSDSDADSD 1604



 Score = 32.7 bits (73), Expect = 5.5
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S +  D+ ADS   +D+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1542 DSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSDSDSDADSDSDSDSD 1592



 Score = 32.7 bits (73), Expect = 5.5
 Identities = 18/54 (33%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ +DS   SDA SD  +++ S+S  D D  ++SD ++  +S ++
Sbjct: 1511 ADSDSDSDADSDSDSDSDSDADSDSDSDSDSDSDADSDSDADSDSDADSDSDAD 1564



 Score = 32.7 bits (73), Expect = 5.5
 Identities = 18/54 (33%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S +  D+ ADS   SD+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 1457 ADSDSDADSDSDADSDSDSDSDSDSDSDSDADSDSDSDSDSDADSDSDADSDSD 1510



 Score = 32.7 bits (73), Expect = 5.5
 Identities = 18/54 (33%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S +  D+ ADS   +D+ SD  +++ S+S  D D  S++D +S  +S S+
Sbjct: 1445 ADSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDSDSDSDADSDSDSDSDSD 1498



 Score = 32.3 bits (72), Expect = 7.2
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  ++A S+S  D D  ++SD ++  +S ++
Sbjct: 1558 DSDSDADSDSDSDSDSDADSDSDSDADSDSDSDSDSDADSDSDADSDSDAD 1608



 Score = 32.3 bits (72), Expect = 7.2
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            ++ S  D+ ADS   SD+ SD  +++ S+S  D D  S+SD +S  ++ S+
Sbjct: 1510 DADSDSDSDADSDSDSDSDSDADSDSDSDSDSDSDADSDSDADSDSDADSD 1560



 Score = 32.3 bits (72), Expect = 7.2
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S +  D+ ADS   SDA SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1499 ADSDSDADSDSDADSDSDSDADSD--SDSDSDSDADSDSDSDSDSDSDADSDSD 1550



 Score = 32.3 bits (72), Expect = 7.2
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  A++ S++  D D  ++SD +S  +S ++
Sbjct: 1482 DSDSDADSDSDSDSDSDADSDSDADSDSDADSDSDSDADSDSDSDSDSDAD 1532



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/51 (33%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S +  D+ ADS   +D+ SD  +++ S+S  D D  S++D +S  +S S+
Sbjct: 1592 DSDADSDSDADSDSDADSDSDADSDSDSDSDSDSDSDSDADSDSDADSDSD 1642



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S +  D+ +DS   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 1528 DSDADSDSDSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSD 1578



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S +  D+ ADS   +D+ SD  A++ S+S  D D  S+SD +S  +S ++
Sbjct: 1496 DSDADSDSDADSDSDADSDSDSDADSDSDSDSDSDADSDSDSDSDSDSDAD 1546



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S++  D D  S+SD +S  +S ++
Sbjct: 1470 DSDSDSDSDSDSDSDSDADSDSDSDSDSDADSDSDADSDSDADSDSDSDAD 1520



>gb:BX571856_780031 Staphylococcus aureus subsp. aureus strain
           MRSA252, complete genome.
          Length = 906

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 20/52 (38%), Positives = 31/52 (59%)
 Frame = +1

Query: 397 ENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           E  +S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 705 EEETSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSD 756



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 20/50 (40%), Positives = 30/50 (60%)
 Frame = +1

Query: 403 SSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 735 SDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSD 784



>gb:BA000017_676507 Staphylococcus aureus subsp. aureus Mu50 DNA,
           complete genome.
          Length = 935

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 750 DSDSDSDSDSDSDSDSDSASDSDSDSDSESDSDSDSDSDSDSDSDSDSDSD 800



 Score = 35.0 bits (79), Expect = 1.1
 Identities = 21/50 (42%), Positives = 32/50 (64%)
 Frame = +1

Query: 403 SSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           S S  D+ +DSG  SD+GSD ++++ S+S  D D  S+SD  S  +S S+
Sbjct: 567 SDSGSDSNSDSG--SDSGSDSTSDSGSDSASDSDSASDSDSASDSDSASD 614



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+S+ +S  +S S+
Sbjct: 774 DSDSESDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSESDSDSDSDSD 824



>gb:CP000046_91008 Staphylococcus aureus subsp. aureus COL, complete
           genome.
          Length = 933

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 21/50 (42%), Positives = 32/50 (64%)
 Frame = +1

Query: 403 SSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           S S  D+ +DSG  SD+GSD ++++ S+S  D D  S+SD  S  +S S+
Sbjct: 567 SDSGSDSNSDSG--SDSGSDSTSDSGSDSASDSDSASDSDSASDSDSASD 614



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 786 DSDSDSDSDSDSDSDSDSDSDSESDSDSESDSDSDSDSDSDSDSDSDSDSD 836



>pir|D89852|D89852 fibrinogen-binding protein A, clumping factor
           [imported] - Staphylococcus aureus (strain
           N315)>gb:BA000018_679157 Staphylococcus aureus subsp.
           aureus N315 genomic DNA, complete genome.
          Length = 989

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 804 DSDSDSDSDSDSDSDSDSASDSDSDSDSESDSDSDSDSDSDSDSDSDSDSD 854



 Score = 35.0 bits (79), Expect = 1.1
 Identities = 21/50 (42%), Positives = 32/50 (64%)
 Frame = +1

Query: 403 SSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           S S  D+ +DSG  SD+GSD ++++ S+S  D D  S+SD  S  +S S+
Sbjct: 567 SDSGSDSNSDSG--SDSGSDSTSDSGSDSASDSDSASDSDSASDSDSASD 614



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+S+ +S  +S S+
Sbjct: 828 DSDSESDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSESDSDSDSDSD 878



>pir|S41539|S41539 fibrinogen-binding protein - Staphylococcus
           aureus>gb:SACFG_169389 S.aureus gene for clumping
           factor.
          Length = 933

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 21/50 (42%), Positives = 32/50 (64%)
 Frame = +1

Query: 403 SSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           S S  D+ +DSG  SD+GSD ++++ S+S  D D  S+SD  S  +S S+
Sbjct: 567 SDSGSDSNSDSG--SDSGSDSTSDSGSDSASDSDSASDSDSASDSDSASD 614



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 786 DSDSDSDSDSDSDSDSDSDSDSESDSDSESDSDSDSDSDSDSDSDSDSDSD 836



>sp|P80544|PLS_STAAU Surface protein precursor (Plasmin-sensitive
            surface protein) (230 kDa cell-wall
            protein).>gb:AF115379_480115 Staphylococcus aureus
            surface protein Pls (pls) gene, complete cds.
          Length = 1637

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +D+   SDA SD  ++A S+S  D D  S+SD +S  +S S+
Sbjct: 1353 DSDSDADSDSDADSDSDADSDSDSDADSDSDSDADSDSDSDSDSDADSDSD 1403



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/54 (37%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S +  D+ ADS   SDA SD  ++A S+S  D D  ++SD +S  +S ++
Sbjct: 1358 ADSDSDADSDSDADSDSDSDADSDSDSDADSDSDSDSDSDADSDSDSDSDSDAD 1411



 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +D+   SDA SD  A++ S+S  D D  S+SD +S  +S S+
Sbjct: 1305 DSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDSDSDSDADSDSDSDSD 1355



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S+S  D D  ++SD +S  +S S+
Sbjct: 1483 DSDSDADSDSDSDSDSDADSDSDSDSDSDSDADSDSDADSDSDSDADSDSD 1533



 Score = 34.3 bits (77), Expect = 1.9
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  A++ S+S  D D  S+SD +S  ++ S+
Sbjct: 1393 DSDSDADSDSDSDSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSDADSD 1443



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +D+   SDA SD  A++ S+S  D D  S+SD +S  +S S+
Sbjct: 1529 DSDSDADSDSDADGDSDADSDSDADSDSDSDSDSDSDSDSDADSDSDSDSD 1579



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   SD+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 1416 ADSDSDSDSDSDADSDSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSD 1469



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   SD+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 1386 ADSDSDSDSDSDADSDSDSDSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSD 1439



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +D+   SDA SD  A++ S+S  D D  S++D +S  +S S+
Sbjct: 1347 DSDSDSDSDSDADSDSDADSDSDADSDSDSDADSDSDSDADSDSDSDSDSD 1397



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  A++ S++  D D  ++SD +S  +S S+
Sbjct: 1341 DSDSDADSDSDSDSDSDADSDSDADSDSDADSDSDSDADSDSDSDADSDSD 1391



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S +  D+ ADS   +D+ SD  +++ S+S  D D  S+SD +S  +S S+
Sbjct: 1310 ADSDSDADSDSDADSDSDADSDSDSDSDSDSDSDSDADSDSDSDSDSDADSDSD 1363



 Score = 33.9 bits (76), Expect = 2.5
 Identities = 18/54 (33%), Positives = 33/54 (61%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A ++S +  D+ ADS   +D+ SD  +++ ++S  D D  S+SD +S  +S S+
Sbjct: 1298 AKDDSDADSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDSDSDSDADSDSD 1351



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S +  D+ ADS   SDA SD  A++ S++  D D  S+SD +S  +S S+
Sbjct: 1511 DSDADSDSDADSDSDSDADSDSDADSDSDADGDSDADSDSDADSDSDSDSD 1561



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S +  D+ ADS   SD+ SD  +++ S+S  D D  S+SD +S  +S ++
Sbjct: 1476 ADSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSDSDADSDSDADSDSDSDAD 1529



 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  +S S+
Sbjct: 1459 DSDSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSDSDSDSD 1509



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +D+   SDA SD  A++ S+S  D D  S+SD +S  +S ++
Sbjct: 1465 DSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSDSDAD 1515



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 1453 DSDSDADSDSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSD 1503



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +D+   SDA SD  A++ S+S  D D  S+SD +S  ++ S+
Sbjct: 1435 DSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSDSDADSDSDADSD 1485



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 18/54 (33%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 1428 ADSDSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSDSDADSDSD 1481



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 19/51 (37%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 1423 DSDSDADSDSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSD 1473



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S +  D+ ADS   SD+ SD  +++ S+S  D D  S++D +S  +S S+
Sbjct: 1407 DSDADSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDADSDSDADSDSD 1457



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ +DS   SDA SD  +++ S++  D D  S+SD +S  ++ S+
Sbjct: 1378 ADSDSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDADSDSDSDSDSDADSD 1431



 Score = 32.7 bits (73), Expect = 5.5
 Identities = 19/54 (35%), Positives = 31/54 (57%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S +  D+ +D+   SDA SD  A+  S++  D D  S+SD +S  +S S+
Sbjct: 1514 ADSDSDADSDSDSDADSDSDADSDSDADGDSDADSDSDADSDSDSDSDSDSDSD 1567



 Score = 32.7 bits (73), Expect = 5.5
 Identities = 18/54 (33%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 1458 ADSDSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSD 1511



 Score = 32.7 bits (73), Expect = 5.5
 Identities = 18/54 (33%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S +  D+ ADS   SD+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 1446 ADSDSDADSDSDADSDSDSDSDSDADSDSDADSDSDADSDSDADSDSDSDSDSD 1499



 Score = 32.7 bits (73), Expect = 5.5
 Identities = 18/54 (33%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 1398 ADSDSDSDSDSDADSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDADSDSD 1451



 Score = 32.7 bits (73), Expect = 5.5
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            ++ S  D+ ADS   SD+ SD  +++ S+S  D D  S++D +S  +S S+
Sbjct: 1377 DADSDSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDADSDSDSDSDSD 1427



 Score = 32.7 bits (73), Expect = 5.5
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S +  D+ ADS   +D+ SD  A++ S+S  D D  S+SD ++  +S S+
Sbjct: 1355 DSDADSDSDADSDSDADSDSDSDADSDSDSDADSDSDSDSDSDADSDSDSD 1405



 Score = 32.7 bits (73), Expect = 5.5
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ ADS   SD+ SD  +++ ++S  D D  S+SD +S  +S ++
Sbjct: 1337 DSDSDSDSDADSDSDSDSDSDADSDSDADSDSDADSDSDSDADSDSDSDAD 1387



 Score = 32.7 bits (73), Expect = 5.5
 Identities = 18/54 (33%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S +  D+ ADS   SD+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 1316 ADSDSDADSDSDADSDSDSDSDSDSDSDSDADSDSDSDSDSDADSDSDADSDSD 1369



 Score = 32.7 bits (73), Expect = 5.5
 Identities = 18/54 (33%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S +  D+ ADS   +D+ SD  +++ S+S  D D  S++D +S  +S S+
Sbjct: 1304 ADSDSDADSDSDADSDSDADSDSDADSDSDSDSDSDSDSDSDADSDSDSDSDSD 1357



 Score = 32.3 bits (72), Expect = 7.2
 Identities = 21/54 (38%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ ADS   SD+ SD  ++A S+S  D D  S++D +S  +S S+
Sbjct: 1488 ADSDSDSDSDSDADSDSDSDSDSD--SDADSDSDADSDSDSDADSDSDADSDSD 1539



 Score = 32.3 bits (72), Expect = 7.2
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            ++ S  D+ ADS   SDA SD  +++ S++  D D  S+SD +S  ++ S+
Sbjct: 1369 DADSDSDSDADSDSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDADSD 1419



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/54 (33%), Positives = 31/54 (57%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  +S S  D+ +D+   SDA  D  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 1520 ADSDSDSDADSDSDADSDSDADGDSDADSDSDADSDSDSDSDSDSDSDSDADSD 1573



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/51 (33%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S +  D+ ADS   +D+ SD  +++ S+S  D D  S++D +S  +S S+
Sbjct: 1437 DSDADSDSDADSDSDADSDSDADSDSDSDSDSDADSDSDADSDSDADSDSD 1487



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S++  D D  S+SD +S  ++ S+
Sbjct: 1411 DSDSDADSDSDSDSDSDADSDSDSDSDSDADSDSDADSDSDADSDSDADSD 1461



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SDA SD  +++ S++  D D  S+SD +S  +S ++
Sbjct: 1329 DSDSDSDSDSDSDSDSDADSDSDSDSDSDADSDSDADSDSDADSDSDSDAD 1379



>gb:BC076799_2559542 Xenopus laevis cDNA clone MGC:83736
           IMAGE:6639932, complete cds.
          Length = 554

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 19/54 (35%), Positives = 24/54 (44%)
 Frame = -2

Query: 649 PFDXDDRKKERTPSPMDSISKSSTYQPDPAFDTLISSSRSNSDQNWTPYHRLTW 488
           PF    ++ ER  SP   +S SS Y PDP      S   +  +   TP H  TW
Sbjct: 49  PFPITPQRNERGLSPTQELSPSSDYSPDP------SDKGAGGECPGTPLHYSTW 96



>gb:BX571857_782739 Staphylococcus aureus strain MSSA476, complete
            genome.
          Length = 1365

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 1197 DSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSD 1247



>gb:BA000033_710809 Staphylococcus aureus subsp. aureus MW2 DNA,
            complete genome, strain:MW2.
          Length = 1347

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 1203 DSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSD 1253



>gb:AF404823_507798 Staphylococcus lugdunensis strain 2342 receptin
           Fbl precursor (fbl) gene, complete cds.
          Length = 881

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  NS S+
Sbjct: 744 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSNSGSD 794



 Score = 33.1 bits (74), Expect = 4.2
 Identities = 18/54 (33%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  SNS  +S ++S S+
Sbjct: 749 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSNSGSDSNVDSDSD 802



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 738 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 788



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 19/62 (30%), Positives = 33/62 (53%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSEYQMQDL 570
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S       
Sbjct: 737 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSNSGSDSN 796

Query: 571 VD 576
           VD
Sbjct: 797 VD 798



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 732 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 782



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 731 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 784



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 726 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 776



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 725 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 778



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 720 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 770



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 719 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 772



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 714 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 764



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 713 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 766



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 708 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 758



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 707 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 760



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 702 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 752



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 701 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 754



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 696 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 746



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 695 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 748



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 690 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 740



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 689 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 742



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 684 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 734



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 683 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 736



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 678 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 728



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 677 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 730



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 672 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 722



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 671 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 724



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 666 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 716



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 665 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 718



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 660 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 710



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 659 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 712



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 654 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 704



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 653 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 706



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 648 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 698



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 647 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 700



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 642 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 692



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 641 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 694



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 636 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 686



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 635 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 688



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 630 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 680



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 629 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 682



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 624 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 674



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 623 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 676



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 618 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 668



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 617 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 670



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 612 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 662



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 611 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 664



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 606 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 656



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 605 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 658



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 600 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 650



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 599 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 652



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 594 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 644



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 593 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 646



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 588 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 638



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 587 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 640



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 582 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 632



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 581 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 634



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 576 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 626



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 575 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 628



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 570 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 620



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 569 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 622



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 564 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 614



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 563 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 616



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 558 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 608



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 557 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 610



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 552 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 602



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 551 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 604



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 18/51 (35%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +D+   SDA SD  A++ S++  D D  S+SD +S  ++ S+
Sbjct: 546 DSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSD 596



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/54 (31%), Positives = 32/54 (59%)
 Frame = +1

Query: 391 ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           A  +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 545 ADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 598



 Score = 32.0 bits (71), Expect = 9.4
 Identities = 16/51 (31%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S +  D+ ADS   +D+ SD  +++ ++S  D D  S++D +S  +S S+
Sbjct: 536 DSDAYSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSDADSDSD 586



>pir|C89824|C89824 hypothetical protein sdrC [imported] -
           Staphylococcus aureus (strain N315)>gb:BA000017_676259
           Staphylococcus aureus subsp. aureus Mu50 DNA, complete
           genome.>gb:BA000018_678932 Staphylococcus aureus subsp.
           aureus N315 genomic DNA, complete genome.
          Length = 953

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/51 (39%), Positives = 31/51 (60%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
           +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD +S  +S S+
Sbjct: 745 DSDSDSDSDSDSDSDSDSDSDSDSDSDSESDSDSDSDSDSDSDSDSDSDSD 795



>pir|T30214|T30214 fibrinogen-binding protein - Staphylococcus
            epidermidis>gb:SEY17116_182662 Staphylococcus epidermidis
            gene encoding fibrinogen-binding protein, complete CDS.
          Length = 1092

 Score = 34.7 bits (78), Expect = 1.5
 Identities = 20/56 (35%), Positives = 34/56 (60%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSEYQMQD 567
            +S S  D+ +DS  +SD+ SD  +++ S+S  D D  S+SD +S L + S+   +D
Sbjct: 998  DSDSDSDSDSDSDSVSDSDSDSDSDSGSDS--DSDSDSDSDNDSDLGNSSDKSTKD 1051



>gb:AY372242_2530520 Danio rerio starmaker mRNA, complete cds.
          Length = 613

 Score = 34.3 bits (77), Expect = 1.9
 Identities = 19/56 (33%), Positives = 33/56 (58%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSEYQMQD 567
           +S S  D+ +DS   S + SD  +++ S+S  D D  S+SD +S  NS+ + + +D
Sbjct: 422 DSDSHSDSDSDSHSDSHSDSDSDSHSDSDSDSDSDSDSDSDSDSDSNSRDKEEKKD 477



>gb:AK175783_1817771 Arabidopsis thaliana mRNA for putative
           RNA-binding protein, partial cds, clone:
           RAFL22-37-B16.>gb:AK175969_1817957 Arabidopsis thaliana
           mRNA for putative RNA-binding protein, partial cds,
           clone: RAFL22-66-A06.
          Length = 295

 Score = 34.3 bits (77), Expect = 1.9
 Identities = 21/30 (70%), Positives = 22/30 (73%), Gaps = 1/30 (3%)
 Frame = +1

Query: 541 SKSEY-QMQDLVDMLKTLKLNPLAKEFFPS 627
           SK EY QM+ LV M K  KLNP AKEFFPS
Sbjct: 30  SKPEYDQMKKLVAMFK--KLNPEAKEFFPS 57



>pir|F96576|F96576 probable RNA-binding protein, 40942-42923
           [imported] - Arabidopsis thaliana>gb:AE005173_893264
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC024260_1539294 Arabidopsis thaliana
           chromosome 1 BAC F22G10 genomic sequence, complete
           sequence.>gb:BT014885_1641875 Arabidopsis thaliana
           unknown protein (At1g53650) mRNA, complete cds.
          Length = 314

 Score = 34.3 bits (77), Expect = 1.9
 Identities = 21/30 (70%), Positives = 22/30 (73%), Gaps = 1/30 (3%)
 Frame = +1

Query: 541 SKSEY-QMQDLVDMLKTLKLNPLAKEFFPS 627
           SK EY QM+ LV M K  KLNP AKEFFPS
Sbjct: 43  SKPEYDQMKKLVAMFK--KLNPEAKEFFPS 70



>gb:BX571857_782738 Staphylococcus aureus strain MSSA476, complete
            genome.
          Length = 957

 Score = 33.9 bits (76), Expect = 2.5
 Identities = 24/68 (35%), Positives = 34/68 (50%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSEYQMQDLVDM 579
            +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD      +K    M  + D 
Sbjct: 857  DSDSDSDSDSDSDSDSDSDSDSDSDSDSESDADSDTDSDSDAGKHTPAK---PMSTVKDQ 913

Query: 580  LKTLKLNP 603
             KT K  P
Sbjct: 914  HKTAKALP 921



>gb:BA000033_710808 Staphylococcus aureus subsp. aureus MW2 DNA,
            complete genome, strain:MW2.
          Length = 955

 Score = 33.9 bits (76), Expect = 2.5
 Identities = 24/68 (35%), Positives = 34/68 (50%)
 Frame = +1

Query: 400  NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSEYQMQDLVDM 579
            +S S  D+ +DS   SD+ SD  +++ SES  D D  S+SD      +K    M  + D 
Sbjct: 855  DSDSDSDSDSDSDSDSDSDSDSDSDSDSESDADSDTDSDSDAGKHTPAK---PMSTVKDQ 911

Query: 580  LKTLKLNP 603
             KT K  P
Sbjct: 912  HKTAKALP 919



>gb:AF035443_2469792 Xenopus laevis wee1 homolog mRNA, complete cds.
          Length = 554

 Score = 33.5 bits (75), Expect = 3.2
 Identities = 19/54 (35%), Positives = 23/54 (42%)
 Frame = -2

Query: 649 PFDXDDRKKERTPSPMDSISKSSTYQPDPAFDTLISSSRSNSDQNWTPYHRLTW 488
           PF    ++ ER  SP   +S SS Y PDP      S      +   TP H  TW
Sbjct: 49  PFPITPQRNERGLSPTQELSPSSDYSPDP------SDKGVGGECPGTPLHYSTW 96



>gb:ATH277884_1552254 Arabidopsis thaliana mRNA for inositol
            1,4,5-trisphosphate 5-phosphatase (ipp3 gene).
          Length = 1280

 Score = 33.5 bits (75), Expect = 3.2
 Identities = 20/54 (37%), Positives = 25/54 (46%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +   S SL  N  DS   S   SD  +N+KS    DGD  S S   S  +S S+
Sbjct: 1106 SNSKSQSLKKNEGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSK 1159



>gb:AY572435_1338117 Plasmodium reichenowi erythrocyte invasion
           ligand JSEBL/EBA-181 gene, partial cds.
          Length = 1497

 Score = 33.5 bits (75), Expect = 3.2
 Identities = 15/40 (37%), Positives = 24/40 (60%)
 Frame = +1

Query: 445 SDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSEYQMQ 564
           S+   +L  N  S S++ G+KG+NSD   I+  K+E Q +
Sbjct: 738 SEEEEELQGNNNSVSVISGNKGTNSDTKVIVKDKNEKQQE 777



>gb:AB188680_1202843 Cotesia glomerata mRNA for asparagine-rich
           cocoon silk protein, partial cds.
          Length = 255

 Score = 33.5 bits (75), Expect = 3.2
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 4/54 (7%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPN----SILNSKS 549
           NS +  ++Y++S   S+A SD ++N+ S S  +G+  SNS+ N    S  NS S
Sbjct: 85  NSGANANSYSNSNSNSNANSDANSNSYSNSGANGNSNSNSNSNSNANSDANSNS 138



>pir|T00670|T00670 probable inositol polyphosphate 5'-phosphatase
            [imported] - Arabidopsis thaliana>gb:AC004005_1531300
            Arabidopsis thaliana chromosome 2 clone F6E13 map
            CIC10F02, CIC02E07, complete
            sequence.>gb:AY761187_1627056 Arabidopsis thaliana
            inositol polyphosphate 5-phosphatase (At5PTase12) mRNA,
            complete cds.>gb:AY761191_1627060 Arabidopsis thaliana
            inositol polyphosphate 5-phosphatase (At5PTase12) gene,
            complete cds.
          Length = 1305

 Score = 33.5 bits (75), Expect = 3.2
 Identities = 20/54 (37%), Positives = 25/54 (46%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            +   S SL  N  DS   S   SD  +N+KS    DGD  S S   S  +S S+
Sbjct: 1106 SNSKSQSLKKNEGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSK 1159



>gb:BC081031_2561940 Xenopus laevis Wee1A kinase, mRNA (cDNA clone
           MGC:81696 IMAGE:6864894), complete cds.
          Length = 555

 Score = 33.1 bits (74), Expect = 4.2
 Identities = 18/54 (33%), Positives = 24/54 (44%)
 Frame = -2

Query: 649 PFDXDDRKKERTPSPMDSISKSSTYQPDPAFDTLISSSRSNSDQNWTPYHRLTW 488
           PF    ++ ER  SP   +S SS Y PDP+           ++   TP H  TW
Sbjct: 49  PFPITPQRNERELSPTQELSPSSDYSPDPSV---------GAECPGTPLHYSTW 93



>gb:CR380953_1650720 Candida glabrata strain CBS138 chromosome G
           complete sequence.
          Length = 371

 Score = 33.1 bits (74), Expect = 4.2
 Identities = 18/54 (33%), Positives = 31/54 (57%)
 Frame = +1

Query: 388 TATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKS 549
           +++ +SSS   +   S   S + SD S+++ SES    D GS+S+ +S  +S S
Sbjct: 44  SSSSSSSSSSSDSESSSTSSSSSSDSSSSSSSESSSSSDSGSDSESSSSSSSSS 97



>sp|P47817|WEE1_XENLA Wee1-like protein kinase (EC
           2.7.1.112).>pir|I51671|I51671 Wee1A kinase - African
           clawed frog>gb:XLU13962_2583231 Xenopus laevis Wee1A
           kinase (Xe-Wee1A) mRNA, complete cds.
          Length = 555

 Score = 33.1 bits (74), Expect = 4.2
 Identities = 18/54 (33%), Positives = 24/54 (44%)
 Frame = -2

Query: 649 PFDXDDRKKERTPSPMDSISKSSTYQPDPAFDTLISSSRSNSDQNWTPYHRLTW 488
           PF    ++ ER  SP   +S SS Y PDP+           ++   TP H  TW
Sbjct: 49  PFPITPQRNERELSPTQELSPSSDYSPDPSV---------GAECPGTPLHYSTW 93



>gb:AP002093_1821998 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0466B10.>gb:AP003052_1824498 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OSJNBa0016I09.
          Length = 308

 Score = 32.7 bits (73), Expect = 5.5
 Identities = 19/31 (61%), Positives = 23/31 (74%), Gaps = 2/31 (6%)
 Frame = +1

Query: 544 KSEYQ--MQDLVDMLKTLKLNPLAKEFFPSS 630
           ++EYQ  +Q LVD+L   KLNP AKEF PSS
Sbjct: 25  EAEYQKGVQKLVDLLS--KLNPAAKEFVPSS 53



>gb:CR382137_1670011 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 679

 Score = 32.7 bits (73), Expect = 5.5
 Identities = 19/63 (30%), Positives = 37/63 (58%), Gaps = 6/63 (9%)
 Frame = +1

Query: 400 NSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGS------NSDPNSILNSKSEYQM 561
           +S S  D+ +DS   SD+ SD S+ ++SES  + + GS      +S+ +S ++S +E   
Sbjct: 53  SSDSSSDSSSDSSSESDSDSDSSSESESESEPESESGSQDSKKSSSESDSAMSSDTEEAS 112

Query: 562 QDL 570
           +++
Sbjct: 113 EEI 115



 Score = 32.7 bits (73), Expect = 5.5
 Identities = 22/54 (40%), Positives = 30/54 (55%)
 Frame = +1

Query: 397 ENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSEYQ 558
           E SSS   + +DS   SD+ SD S+++ SES  D D  S S+  S   S+S  Q
Sbjct: 40  ETSSS--SSGSDSDSSSDSSSDSSSDSSSESDSDSDSSSESESESEPESESGSQ 91



>gb:AF402316_507690 Staphylococcus saprophyticus surface protein SdrI
            gene, complete cds.
          Length = 1893

 Score = 32.7 bits (73), Expect = 5.5
 Identities = 18/54 (33%), Positives = 32/54 (59%)
 Frame = +1

Query: 391  ATENSSSLPDNYADSGKISDAGSDLSANAKSESMLDGDKGSNSDPNSILNSKSE 552
            A  ++ +  D+ AD+   SDA SD  A+A S++  D D  S++D +S  ++ S+
Sbjct: 1450 ADSDADADADSDADADADSDADSDADADADSDADADADADSDADADSDADADSD 1503



>gb:AF434681_1799705 Arabidopsis thaliana arogenate dehydrogenase
           mRNA, complete cds.
          Length = 640

 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/66 (25%), Positives = 32/66 (48%)
 Frame = +3

Query: 72  ICHNLECIYYSFFFFHNNFINLCERINIVLPFK*INKYGDYPILKAVLLPLIFGIIKIES 251
           IC +   +YY  F ++NN + + ERI++            +  L+  L   + G+++ +S
Sbjct: 268 ICGDSFDLYYGLFVYNNNSLEVLERIDLA-----------FEALRKELFSRLHGVVRKQS 316

Query: 252 LEGLIK 269
            EG  K
Sbjct: 317 FEGEAK 322



>gb:AX457119_1468871 Sequence 4 from Patent WO0246441.
          Length = 310

 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/66 (25%), Positives = 32/66 (48%)
 Frame = +3

Query: 72  ICHNLECIYYSFFFFHNNFINLCERINIVLPFK*INKYGDYPILKAVLLPLIFGIIKIES 251
           IC +   +YY  F ++NN + + ERI++            +  L+  L   + G+++ +S
Sbjct: 233 ICGDSFDLYYGLFVYNNNSLEVLERIDLA-----------FEALRKELFSRLHGVVRKQS 281

Query: 252 LEGLIK 269
            EG  K
Sbjct: 282 FEGEAK 287



>gb:AX457117_1468870 Sequence 2 from Patent WO0246441.
          Length = 660

 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/66 (25%), Positives = 32/66 (48%)
 Frame = +3

Query: 72  ICHNLECIYYSFFFFHNNFINLCERINIVLPFK*INKYGDYPILKAVLLPLIFGIIKIES 251
           IC +   +YY  F ++NN + + ERI++            +  L+  L   + G+++ +S
Sbjct: 290 ICGDSFDLYYGLFVYNNNSLEVLERIDLA-----------FEALRKELFSRLHGVVRKQS 338

Query: 252 LEGLIK 269
            EG  K
Sbjct: 339 FEGEAK 344



>pir|T01952|T01952 hypothetical protein T2L5.1 - Arabidopsis
           thaliana>gb:AB028613_1517957 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1
           clone:MGG23.>gb:T2L5_1723981 Arabidopsis thaliana BAC
           T2L5.
          Length = 662

 Score = 32.0 bits (71), Expect = 9.4
 Identities = 17/66 (25%), Positives = 32/66 (48%)
 Frame = +3

Query: 72  ICHNLECIYYSFFFFHNNFINLCERINIVLPFK*INKYGDYPILKAVLLPLIFGIIKIES 251
           IC +   +YY  F ++NN + + ERI++            +  L+  L   + G+++ +S
Sbjct: 290 ICGDSFDLYYGLFVYNNNSLEVLERIDLA-----------FEALRKELFSRLHGVVRKQS 338

Query: 252 LEGLIK 269
            EG  K
Sbjct: 339 FEGEAK 344


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 551,534,268
Number of Sequences: 1806583
Number of extensions: 9987494
Number of successful extensions: 35944
Number of sequences better than 10.0: 63
Number of HSP's better than 10.0 without gapping: 33195
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 35788
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 35417417455
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)