BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig5047
         (521 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY052303_1562676 Arabidopsis thaliana AT5g11170/F2I11_60 mRNA...   182   3e-45   
gb:ATH010466_1551899 Arabidopsis thaliana mRNA for DEAD box RNA ...   182   3e-45   
gb:ATF2I11_1550468 Arabidopsis thaliana DNA chromosome 5, BAC cl...   182   3e-45   
gb:ATF2I11_1550465 Arabidopsis thaliana DNA chromosome 5, BAC cl...   182   3e-45   
pir|T51343|T51343 RNA helicase RH15 [imported] - Arabidopsis tha...   182   3e-45   Arabidopsis thaliana [mouse-ear cress]
gb:AP004225_1838948 Oryza sativa (japonica cultivar-group) genom...   160   1e-38   
gb:AP004225_1838946 Oryza sativa (japonica cultivar-group) genom...   160   1e-38   
gb:BC044169_2548558 Danio rerio DEAD (Asp-Glu-Ala-Asp) box polyp...   154   8e-37   
pir|I47126|I47126 nuclear RNA helicase (DEAD family) BAT1 - pig>...   154   8e-37   Sus scrofa [pigs]
gb:BC071505_2556241 Danio rerio zgc:55881, mRNA (cDNA clone MGC:...   153   2e-36   
gb:BC055240_2551319 Danio rerio zgc:63773, mRNA (cDNA clone MGC:...   152   2e-36   
gb:AF391287_1267424 Branchiostoma floridae cosmid MPMGc117C0356,...   152   4e-36   
gb:BC045125_2549057 Xenopus laevis nuclear RNA helicase, mRNA (c...   151   6e-36   
gb:AJ720994_2503181 Gallus gallus mRNA for hypothetical protein,...   150   8e-36   
gb:BT008096_2151028 Synthetic construct Homo sapiens HLA-B assoc...   150   8e-36   
gb:BC020134_2093288 Mus musculus DEAD (Asp-Glu-Ala-Asp) box poly...   150   8e-36   
gb:AF387339_2064639 Rattus norvegicus IkBL, vacuolar ATPase NG38...   150   8e-36   
gb:HSY14768_2028380 Homo sapiens DNA, cosmid clones TN62 and TN82.    150   8e-36   
gb:BX248516_1991661 Human DNA sequence from clone DASS-161H22 on...   150   8e-36   
gb:BX248516_1991659 Human DNA sequence from clone DASS-161H22 on...   150   8e-36   
gb:BX248516_1991658 Human DNA sequence from clone DASS-161H22 on...   150   8e-36   
gb:BX001040_1991475 Human DNA sequence from clone DAQB-72H16 on ...   150   8e-36   
gb:BX001040_1991474 Human DNA sequence from clone DAQB-72H16 on ...   150   8e-36   
gb:AL662801_1931488 Human DNA sequence from clone XXbac-296P20 o...   150   8e-36   
gb:AL662801_1931487 Human DNA sequence from clone XXbac-296P20 o...   150   8e-36   
gb:AL662801_1931486 Human DNA sequence from clone XXbac-296P20 o...   150   8e-36   
gb:AL662801_1931485 Human DNA sequence from clone XXbac-296P20 o...   150   8e-36   
gb:AX885456_1480909 Sequence 1319 from Patent EP1033401.              150   8e-36   
gb:AY423389_1430089 Canis familiaris BAC 231G24 MHC class I locu...   150   8e-36   
gb:CR859800_1183903 Pongo pygmaeus mRNA; cDNA DKFZp469F1834 (fro...   150   8e-36   
gb:AK051034_1169553 Mus musculus 9 days embryo whole body cDNA, ...   150   8e-36   
pir|A42811|A42811 nuclear RNA helicase (DEAD family) homolog - r...   150   8e-36   Rattus norvegicus [brown rat]
sp|Q63413|HE47_RAT|HE47_RAT Probable ATP-dependent RNA helicase p47.           150   8e-36   Rattus norvegicus [brown rat]
sp|Q13838|HE47_HUMAN|HE47_HUMAN Probable ATP-dependent RNA helicase p47 (HL...   150   8e-36   Homo sapiens [man]
gb:BC086328_2109523 Rattus norvegicus nuclear RNA helicase, DECD...   150   1e-35   
gb:AF063447_2052988 Rattus norvegicus nuclear RNA helicase mRNA,...   150   1e-35   
gb:BT021050_1436408 Bos taurus DEAD (Asp-Glu-Ala-Asp) box polype...   150   1e-35   
gb:BC032128_1980336 Homo sapiens DEAD (Asp-Glu-Ala-Asp) box poly...   150   1e-35   
gb:BC010455_1972648 Homo sapiens DEAD (Asp-Glu-Ala-Asp) box poly...   150   1e-35   
gb:BC001009_1967207 Homo sapiens DEAD (Asp-Glu-Ala-Asp) box poly...   150   1e-35   
gb:AY298950_2525768 Xenopus laevis DECD-box RNA helicase (DDX39)...   149   2e-35   
gb:BC082368_2562605 Xenopus laevis MGC81606 protein, mRNA (cDNA ...   149   2e-35   
gb:BC061280_2553057 Xenopus tropicalis hypothetical protein MGC7...   149   2e-35   
gb:BX248516_1991660 Human DNA sequence from clone DASS-161H22 on...   149   3e-35   
gb:BX001040_1991476 Human DNA sequence from clone DAQB-72H16 on ...   149   3e-35   
gb:AL662801_1931489 Human DNA sequence from clone XXbac-296P20 o...   149   3e-35   
gb:AK026614_1910664 Homo sapiens cDNA: FLJ22961 fis, clone KAT10...   148   5e-35   
gb:HSU90426_2027133 Human nuclear RNA helicase, complete cds.         147   7e-35   
gb:AF075691_1239002 Crassostrea gigas BAT1 homolog mRNA, complet...   147   7e-35   
gb:AL662801_1931490 Human DNA sequence from clone XXbac-296P20 o...   147   9e-35   
gb:AX885457_1480910 Sequence 1320 from Patent EP1033401.              147   9e-35   
pir|T37846|T37846 probable ATP-dependent RNA helicase - fission ...   144   1e-33   Schizosaccharomyces pombe
gb:AE017341_1754546 Cryptococcus neoformans var. neoformans JEC2...   142   4e-33   
gb:AE017341_1754545 Cryptococcus neoformans var. neoformans JEC2...   142   4e-33   
gb:CEU08102_1368390 Caenorhabditis elegans putative RNA helicase...   140   1e-32   
gb:CEC26D10_1360684 Caenorhabditis elegans cosmid C26D10, comple...   140   1e-32   
sp|Q18212|HE47_CAEEL|HE47_CAEEL Probable ATP-dependent RNA helicase p47 hom...   140   1e-32   Caenorhabditis elegans [roundworm]
sp|Q27268|HE47_DROME|HE47_DROME Probable ATP-dependent RNA helicase WM6.>pi...   139   3e-32   Drosophila melanogaster
gb:CTE428513_1375860 Chironomus tentans mRNA for HEL protein.         139   3e-32   
gb:AY223417_1176876 Schistosoma japonicum clone ZZZ368 mRNA sequ...   137   1e-31   
gb:CR380958_1653373 Candida glabrata strain CBS138 chromosome L ...   133   1e-30   
gb:CR382125_1658207 Kluyveromyces lactis strain NRRL Y-1140 chro...   131   7e-30   
sp|Q07478|SUB2_YEAST|SUB2_YEAST Probable ATP-dependent RNA helicase SUB2.>p...   129   3e-29   Saccharomyces cerevisiae [brewer's yeast]
gb:AE016817_1747644 Ashbya gossypii (= Eremothecium gossypii) AT...   127   8e-29   
gb:AX716945_1473722 Sequence 56 from Patent WO03020757.               123   1e-27   
pir|G71614|G71614 eIF-4A-like DEAD family RNA helicase PFB0445c ...   112   4e-24   Plasmodium falciparum 3D7
gb:AY231673_1176966 Drosophila yakuba clone yak-em_Hel25E mRNA s...   106   2e-22   
gb:AY142142_1303370 Giardia intestinalis putative RNA helicase g...    82   4e-15   
gb:YLAJ11564_1727886 Yarrowia lipolytica DHH1 gene.                    82   6e-15   
gb:CR382132_1665823 Yarrowia lipolytica chromosome F of strain C...    82   6e-15   
gb:CR380955_1651662 Candida glabrata strain CBS138 chromosome I ...    79   4e-14   
gb:CR382123_1656205 Kluyveromyces lactis strain NRRL Y-1140 chro...    78   7e-14   
sp|P39517|DHH1_YEAST|DHH1_YEAST Putative ATP-dependent RNA helicase DHH1.>p...    78   7e-14   Saccharomyces cerevisiae [brewer's yeast]
gb:CR382138_1670944 Debaryomyces hansenii chromosome F of strain...    74   1e-12   
gb:AY039862_1560376 Arabidopsis thaliana At2g45810/F4I18.21 mRNA...    73   3e-12   
gb:CR382127_1659975 Yarrowia lipolytica chromosome A of strain C...    72   4e-12   
gb:AE016816_1746887 Ashbya gossypii (= Eremothecium gossypii) AT...    72   5e-12   
pir|T02466|T02466 probable ATP-dependent RNA helicase [imported]...    71   8e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AC084023_1733314 Oryza sativa chromosome 10 BAC OSJNBa0062C05...    70   2e-11   
gb:AE016959_1023315 Oryza sativa (japonica cultivar-group) chrom...    70   2e-11   
sp|Q09181|ST13_SCHPO|ST13_SCHPO Putative ATP-dependent RNA helicase ste13.>...    70   2e-11   Schizosaccharomyces pombe
gb:AE017343_1755891 Cryptococcus neoformans var. neoformans JEC2...    69   3e-11   
gb:CR382121_1654727 Kluyveromyces lactis strain NRRL Y-1140 chro...    69   5e-11   
pir|T47916|T47916 DEAD box RNA helicase RH12 - Arabidopsis thali...    68   7e-11   Arabidopsis thaliana [mouse-ear cress]
gb:CR382127_1659974 Yarrowia lipolytica chromosome A of strain C...    68   9e-11   
gb:AP004133_1838092 Oryza sativa (japonica cultivar-group) genom...    67   2e-10   
gb:AP004133_1838091 Oryza sativa (japonica cultivar-group) genom...    67   2e-10   
gb:OSJN00204_1696668 Oryza sativa genomic DNA, chromosome 4, BAC...    67   2e-10   
gb:AY080837_1568530 Arabidopsis thaliana putative RNA helicase (...    67   2e-10   
pir|T01230|T01230 probable RNA helicase (EC 3.6.1.-) F6N23.6 - A...    67   2e-10   Arabidopsis thaliana [mouse-ear cress]
pir|T51741|T51741 RNA helicase RH8 [imported] - Arabidopsis thal...    67   2e-10   Arabidopsis thaliana [mouse-ear cress]
gb:DROHELI_1382110 D.melanogaster RNA helicase mRNA, complete cds.     67   2e-10   
gb:AY232161_1177454 Drosophila yakuba clone yak-ad_me31B mRNA se...    67   2e-10   
gb:AE014134_1128513 Drosophila melanogaster chromosome 2L, compl...    67   2e-10   
sp|P23128|ME31_DROME|ME31_DROME Putative ATP-dependent RNA helicase me31b (...    67   2e-10   Drosophila melanogaster
pir|T51743|T51743 RNA helicase RH12 [imported] - Arabidopsis tha...    66   3e-10   Arabidopsis thaliana [mouse-ear cress]
gb:XLEIF4AI_2582767 X.laevis mRNA for translation initiation fac...    65   5e-10   
gb:AE017341_1754588 Cryptococcus neoformans var. neoformans JEC2...    65   8e-10   
gb:CR382138_1670945 Debaryomyces hansenii chromosome F of strain...    65   8e-10   
gb:BA000037_721486 Vibrio vulnificus YJ016 DNA, chromosome I, co...    64   1e-09   
gb:AE016798_335305 Vibrio vulnificus CMCP6 chromosome I section ...    64   1e-09   
gb:AY752803_1179946 Culicoides sonorensis clone CseIF4a elongati...    64   1e-09   
sp|P27639|IF4A_CAEEL|IF4A_CAEEL Eukaryotic initiation factor 4A (eIF4A) (eI...    64   1e-09   Caenorhabditis elegans [roundworm]
sp|Q12099|FAL1_YEAST|FAL1_YEAST Probable ATP-dependent RNA helicase FAL1.>p...    64   1e-09   Saccharomyces cerevisiae [brewer's yeast]
gb:AF515726_2498839 Gallus gallus translational eukaryotic initi...    64   2e-09   
gb:MMEIF4AR_2114804 Mouse eIF-4AII mRNA for protein synthesis in...    64   2e-09   
gb:HUMELF4AII_2030861 Homo sapiens mRNA for eukaryotic initiatio...    64   2e-09   
gb:BC015842_1975341 Homo sapiens eukaryotic translation initiati...    64   2e-09   
gb:BC012547_1973667 Homo sapiens eukaryotic translation initiati...    64   2e-09   
gb:AX885065_1480518 Sequence 928 from Patent EP1033401.                64   2e-09   
gb:AK088669_1175543 Mus musculus 2 days neonate thymus thymic ce...    64   2e-09   
gb:AE016767_327895 Escherichia coli CFT073 section 13 of 18 of t...    64   2e-09   
gb:ECODEAD_128427 E.coli deaD gene, complete cds.                      64   2e-09   
pir|F65106|F65106 probable ATP-dependent RNA helicase deaD - Esc...    64   2e-09   Escherichia coli K-12
pir|C91134|C91134 inducible ATP-independent RNA helicase [import...    64   2e-09   Escherichia coli O157:H7
pir|A39157|A39157 probable RNA helicase (EC 3.6.1.-) - fruit fly...    64   2e-09   Drosophila melanogaster
sp|Q14240|IF42_HUMAN|IF42_HUMAN Eukaryotic initiation factor 4A-II (eIF4A-I...    64   2e-09   Homo sapiens [man]
gb:XLEIF4AII_2582768 X.laevis mRNA for translation initiation fa...    63   2e-09   
gb:BC084468_2563842 Xenopus tropicalis hypothetical LOC496556, m...    63   2e-09   
gb:BC077641_2560340 Xenopus laevis translation initiation factor...    63   2e-09   
gb:BC068800_2555300 Xenopus laevis translation initiation factor...    63   2e-09   
gb:BC045237_2549092 Xenopus laevis translation initiation factor...    63   2e-09   
gb:CR382128_1661208 Yarrowia lipolytica chromosome B of strain C...    63   2e-09   
gb:AB052858_7693 Enterococcus faecium gene for autoaggregation-m...    63   2e-09   
pir|JX0314|JX0314 DEAD box protein - Klebsiella pneumoniae>gb:KP...    63   2e-09   Klebsiella pneumoniae
sp|P47943|IF4A_SCHPO|IF4A_SCHPO Eukaryotic initiation factor 4A (eIF4A) (eI...    63   2e-09   Schizosaccharomyces pombe
gb:AL662801_1931484 Human DNA sequence from clone XXbac-296P20 o...    63   3e-09   
pir|S30278|S30278 translation initiation factor eIF-4A - fruit f...    63   3e-09   Drosophila melanogaster
sp|Q02748|IF4A_DROME|IF4A_DROME Eukaryotic initiation factor 4A (eIF4A) (eI...    63   3e-09   Drosophila melanogaster
gb:BC084034_2563442 Xenopus laevis hypothetical LOC494976, mRNA ...    62   4e-09   
gb:BC042330_2548141 Danio rerio zgc:55881, mRNA (cDNA clone MGC:...    62   4e-09   
gb:BT019879_2151582 Synthetic construct Homo sapiens eukaryotic ...    62   4e-09   
gb:MUSELF4A5_2125725 Mus musculus protein synthesis initiation f...    62   4e-09   
gb:MMEIF4AI_2114796 Mouse mRNA for initiation factor eIF-4AI.>gb...    62   4e-09   
gb:CR382138_1671911 Debaryomyces hansenii chromosome F of strain...    62   4e-09   
gb:AX969472_1484781 Sequence 275 from Patent EP1104808.                62   4e-09   
gb:AX887994_1483447 Sequence 3857 from Patent EP1033401.               62   4e-09   
gb:AX887993_1483446 Sequence 3856 from Patent EP1033401.               62   4e-09   
gb:AX885064_1480517 Sequence 927 from Patent EP1033401.                62   4e-09   
gb:AK011529_1156455 Mus musculus 10 days embryo whole body cDNA,...    62   4e-09   
gb:AE017320_441550 Desulfovibrio vulgaris subsp. vulgaris str. H...    62   4e-09   
gb:AE008851_244924 Salmonella typhimurium LT2, section 155 of 22...    62   4e-09   
pir|AB0901|AB0901 ATP-dependent RNA helicase (dead-box protein) ...    62   4e-09   Salmonella enterica subsp. enterica serovar Typhi
pir|S13269|S13269 translation initiation factor eIF-4A.I - rabbi...    62   4e-09   Oryctolagus cuniculus [domestic rabbit]
sp|P29562|IF41_RABIT|IF41_RABIT Eukaryotic initiation factor 4A-I (eIF4A-I)...    62   4e-09   Oryctolagus cuniculus [domestic rabbit]
sp|P60842|IF41_HUMAN|IF41_HUMAN Eukaryotic initiation factor 4A-I (eIF4A-I)...    62   4e-09   Homo sapiens [man]
sp|P23304|DEAD_ECOLI|DEAD_ECOLI Cold-shock DEAD-box protein A (ATP-dependen...    62   4e-09   Escherichia coli [E. coli]
sp|Q8XA87|DEAD_ECO57|DEAD_ECO57 Cold-shock DEAD-box protein A (ATP-dependen...    62   4e-09   Escherichia coli O157:H7
gb:AF399934_1268224 Spisula solidissima RNA helicase p47 mRNA, c...    62   5e-09   
pir|F82295|F82295 ATP-dependent RNA helicase SrmB VC0660 [import...    62   5e-09   Vibrio cholerae
sp|P33906|DEAD_KLEPN|DEAD_KLEPN Cold-shock DEAD-box protein A (ATP-dependen...    62   5e-09   Klebsiella pneumoniae
gb:BC049427_2550236 Danio rerio eukaryotic translation initiatio...    62   7e-09   
gb:BC048899_2550074 Danio rerio eukaryotic translation initiatio...    62   7e-09   
gb:AE017349_1758785 Cryptococcus neoformans var. neoformans JEC2...    62   7e-09   
gb:PFMAL3P7_1394581 Plasmodium falciparum MAL3P7, complete seque...    62   7e-09   
gb:AP006840_568836 Symbiobacterium thermophilum DNA, complete ge...    62   7e-09   
sp|P44586|DEAD_HAEIN|DEAD_HAEIN Cold-shock DEAD-box protein A homolog (ATP-...    62   7e-09   Haemophilus influenzae
gb:CR860906_1184950 Pongo pygmaeus mRNA; cDNA DKFZp470B2433 (fro...    61   9e-09   
gb:AE016862_351207 Pseudomonas syringae pv. tomato str. DC3000 s...    61   9e-09   
gb:CP000026_77859 Salmonella enterica subsp. enterica serovar Pa...    61   9e-09   
gb:AY207392_1939194 Homo sapiens eukaryotic translation initiati...    61   1e-08   
gb:AY598438_2365404 Diachasmimorpha longicaudata entomopoxvirus ...    60   1e-08   
gb:AE016818_1748551 Ashbya gossypii (= Eremothecium gossypii) AT...    60   1e-08   
gb:CR380959_1653935 Candida glabrata strain CBS138 chromosome M ...    60   1e-08   
gb:BX640434_811784 Bordetella parapertussis strain 12822, comple...    60   1e-08   
gb:AE017201_403642 Lactobacillus johnsonii NCC 533, section 2 of...    60   1e-08   
sp|P54824|DDX6_XENLA|DDX6_XENLA ATP-dependent RNA helicase p54 (Xp54).>gb:X...    60   1e-08   Xenopus laevis [clawed frog]
gb:MMEIF4AI_2114797 Mouse mRNA for initiation factor eIF-4AI.>gb...    60   3e-08   
gb:AB013609_2043770 Cavia porcellus mRNA for DEAD box protein, c...    60   3e-08   
gb:CAL390488_1644974 Candida albicans partial fal1 gene for ATP-...    60   3e-08   
gb:CAL250879_1644946 Candida albicans fal1 gene for ATP-dependen...    60   3e-08   
gb:EMU292369_1384653 Echinococcus multilocularis mRNA for transl...    60   3e-08   
gb:BX950851_839470 Erwinia carotovora subsp. atroseptica SCRI104...    60   3e-08   
gb:BX640421_807786 Bordetella pertussis strain Tohama I, complet...    60   3e-08   
gb:BA000016_674436 Clostridium perfringens str. 13 DNA, complete...    60   3e-08   
gb:AF542976_520681 Yersinia enterocolitica PNPase (pnp), lipopro...    60   3e-08   
pir|G64550|G64550 ATP-dependent RNA helicase, DEAD-box family - ...    60   3e-08   Helicobacter pylori
pir|B71957|B71957 ATP-dependent RNA helicase dead - Helicobacter...    60   3e-08   Helicobacter pylori J99
gb:AJ720165_2502352 Gallus gallus mRNA for hypothetical protein,...    59   3e-08   
gb:AF038995_2051892 Mus musculus putative RNA helicase RCK mRNA,...    59   3e-08   
gb:HUMRCK_2036239 Homo sapiens mRNA for RCK, complete cds.             59   3e-08   
gb:BC039826_1982639 Homo sapiens DEAD (Asp-Glu-Ala-Asp) box poly...    59   3e-08   
gb:AY050367_1562146 Arabidopsis thaliana AT3g19760/MMB12_21 mRNA...    59   3e-08   
gb:AY089635_1297291 Drosophila melanogaster RE50350 full insert ...    59   3e-08   
gb:CR857097_1181350 Pongo pygmaeus mRNA; cDNA DKFZp469I1738 (fro...    59   3e-08   
gb:AK054144_1170718 Mus musculus 2 days pregnant adult female ov...    59   3e-08   
gb:AE014297_1138455 Drosophila melanogaster chromosome 3R, compl...    59   3e-08   
gb:CP000024_877346 Streptococcus thermophilus CNRZ1066, complete...    59   3e-08   
gb:CP000023_875419 Streptococcus thermophilus LMG 18311, complet...    59   3e-08   
gb:BA000031_705965 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    59   3e-08   
gb:AE016949_364919 Enterococcus faecalis V583, section 3 of 11 o...    59   3e-08   
pir|T51737|T51737 RNA helicase RH2 [imported] - Arabidopsis thal...    59   3e-08   Arabidopsis thaliana [mouse-ear cress]
pir|S22651|S22651 probable RNA helicase (EC 3.6.1.-) RCK - human...    59   3e-08   Homo sapiens [man]
sp|P54823|DDX6_MOUSE|DDX6_MOUSE Probable ATP-dependent RNA helicase p54 (On...    59   3e-08   Mus musculus [mouse]
sp|P26196|DDX6_HUMAN|DDX6_HUMAN Probable ATP-dependent RNA helicase p54 (On...    59   3e-08   Homo sapiens [man]
gb:NC8D4_1688770 Neurospora crassa DNA linkage group V Cosmid co...    59   4e-08   
gb:CR382136_1669297 Debaryomyces hansenii chromosome D of strain...    59   4e-08   
gb:AC024844_1204946 Caenorhabditis elegans cosmid Y65B4A, comple...    59   4e-08   
gb:AB074896_1197549 Marsupenaeus japonicus eIF4A-1 mRNA for euka...    59   4e-08   
pir|T48731|T48731 probable translation initiation factor eIF-4A ...    59   4e-08   Neurospora crassa
sp|Q10055|IF4N_SCHPO|IF4N_SCHPO Eukaryotic initiation factor 4A-like protei...    59   4e-08   Schizosaccharomyces pombe
pir|T32773|T32773 hypothetical protein F33D11.10 - Caenorhabditi...    59   6e-08   Caenorhabditis elegans [roundworm]
gb:BC084859_2564103 Xenopus laevis cDNA clone MGC:85498 IMAGE:69...    58   7e-08   
gb:BC045939_2549453 Danio rerio zgc:56139, mRNA (cDNA clone MGC:...    58   7e-08   
gb:AJ719548_2501735 Gallus gallus mRNA for hypothetical protein,...    58   7e-08   
gb:AF020432_2469032 Xenopus laevis eukaryotic translation initia...    58   7e-08   
gb:HUMORFJA_2035323 Homo sapiens KIAA0111 mRNA, partial cds.           58   7e-08   
gb:AC117081_1207951 Dictyostelium discoideum chromosome 2 map 58...    58   7e-08   
gb:BX571661_778791 Wolinella succinogenes, complete genome; segm...    58   7e-08   
gb:AE017155_392974 Haemophilus ducreyi strain 35000HP section 5 ...    58   7e-08   
gb:AE006152_216000 Pasteurella multocida subsp. multocida str. P...    58   7e-08   
pir|S45142|S45142 translation initiation factor eIF-4A2 homolog ...    58   7e-08   Homo sapiens [man]
sp|P38919|DD48_HUMAN|DD48_HUMAN Probable ATP-dependent helicase DDX48 (DEAD...    58   7e-08   Homo sapiens [man]
gb:CR457215_1993422 Homo sapiens full open reading frame cDNA cl...    58   1e-07   
gb:CR382132_1665044 Yarrowia lipolytica chromosome F of strain C...    58   1e-07   
gb:BA000045_742400 Gloeobacter violaceus PCC 7421 DNA, complete ...    58   1e-07   
gb:AE016920_357853 Chromobacterium violaceum ATCC 12472 section ...    58   1e-07   
gb:AE016827_343579 Mannheimia succiniciproducens MBEL55E, comple...    58   1e-07   
gb:AE012553_283599 Xylella fastidiosa Temecula1, section 1 of 9 ...    58   1e-07   
gb:CR378678_97829 Photobacterium profundum SS9 chromosome 2; seg...    58   1e-07   
pir|E82835|E82835 ATP-dependent RNA helicase XF0192 [imported] -...    58   1e-07   Xylella fastidiosa
pir|H90136|H90136 RNA helicase [imported] - Guillardia theta nuc...    58   1e-07   Guillardia theta
sp|P87206|IF4A_CANAL|IF4A_CANAL Eukaryotic initiation factor 4A (eIF4A) (eI...    58   1e-07   Candida albicans
sp|Q91VC3|DD48_MOUSE|DD48_MOUSE Probable ATP-dependent helicase DDX48 (DEAD...    58   1e-07   Mus musculus [mouse]
gb:BC061342_2553118 Xenopus tropicalis DEAD (Asp-Glu-Ala-As) box...    57   1e-07   
gb:BC025594_2095092 Mus musculus DEAD (Asp-Glu-Ala-Asp) box poly...    57   1e-07   
gb:AC006605_1203307 Caenorhabditis elegans cosmid C07H6, complet...    57   1e-07   
gb:AK075920_1171103 Mus musculus ES cells cDNA, RIKEN full-lengt...    57   1e-07   
gb:AK033235_1163249 Mus musculus 15 days embryo male testis cDNA...    57   1e-07   
gb:AE016780_331301 Pseudomonas putida KT2440 section 7 of 21 of ...    57   1e-07   
gb:CR555306_107960 Azoarcus sp. EbN1 complete genome.                  57   1e-07   
pir|A83292|A83292 probable ATP-dependent RNA helicase PA2840 [im...    57   1e-07   Pseudomonas aeruginosa
sp|P41380|IF43_NICPL|IF43_NICPL Eukaryotic initiation factor 4A-3 (eIF4A-3)...    57   1e-07   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb:AY751756_2088403 Rattus norvegicus zinc responsive protein Zd...    57   2e-07   
gb:AE017343_1755881 Cryptococcus neoformans var. neoformans JEC2...    57   2e-07   
gb:CR382136_1668772 Debaryomyces hansenii chromosome D of strain...    57   2e-07   
gb:CR382121_1654516 Kluyveromyces lactis strain NRRL Y-1140 chro...    57   2e-07   
gb:BX294145_769104 Pirellula sp. strain 1 complete genome; segme...    57   2e-07   
gb:BA000012_666141 Mesorhizobium loti MAFF303099 DNA, complete g...    57   2e-07   
gb:AE017236_413226 Mycobacterium avium subsp. paratuberculosis s...    57   2e-07   
gb:AE017164_395550 Prochlorococcus marinus subsp. marinus str. C...    57   2e-07   
gb:AE016913_355964 Chromobacterium violaceum ATCC 12472 section ...    57   2e-07   
pir|T41007|T41007 atp dependent helicase - fission yeast (Schizo...    57   2e-07   Schizosaccharomyces pombe
pir|C97238|C97238 ATP dependent RNA helicase DeaD, superfamily I...    57   2e-07   Clostridium acetobutylicum
pir|A83823|A83823 ATP-dependent RNA helicase BH1385 [imported] -...    57   2e-07   Bacillus halodurans
sp|Q9UMR2|DD19_HUMAN|DD19_HUMAN ATP-dependent RNA helicase DDX19 (DEAD-box ...    57   2e-07   Homo sapiens [man]
gb:AJ719804_2501991 Gallus gallus mRNA for hypothetical protein,...    57   2e-07   
gb:BC024730_2094697 Mus musculus DEAD (Asp-Glu-Ala-Asp) box poly...    57   2e-07   
gb:CR380955_1651701 Candida glabrata strain CBS138 chromosome I ...    57   2e-07   
gb:BX294147_769574 Pirellula sp. strain 1 complete genome; segme...    57   2e-07   
gb:AE016827_342124 Mannheimia succiniciproducens MBEL55E, comple...    57   2e-07   
gb:AE013672_299026 Yersinia pestis KIM section 72 of 415 of the ...    57   2e-07   
pir|AI0423|AI0423 cold-shock dead-box protein A [imported] - Yer...    57   2e-07   Yersinia pestis Nepal516
pir|D97270|D97270 ATP-dependent RNA helicase (superfamily II), Y...    57   2e-07   Clostridium acetobutylicum
pir|C90137|C90137 eukaryotic initiation factor 4a [imported] - G...    57   2e-07   Guillardia theta
sp|Q921N6|DD27_MOUSE|DD27_MOUSE Probable ATP-dependent RNA helicase DDX27 (...    57   2e-07   Mus musculus [mouse]
gb:BC046696_2549686 Xenopus laevis DEAD/H (Asp-Glu-Ala-Asp/His) ...    56   3e-07   
gb:BC079094_2107227 Rattus norvegicus cDNA clone MGC:94068 IMAGE...    56   3e-07   
gb:AF183422_1888524 Homo sapiens RNA helicase mRNA, complete cds.      56   3e-07   
gb:AF136175_1885745 Homo sapiens RNA helicase mRNA, complete cds.      56   3e-07   
gb:AP003726_1832494 Oryza sativa (japonica cultivar-group) genom...    56   3e-07   
gb:ATH010474_1551907 Arabidopsis thaliana mRNA for DEAD box RNA ...    56   3e-07   
gb:AB006697_1509847 Arabidopsis thaliana genomic DNA, chromosome...    56   3e-07   
gb:HSM804281_1187156 Homo sapiens mRNA; cDNA DKFZp666D212 (from ...    56   3e-07   
gb:CR861435_1185430 Pongo pygmaeus mRNA; cDNA DKFZp459H062 (from...    56   3e-07   
gb:AK049467_1168810 Mus musculus 7 days embryo whole body cDNA, ...    56   3e-07   
gb:CP000009_862131 Gluconobacter oxydans 621H, complete genome.        56   3e-07   
gb:BX569691_775822 Synechococcus sp. WH8102 complete genome; seg...    56   3e-07   
gb:AP008226_577566 Thermus thermophilus HB8 genomic DNA, complet...    56   3e-07   
gb:AE017315_440231 Desulfovibrio vulgaris subsp. vulgaris str. H...    56   3e-07   
gb:AE017307_437529 Thermus thermophilus HB27 section 7 of 7 of t...    56   3e-07   
gb:AE014158_304556 Streptococcus pyogenes MGAS315, section 23 of...    56   3e-07   
gb:AE006578_220354 Streptococcus pyogenes M1 GAS, section 107 of...    56   3e-07   
pir|T51747|T51747 RNA helicase RH26 [imported] - Arabidopsis tha...    56   3e-07   Arabidopsis thaliana [mouse-ear cress]
sp|P44701|SRMB_HAEIN|SRMB_HAEIN ATP-dependent RNA helicase srmB homolog.>pi...    56   3e-07   Haemophilus influenzae
sp|P35683|IF4A_ORYSA|IF4A_ORYSA Eukaryotic initiation factor 4A (eIF4A) (eI...    56   3e-07   Oryza sativa [red rice]
sp|Q61655|DD19_MOUSE|DD19_MOUSE ATP-dependent RNA helicase DDX19 (DEAD-box ...    56   3e-07   Mus musculus [mouse]
gb:AJ719483_2501670 Gallus gallus partial mRNA for hypothetical ...    56   4e-07   
gb:AJ719463_2501650 Gallus gallus mRNA for hypothetical protein,...    56   4e-07   
gb:BC011927_1973321 Homo sapiens DEAD (Asp-Glu-Ala-Asp) box poly...    56   4e-07   
gb:BC009304_1971898 Homo sapiens DEAD (Asp-Glu-Ala-Asp) box poly...    56   4e-07   
gb:AY044431_1935065 Homo sapiens RNA helicase-like protein mRNA,...    56   4e-07   
gb:AP003607_1831254 Oryza sativa (japonica cultivar-group) genom...    56   4e-07   
gb:AC084404_1733571 Oryza sativa chromosome 3 BAC OSJNBa0026A15 ...    56   4e-07   
gb:ATH010472_1551905 Arabidopsis thaliana mRNA for DEAD box RNA ...    56   4e-07   
gb:AX880007_1478086 Sequence 14912 from Patent EP1074617.>gb:AK0...    56   4e-07   
gb:CP000020_870620 Vibrio fischeri ES114 chromosome I, complete ...    56   4e-07   
gb:BX640437_812861 Bordetella bronchiseptica strain RB50, comple...    56   4e-07   
gb:BX640423_808459 Bordetella parapertussis strain 12822, comple...    56   4e-07   
gb:BX640420_807454 Bordetella pertussis strain Tohama I, complet...    56   4e-07   
gb:AE017355_466420 Bacillus thuringiensis serovar konkukian str....    56   4e-07   
gb:TTHERAGEN_198525 T.thermophilus DNA for RNA dependent ATPase.       56   4e-07   
pir|S76612|S76612 ATP-dependent RNA helicase deaD - Synechocysti...    56   4e-07   
pir|T06824|T06824 translation initiation factor - garden pea>gb:...    56   4e-07   
pir|T51347|T51347 RNA helicase RH23 [imported] - Arabidopsis tha...    56   4e-07   
pir|B96752|B96752 hypothetical protein F28P22.8 [imported] - Ara...    56   4e-07   
sp|Q96GQ7|DD27_HUMAN|DD27_HUMAN Probable ATP-dependent RNA helicase DDX27 (...    56   4e-07   
gb:AY303540_2081902 Rattus norvegicus zinc responsive protein ZD...    55   5e-07   
gb:CNS07EG9_1372906 chromosome II of strain GB-M1 of Encephalito...    55   5e-07   
gb:CP000003_861105 Streptococcus pyogenes MGAS10394, complete ge...    55   5e-07   
gb:BX571874_789378 Photorhabdus luminescens subsp. laumondii TTO...    55   5e-07   
gb:AP006627_564519 Bacillus clausii KSM-K16 DNA, complete genome.      55   5e-07   
gb:AE017333_446464 Bacillus licheniformis DSM 13, complete genom...    55   5e-07   
gb:AE017281_426791 Bacillus cereus ATCC 10987, section 18 of 18 ...    55   5e-07   
gb:AE017015_380268 Bacillus cereus ATCC 14579 section 18 of 18 o...    55   5e-07   
gb:AE014905_313022 Streptococcus mutans UA159 section 53 of 185 ...    55   5e-07   
gb:AE014227_306098 Streptococcus agalactiae 2603V/R section 37 o...    55   5e-07   
gb:AE006221_216728 Pasteurella multocida subsp. multocida str. P...    55   5e-07   
gb:SAG766847_170324 Streptococcus agalactiae NEM316 complete gen...    55   5e-07   
gb:AE004969_60406 Neisseria gonorrhoeae FA 1090, complete genome.      55   5e-07   
pir|T51310|T51310 RNA helicase RH28 [imported] - Arabidopsis tha...    55   5e-07   
pir|E81090|E81090 ATP-dependent RNA helicase, probable NMB1368 [...    55   5e-07   
pir|G81850|G81850 probable ATP-dependent RNA helicase NMA1580 [i...    55   5e-07   
pir|D69772|D69772 ATP-dependent RNA helicase homolog ydbR - Baci...    55   5e-07   
sp|P41378|IF4A_WHEAT|IF4A_WHEAT Eukaryotic initiation factor 4A (eIF4A) (eI...    55   5e-07   
gb:AY648729_2541557 Danio rerio DEAD box polypeptide 27 mRNA, co...    55   6e-07   
gb:SCU25436_1710066 Saccharomyces cerevisiae Glg2p (GLG2) gene, ...    55   6e-07   
gb:LAU81597_1387112 Leishmania amazonensis ATP-dependent RNA hel...    55   6e-07   
gb:BX842649_824315 Bdellovibrio bacteriovorus complete genome, s...    55   6e-07   
gb:AE015943_321067 Clostridium tetani E88, section 8 of 10 of th...    55   6e-07   
gb:AE015582_315787 Shewanella oneidensis MR-1 section 131 of 457...    55   6e-07   
gb:AE011560_274285 Leptospira interrogans serovar lai str. 56601...    55   6e-07   
pir|S05835|FIBY1 translation initiation factor eIF-4A - yeast (S...    55   6e-07   
sp|P10081|IF4A_YEAST|IF4A_YEAST Eukaryotic initiation factor 4A (eIF4A) (eI...    55   6e-07   
gb:AFA12H2_1810806 Aspergillus fumigatus BAC AFA12F2.                  55   8e-07   
gb:BX248338_758641 Mycobacterium bovis subsp. bovis AF2122/97 co...    55   8e-07   
gb:AP006618_561083 Nocardia farcinica IFM 10152 DNA, complete ge...    55   8e-07   
gb:AE012833_286081 Chlorobium tepidum TLS section 54 of 194 of t...    55   8e-07   
gb:CR522870_100535 Desulfotalea psychrophila LSv54 chromosome.         55   8e-07   
gb:CP000033_88575 Lactobacillus acidophilus NCFM, complete genome.     55   8e-07   
gb:AB069963_9086 Streptococcus sobrinus spaA, SSO1, SSO2 genes f...    55   8e-07   
sp|P35599|EXP9_STRPN|EXP9_STRPN Probable RNA helicase exp9 (Exported protei...    55   8e-07   
sp|Q11039|DEAD_MYCTU|DEAD_MYCTU Cold-shock DEAD-box protein A homolog (ATP-...    55   8e-07   
gb:BC044541_2548843 Danio rerio DEAD/H (Asp-Glu-Ala-Asp/His) box...    54   1e-06   
gb:CP000001_850856 Bacillus cereus ZK, complete genome.                54   1e-06   
gb:AF204145_488228 Xanthomonas campestris pv. campestris LPS bio...    54   1e-06   
gb:AE017264_421502 Bacillus cereus ATCC 10987, section 1 of 18 o...    54   1e-06   
gb:AE017149_391521 Helicobacter hepaticus ATCC 51449 section 6 o...    54   1e-06   
gb:AE017024_380528 Bacillus anthracis str. Ames section 1 of 18 ...    54   1e-06   
gb:AE016951_365429 Enterococcus faecalis V583, section 5 of 11 o...    54   1e-06   
gb:AE013598_294471 Xanthomonas oryzae pv. oryzae KACC10331, comp...    54   1e-06   
gb:AE012157_279862 Xanthomonas campestris pv. campestris str. AT...    54   1e-06   
gb:AE008734_242529 Salmonella typhimurium LT2, section 42 of 220...    54   1e-06   
gb:CP000026_76727 Salmonella enterica subsp. enterica serovar Pa...    54   1e-06   
pir|H83947|H83947 ATP-dependent RNA helicase BH2384 [imported] -...    54   1e-06   
pir|AI0599|AI0599 probable ATP-dependent RNA helicase rhlE STY08...    54   1e-06   
gb:PCY245475_1391862 Plasmodium cynomolgi gene for RNA helicase-1.     54   1e-06   
gb:AE014187_939121 Plasmodium falciparum 3D7 chromosome 14 compl...    54   1e-06   
gb:BA000011_665768 Thermoplasma volcanium GSS1 DNA, complete gen...    54   1e-06   
gb:AE016911_355344 Chromobacterium violaceum ATCC 12472 section ...    54   1e-06   
gb:AE016757_324922 Escherichia coli CFT073 section 3 of 18 of th...    54   1e-06   
gb:AE005674_70329 Shigella flexneri 2a str. 301, complete genome...    54   1e-06   
pir|D85588|D85588 probable ATP-dependent RNA helicase rhlE [impo...    54   1e-06   
sp|Q09903|YAJ3_SCHPO|YAJ3_SCHPO Putative ATP-dependent RNA helicase C30D11....    54   1e-06   
sp|P25888|RHLE_ECOLI|RHLE_ECOLI Putative ATP-dependent RNA helicase rhlE.>p...    54   1e-06   
sp|O02494|IF4A_CRYPV|IF4A_CRYPV Eukaryotic initiation factor 4A (eIF4A) (eI...    54   1e-06   
sp|P41377|IF42_ARATH|IF42_ARATH Eukaryotic initiation factor 4A-2 (eIF4A-2)...    54   1e-06   
gb:AP005288_1849910 Oryza sativa (japonica cultivar-group) genom...    54   2e-06   
gb:AF007580_1760920 Zea mays translation initiation factor (eIF-...    54   2e-06   
gb:ZMU73459_1732221 Zea mays translational initiation factor eIF...    54   2e-06   
gb:CR382137_1669882 Debaryomyces hansenii chromosome E of strain...    54   2e-06   
gb:CP000001_855737 Bacillus cereus ZK, complete genome.                54   2e-06   
gb:AE017180_398796 Geobacter sulfurreducens PCA, complete genome.      54   2e-06   
gb:AE017041_385577 Bacillus anthracis str. Ames section 18 of 18...    54   2e-06   
gb:AE012011_278524 Xanthomonas axonopodis pv. citri str. 306, se...    54   2e-06   
gb:AE004969_59936 Neisseria gonorrhoeae FA 1090, complete genome.      54   2e-06   
pir|T24662|T24662 hypothetical protein T07D4.4c - Caenorhabditis...    54   2e-06   
pir|T24661|T24661 hypothetical protein T07D4.4b - Caenorhabditis...    54   2e-06   
pir|T24663|T24663 hypothetical protein T07D4.4a - Caenorhabditis...    54   2e-06   
pir|H81085|H81085 ATP-dependent RNA helicase, probable NMB1422 [...    54   2e-06   
pir|F81857|F81857 probable ATP-dependent RNA helicase NMA1634 [i...    54   2e-06   
gb:AY086907_1571946 Arabidopsis thaliana clone 29310 mRNA, compl...    53   2e-06   
gb:AY081287_1568633 Arabidopsis thaliana eukaryotic translation ...    53   2e-06   
gb:AB046414_1520492 Oryza sativa eIF4A-2 mRNA for eukaryotic ini...    53   2e-06   
gb:AE014296_1134005 Drosophila melanogaster chromosome 3L, compl...    53   2e-06   
gb:AL935253_550486 Lactobacillus plantarum strain WCFS1 complete...    53   2e-06   
gb:AL646068_547139 Ralstonia solanacearum GMI1000 chromosome, co...    53   2e-06   
gb:PSEESTA_160546 Pseudomonas fluorescens genes for esterase A a...    53   2e-06   
gb:CR378664_93962 Photobacterium profundum SS9; segment 2/12.          53   2e-06   
pir|JQ0886|JQ0886 hypothetical protein (estA 3' region) - Pseudo...    53   2e-06   
pir|S52017|S52017 translation initiation factor eIF-4A.9 - commo...    53   2e-06   
sp|Q09719|YA47_SCHPO|YA47_SCHPO Putative ATP-dependent RNA helicase C31A2.0...    53   2e-06   
sp|P41376|IF41_ARATH|IF41_ARATH Eukaryotic initiation factor 4A-1 (eIF4A-1)...    53   2e-06   
gb:BX950851_842022 Erwinia carotovora subsp. atroseptica SCRI104...    53   3e-06   
gb:BX640411_804617 Bordetella pertussis strain Tohama I, complet...    53   3e-06   
gb:AE013598_295251 Xanthomonas oryzae pv. oryzae KACC10331, comp...    53   3e-06   
pir|A81464|A81464 translation initiation factor eIF-4A [similari...    53   3e-06   
sp|Q25225|IF4A_LEIBR|IF4A_LEIBR Probable eukaryotic initiation factor 4A (e...    53   3e-06   
sp|Q40471|IF49_TOBAC|IF49_TOBAC Eukaryotic initiation factor 4A-9 (eIF4A-9)...    53   3e-06   
gb:AE016816_1746943 Ashbya gossypii (= Eremothecium gossypii) AT...    52   4e-06   
gb:DDU78759_1377426 Dictyostelium discoideum IfdA (ifdA) mRNA, p...    52   4e-06   
gb:BX908798_831115 Parachlamydia-related symbiont UWE25, complet...    52   4e-06   
gb:AL935258_551961 Lactobacillus plantarum strain WCFS1 complete...    52   4e-06   
gb:CR378678_97855 Photobacterium profundum SS9 chromosome 2; seg...    52   4e-06   
pir|D96799|D96799 hypothetical protein F22K20.13 [imported] - Ar...    52   4e-06   
pir|E90520|E90520 atp-dependent rna helicase [imported] - Mycopl...    52   4e-06   
gb:AF190623_2479224 Xenopus laevis DEADSouth RNA helicase (DEADS...    52   5e-06   
gb:BC011321_2091386 Mus musculus DEAD (Asp-Glu-Ala-Asp) box poly...    52   5e-06   
gb:AF193054_1889122 Homo sapiens PP3241 mRNA, complete cds.            52   5e-06   
gb:AF462218_1801871 Narcissus pseudonarcissus putative DEAD/DEAH...    52   5e-06   
gb:AX405698_1467626 Sequence 113 from Patent WO0222660.                52   5e-06   
gb:CP000021_873304 Vibrio fischeri ES114 chromosome II, complete...    52   5e-06   
gb:BX572098_798425 Prochlorococcus marinus MIT9313 complete geno...    52   5e-06   
gb:BX571864_786368 Photorhabdus luminescens subsp. laumondii TTO...    52   5e-06   
gb:AF091502_478500 Lactobacillus reuteri autoaggregation-mediati...    52   5e-06   
gb:AE011922_277729 Xanthomonas axonopodis pv. citri str. 306, se...    52   5e-06   
pir|C71604|C71604 RNA helicase PFB0860c - malaria parasite (Plas...    52   5e-06   
pir|H96551|H96551 hypothetical protein F11M15.24 [imported] - Ar...    52   5e-06   
sp|Q887N8|RHLB_PSESM|RHLB_PSESM ATP-dependent RNA helicase rhlB (EC 3.6.1.-...    52   5e-06   
gb:AF220454_2059617 Mus musculus regulator of steroidogenic fact...    52   7e-06   
gb:AF217001_2059398 Mus musculus DEAD-box corepressor DP103 beta...    52   7e-06   
gb:AF217000_2059397 Mus musculus DEAD-box corepressor DP103 alph...    52   7e-06   
gb:AP003328_1827947 Oryza sativa (japonica cultivar-group) genom...    52   7e-06   
gb:AF527439_1808387 Phaseolus vulgaris clone PvDR-6 translation ...    52   7e-06   
gb:AE016814_1745789 Ashbya gossypii (= Eremothecium gossypii) AT...    52   7e-06   
gb:AY428601_1605820 Helianthus annuus clone HA24-15A initiation ...    52   7e-06   
gb:AY167670_1586294 Pisum sativum DEAD box RNA helicase mRNA, co...    52   7e-06   
gb:ATH298137_1552408 Arabidopsis thaliana eIF-4A1 gene for trans...    52   7e-06   
gb:AC025726_1205205 Caenorhabditis elegans cosmid Y71G12B, compl...    52   7e-06   
gb:AK050950_1169522 Mus musculus 9 days embryo whole body cDNA, ...    52   7e-06   
gb:AK013179_1157371 Mus musculus 10, 11 days embryo whole body c...    52   7e-06   
gb:AE014296_1135696 Drosophila melanogaster chromosome 3L, compl...    52   7e-06   
gb:BX248356_762301 Corynebacterium diphtheriae gravis NCTC13129,...    52   7e-06   
gb:BA000021_686967 Wigglesworthia glossinidia endosymbiont of Gl...    52   7e-06   
gb:AE017282_427784 Methylococcus capsulatus str. Bath, complete ...    52   7e-06   
pir|S52022|S52022 translation initiation factor eIF-4A.13 - comm...    52   7e-06   
pir|S52019|S52019 translation initiation factor eIF-4A.7 - commo...    52   7e-06   
pir|S52023|S52023 translation initiation factor eIF-4A.14 - comm...    52   7e-06   
pir|S52018|S52018 translation initiation factor eIF-4A.11 - comm...    52   7e-06   
sp|Q88NB7|RHLB_PSEPK|RHLB_PSEPK ATP-dependent RNA helicase rhlB (EC 3.6.1.-...    52   7e-06   
sp|Q40467|IF4Y_TOBAC|IF4Y_TOBAC Eukaryotic initiation factor 4A-14 (eIF4A-1...    52   7e-06   
sp|Q40466|IF4X_TOBAC|IF4X_TOBAC Eukaryotic initiation factor 4A-13 (eIF4A-1...    52   7e-06   
sp|P41382|IF4U_TOBAC|IF4U_TOBAC Eukaryotic initiation factor 4A-10 (eIF4A-1...    52   7e-06   
sp|P41381|IF48_TOBAC|IF48_TOBAC Eukaryotic initiation factor 4A-8 (eIF4A-8)...    52   7e-06   
sp|Q40470|IF47_TOBAC|IF47_TOBAC Eukaryotic initiation factor 4A-7 (eIF4A-7)...    52   7e-06   
sp|P41379|IF42_NICPL|IF42_NICPL Eukaryotic initiation factor 4A-2 (eIF4A-2)...    52   7e-06   
sp|Q9JJY4|DD20_MOUSE|DD20_MOUSE Probable ATP-dependent RNA helicase DDX20 (...    52   7e-06   
gb:AF303464_2154200 Unidentified ATP-dependent RNA helicase RhlE...    51   9e-06   
gb:BC034953_1981423 Homo sapiens DEAD (Asp-Glu-Ala-Asp) box poly...    51   9e-06   
gb:BC031062_1980054 Homo sapiens DEAD (Asp-Glu-Ala-Asp) box poly...    51   9e-06   
gb:BC011556_1973029 Homo sapiens DEAD (Asp-Glu-Ala-Asp) box poly...    51   9e-06   
gb:AF171063_1887577 Homo sapiens DEAD box RNA helicase Gemin3 mR...    51   9e-06   
gb:AF155803_1886674 Homo sapiens DEAD-box corepressor DP103 (DDX...    51   9e-06   
gb:AF106019_1884002 Homo sapiens DEAD-box protein (DP103) mRNA, ...    51   9e-06   
gb:AC099401_1737147 Oryza sativa (japonica cultivar-group) chrom...    51   9e-06   
gb:CR382130_1663326 Yarrowia lipolytica chromosome D of strain C...    51   9e-06   
gb:AY167671_1586295 Pisum sativum DEAD box RNA helicase mRNA, co...    51   9e-06   
gb:AX876885_1476738 Sequence 11790 from Patent EP1074617.>gb:AK0...    51   9e-06   
gb:BX842646_823349 Bdellovibrio bacteriovorus complete genome, s...    51   9e-06   
gb:AE017325_443315 Listeria monocytogenes str. 4b F2365, section...    51   9e-06   
gb:AE017239_414017 Mycobacterium avium subsp. paratuberculosis s...    51   9e-06   
gb:AE016940_362670 Bacteroides thetaiotaomicron VPI-5482, sectio...    51   9e-06   
gb:AE008692_240952 Zymomonas mobilis subsp. mobilis ZM4, complet...    51   9e-06   
gb:CR628337_115244 Legionella pneumophila str. Lens complete gen...    51   9e-06   
pir|AC1540|AC1540 ATP-dependent RNA helicase homolog lin0859 [im...    51   9e-06   
pir|AD0330|AD0330 ATP-dependent RNA helicase [imported] - Yersin...    51   9e-06   
sp|Q40465|IF4V_TOBAC|IF4V_TOBAC Eukaryotic initiation factor 4A-11 (eIF4A-1...    51   9e-06   
sp|Q41741|IF4A_MAIZE|IF4A_MAIZE Eukaryotic initiation factor 4A (eIF4A) (eI...    51   9e-06   
sp|Q9UHI6|DD20_HUMAN|DD20_HUMAN Probable ATP-dependent RNA helicase DDX20 (...    51   9e-06   
gb:CTE318937_1375856 Chironomus tentans mRNA for Dbp5 protein.         51   1e-05   
gb:CNS07EGI_1374506 chromosome IX of strain GB-M1 of Encephalito...    51   1e-05   
gb:BX321863_774368 Nitrosomonas europaea ATCC 19718, complete ge...    51   1e-05   
gb:BA000016_674556 Clostridium perfringens str. 13 DNA, complete...    51   1e-05   
gb:CR555306_108663 Azoarcus sp. EbN1 complete genome.                  51   1e-05   
gb:CR378678_98079 Photobacterium profundum SS9 chromosome 2; seg...    51   1e-05   
pir|T40504|T40504 atp-dependent, dead box, rna helicase - fissio...    51   1e-05   
pir|T10237|T10237 RNA helicase RH16 - Arabidopsis thaliana>gb:AT...    51   1e-05   
pir|B87478|B87478 hypothetical protein CC1847 [imported] - Caulo...    51   1e-05   
pir|H85903|H85903 ATP-dependent RNA helicase [imported] - Escher...    51   1e-05   
pir|B91059|B91059 ATP-dependent RNA helicase [imported] - Escher...    51   1e-05   
pir|S52020|S52020 translation initiation factor eIF-4A.15 - comm...    51   1e-05   
sp|P21507|SRMB_ECOLI|SRMB_ECOLI ATP-dependent RNA helicase srmB.>pir|G65035...    51   1e-05   
sp|Q40468|IF4Z_TOBAC|IF4Z_TOBAC Eukaryotic initiation factor 4A-15 (eIF4A-1...    51   1e-05   
sp|Q89AF9|DEAD_BUCBP|DEAD_BUCBP Cold-shock DEAD-box protein A homolog (ATP-...    51   1e-05   
gb:CP000009_863017 Gluconobacter oxydans 621H, complete genome.        50   2e-05   
gb:BX572092_796727 Prochlorococcus marinus MED4 complete genome;...    50   2e-05   
gb:AF076644_476880 Myxococcus xanthus DEAD-box protein (dedA) ge...    50   2e-05   
gb:AE017340_457306 Idiomarina loihiensis L2TR, complete genome.        50   2e-05   
gb:AE016791_333920 Pseudomonas putida KT2440 section 18 of 21 of...    50   2e-05   
gb:AE015941_320617 Clostridium tetani E88, section 6 of 10 of th...    50   2e-05   
gb:AE015722_317193 Shewanella oneidensis MR-1 section 271 of 457...    50   2e-05   
gb:AE012376_281870 Xanthomonas campestris pv. campestris str. AT...    50   2e-05   
pir|AB1183|AB1183 ATP-dependent RNA helicase homolog lmo0866 [im...    50   2e-05   
pir|B82060|B82060 ATP-dependent RNA helicase DbpA VC2564 [import...    50   2e-05   
pir|H69124|H69124 translation initiation factor eIF-4A homolog -...    50   2e-05   
sp|Q9HXE5|RHLB_PSEAE|RHLB_PSEAE ATP-dependent RNA helicase rhlB (EC 3.6.1.-...    50   2e-05   
gb:BC086113_2564700 Xenopus laevis hypothetical LOC495747, mRNA ...    50   2e-05   
gb:BC081871_2108117 Rattus norvegicus similar to RIKEN cDNA 1210...    50   2e-05   
gb:BC005848_1969877 Homo sapiens DEAD (Asp-Glu-Ala-Asp) box poly...    50   2e-05   
gb:AY148094_1937132 Homo sapiens DEAD box RNA helicase DP97 mRNA...    50   2e-05   
gb:AF478457_1904580 Homo sapiens ATP-dependent RNA helicase mRNA...    50   2e-05   
gb:CR382137_1670271 Debaryomyces hansenii chromosome E of strain...    50   2e-05   
gb:AB027882_1517648 Schizosaccharomyces pombe gene for Hypotheti...    50   2e-05   
gb:AK031679_1162552 Mus musculus 13 days embryo male testis cDNA...    50   2e-05   
gb:AK031534_1162481 Mus musculus 13 days embryo male testis cDNA...    50   2e-05   
gb:AE012553_283644 Xylella fastidiosa Temecula1, section 1 of 9 ...    50   2e-05   
gb:AE008820_244309 Salmonella typhimurium LT2, section 124 of 22...    50   2e-05   
gb:CR628336_112158 Legionella pneumophila str. Paris complete ge...    50   2e-05   
gb:CP000031_85482 Silicibacter pomeroyi DSS-3, complete genome.        50   2e-05   
gb:CP000026_75181 Salmonella enterica subsp. enterica serovar Pa...    50   2e-05   


>gb:AY052303_1562676 Arabidopsis thaliana AT5g11170/F2I11_60 mRNA,
           complete cds.>gb:AY059168_1564531 Arabidopsis thaliana
           AT5g11200/F2I11_90 mRNA, complete
           cds.>gb:BT001052_1635307 Arabidopsis thaliana
           At5g11170/F2I11_60 mRNA, complete
           cds.>gb:AF378868_1793453 Arabidopsis thaliana
           AT5g11200/F2I11_90 mRNA, complete cds.
          Length = 427

 Score =  182 bits (462), Expect = 3e-45
 Identities = 94/119 (78%), Positives = 100/119 (84%)
 Frame = +1

Query: 163 MGENKENDAXXXXXXXXXXXXXKAPDSVGAKVNGESVKKGYVGIHSSGFRDFLLKPELLR 342
           MG+ ++N+A             K PDS G KVNGE+VKKGYVGIHSSGFRDFLLKPELLR
Sbjct: 1   MGDARDNEAYEEELLDYEEEDEKVPDS-GNKVNGEAVKKGYVGIHSSGFRDFLLKPELLR 59

Query: 343 AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+AL
Sbjct: 60  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSAL 118



>gb:ATH010466_1551899 Arabidopsis thaliana mRNA for DEAD box RNA
           helicase, RH15.
          Length = 451

 Score =  182 bits (462), Expect = 3e-45
 Identities = 94/119 (78%), Positives = 100/119 (84%)
 Frame = +1

Query: 163 MGENKENDAXXXXXXXXXXXXXKAPDSVGAKVNGESVKKGYVGIHSSGFRDFLLKPELLR 342
           MG+ ++N+A             K PDS G KVNGE+VKKGYVGIHSSGFRDFLLKPELLR
Sbjct: 25  MGDARDNEAYEEELLDYEEEDEKVPDS-GNKVNGEAVKKGYVGIHSSGFRDFLLKPELLR 83

Query: 343 AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+AL
Sbjct: 84  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSAL 142



>gb:ATF2I11_1550468 Arabidopsis thaliana DNA chromosome 5, BAC clone
           F2I11 (ESSA project).
          Length = 427

 Score =  182 bits (462), Expect = 3e-45
 Identities = 94/119 (78%), Positives = 100/119 (84%)
 Frame = +1

Query: 163 MGENKENDAXXXXXXXXXXXXXKAPDSVGAKVNGESVKKGYVGIHSSGFRDFLLKPELLR 342
           MG+ ++N+A             K PDS G KVNGE+VKKGYVGIHSSGFRDFLLKPELLR
Sbjct: 1   MGDARDNEAYEEELLDYEEEDEKVPDS-GNKVNGEAVKKGYVGIHSSGFRDFLLKPELLR 59

Query: 343 AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+AL
Sbjct: 60  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSAL 118



>gb:ATF2I11_1550465 Arabidopsis thaliana DNA chromosome 5, BAC clone
           F2I11 (ESSA project).
          Length = 435

 Score =  182 bits (462), Expect = 3e-45
 Identities = 94/119 (78%), Positives = 100/119 (84%)
 Frame = +1

Query: 163 MGENKENDAXXXXXXXXXXXXXKAPDSVGAKVNGESVKKGYVGIHSSGFRDFLLKPELLR 342
           MG+ ++N+A             K PDS G KVNGE+VKKGYVGIHSSGFRDFLLKPELLR
Sbjct: 1   MGDARDNEAYEEELLDYEEEDEKVPDS-GNKVNGEAVKKGYVGIHSSGFRDFLLKPELLR 59

Query: 343 AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+AL
Sbjct: 60  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSAL 118



>pir|T51343|T51343 RNA helicase RH15 [imported] - Arabidopsis
           thaliana  (fragment)
          Length = 451

 Score =  182 bits (462), Expect = 3e-45
 Identities = 94/119 (78%), Positives = 100/119 (84%)
 Frame = +1

Query: 163 MGENKENDAXXXXXXXXXXXXXKAPDSVGAKVNGESVKKGYVGIHSSGFRDFLLKPELLR 342
           MG+ ++N+A             K PDS G KVNGE+VKKGYVGIHSSGFRDFLLKPELLR
Sbjct: 25  MGDARDNEAYEEELLDYEEEDEKVPDS-GNKVNGEAVKKGYVGIHSSGFRDFLLKPELLR 83

Query: 343 AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP  GQV+AL
Sbjct: 84  AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPSPGQVSAL 142



>gb:AP004225_1838948 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC
           clone:B1156H12.>gb:AP004258_1839241 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OSJNBa0024F24.
          Length = 432

 Score =  160 bits (405), Expect = 1e-38
 Identities = 79/93 (84%), Positives = 84/93 (90%)
 Frame = +1

Query: 241 SVGAKVNGESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMD 420
           +  A  + + VKKGYVGIHSSGFRDFLLKPELLRAI D GFEHPSEVQHECIPQAILGMD
Sbjct: 31  AAAANASADVVKKGYVGIHSSGFRDFLLKPELLRAIQDCGFEHPSEVQHECIPQAILGMD 90

Query: 421 VICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           VICQAKSGMGKTAVFVLS+LQQI+PVAGQV AL
Sbjct: 91  VICQAKSGMGKTAVFVLSSLQQIDPVAGQVGAL 123



>gb:AP004225_1838946 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1156H12.
          Length = 432

 Score =  160 bits (404), Expect = 1e-38
 Identities = 79/90 (87%), Positives = 83/90 (92%)
 Frame = +1

Query: 250 AKVNGESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVIC 429
           A  + + VKKGYVGIHSSGFRDFLLKPELLRAI D GFEHPSEVQHECIPQAILGMDVIC
Sbjct: 34  ANASADVVKKGYVGIHSSGFRDFLLKPELLRAIQDCGFEHPSEVQHECIPQAILGMDVIC 93

Query: 430 QAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           QAKSGMGKTAVFVLS+LQQI+PVAGQV AL
Sbjct: 94  QAKSGMGKTAVFVLSSLQQIDPVAGQVGAL 123



>gb:BC044169_2548558 Danio rerio DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 39, mRNA (cDNA clone MGC:55433
           IMAGE:2639515), complete cds.>gb:BC067555_2554733 Danio
           rerio DEAD (Asp-Glu-Ala-Asp) box polypeptide 39, mRNA
           (cDNA clone MGC:85646 IMAGE:6805653), complete cds.
          Length = 427

 Score =  154 bits (389), Expect = 8e-37
 Identities = 78/96 (81%), Positives = 84/96 (87%)
 Frame = +1

Query: 232 APDSVGAKVNGESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL 411
           AP+S  A V  + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAIL
Sbjct: 22  APESA-APVGKKEVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAIL 80

Query: 412 GMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           GMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ L
Sbjct: 81  GMDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVL 116



>pir|I47126|I47126 nuclear RNA helicase (DEAD family) BAT1 -
           pig>gb:SSBAT1G_1445029 S.scrofa BAT1 gene.
          Length = 427

 Score =  154 bits (389), Expect = 8e-37
 Identities = 79/114 (69%), Positives = 85/114 (74%)
 Frame = +1

Query: 178 ENDAXXXXXXXXXXXXXKAPDSVGAKVNGESVKKGYVGIHSSGFRDFLLKPELLRAIVDS 357
           END               A    GA+   + VK  YV IHSSGFRDFLLKPELLRAIVD 
Sbjct: 3   ENDVDNELLDYEDDEVETAAGGDGAEAAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDC 62

Query: 358 GFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           GFEHPSEVQHECIPQAILGMDV+CQAKSGMGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 63  GFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVL 116



>gb:BC071505_2556241 Danio rerio zgc:55881, mRNA (cDNA clone
           MGC:86865 IMAGE:6903439), complete cds.
          Length = 427

 Score =  153 bits (386), Expect = 2e-36
 Identities = 75/91 (82%), Positives = 80/91 (87%)
 Frame = +1

Query: 247 GAKVNGESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVI 426
           GA    + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMD++
Sbjct: 26  GATTGKKEVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDIL 85

Query: 427 CQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           CQAKSGMGKTAVFVL+TLQQIEPV GQV+ L
Sbjct: 86  CQAKSGMGKTAVFVLATLQQIEPVDGQVSVL 116



>gb:BC055240_2551319 Danio rerio zgc:63773, mRNA (cDNA clone
           MGC:63773 IMAGE:2642676), complete cds.
          Length = 435

 Score =  152 bits (385), Expect = 2e-36
 Identities = 74/88 (84%), Positives = 79/88 (89%)
 Frame = +1

Query: 256 VNGESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQA 435
           +  E VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQA
Sbjct: 37  IRKEGVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQA 96

Query: 436 KSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           KSGMGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 97  KSGMGKTAVFVLATLQQLEPVTGQVSVL 124



>gb:AF391287_1267424 Branchiostoma floridae cosmid MPMGc117C0356,
           partial sequence.
          Length = 427

 Score =  152 bits (383), Expect = 4e-36
 Identities = 81/119 (68%), Positives = 86/119 (72%)
 Frame = +1

Query: 163 MGENKENDAXXXXXXXXXXXXXKAPDSVGAKVNGESVKKGYVGIHSSGFRDFLLKPELLR 342
           M E  EN+               A D+    V  + VK  YV IHSSGFRDFLLKPELLR
Sbjct: 1   MAEEGENELLDYEEEEQETTTEAAGDTA---VQKKEVKGSYVSIHSSGFRDFLLKPELLR 57

Query: 343 AIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           AIVD GFEHPSEVQHECIPQAIL MDV+CQAKSGMGKTAVFVL+TLQQIEPV GQVA L
Sbjct: 58  AIVDCGFEHPSEVQHECIPQAILSMDVLCQAKSGMGKTAVFVLATLQQIEPVDGQVAVL 116



>gb:BC045125_2549057 Xenopus laevis nuclear RNA helicase, mRNA (cDNA
           clone MGC:53944 IMAGE:5570363), complete cds.
          Length = 427

 Score =  151 bits (381), Expect = 6e-36
 Identities = 74/97 (76%), Positives = 82/97 (84%)
 Frame = +1

Query: 229 KAPDSVGAKVNGESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI 408
           +AP    A +  + VK  YV IHSSGFRDFLLKPELLR+IVD GFEHPSEVQHECIPQAI
Sbjct: 20  QAPAETAAPIARKEVKGSYVSIHSSGFRDFLLKPELLRSIVDCGFEHPSEVQHECIPQAI 79

Query: 409 LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           LGMD++CQAKSGMGKTAVFVL+TLQQIE V GQV+ L
Sbjct: 80  LGMDILCQAKSGMGKTAVFVLATLQQIEAVEGQVSVL 116



>gb:AJ720994_2503181 Gallus gallus mRNA for hypothetical protein,
           clone 32b9.
          Length = 428

 Score =  150 bits (380), Expect = 8e-36
 Identities = 73/85 (85%), Positives = 78/85 (91%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 33  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 92

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 93  MGKTAVFVLATLQQLEPVTGQVSVL 117



>gb:BT008096_2151028 Synthetic construct Homo sapiens HLA-B
           associated transcript 1 mRNA, partial cds.
          Length = 429

 Score =  150 bits (380), Expect = 8e-36
 Identities = 73/85 (85%), Positives = 78/85 (91%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 33  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 92

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 93  MGKTAVFVLATLQQLEPVTGQVSVL 117



>gb:BC020134_2093288 Mus musculus DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 39, mRNA (cDNA clone MGC:28113
           IMAGE:3969048), complete cds.>gb:BC083953_2563366
           Xenopus laevis hypothetical LOC494890, mRNA (cDNA clone
           MGC:97961 IMAGE:7197890), complete cds.
          Length = 427

 Score =  150 bits (380), Expect = 8e-36
 Identities = 74/85 (87%), Positives = 78/85 (91%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 32  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 91

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQIEPV GQV+ L
Sbjct: 92  MGKTAVFVLATLQQIEPVNGQVSVL 116



>gb:AF387339_2064639 Rattus norvegicus IkBL, vacuolar ATPase NG38,
           Bat1, and MHC class I antigen (RT1.46) genes, complete
           cds.
          Length = 428

 Score =  150 bits (380), Expect = 8e-36
 Identities = 73/85 (85%), Positives = 78/85 (91%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 33  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 92

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 93  MGKTAVFVLATLQQLEPVTGQVSVL 117



>gb:HSY14768_2028380 Homo sapiens DNA, cosmid clones TN62 and TN82.
          Length = 144

 Score =  150 bits (380), Expect = 8e-36
 Identities = 73/85 (85%), Positives = 78/85 (91%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 33  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 92

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 93  MGKTAVFVLATLQQLEPVTGQVSVL 117



>gb:BX248516_1991661 Human DNA sequence from clone DASS-161H22 on
           chromosome 6, complete sequence.
          Length = 187

 Score =  150 bits (380), Expect = 8e-36
 Identities = 73/85 (85%), Positives = 78/85 (91%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 56  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 115

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 116 MGKTAVFVLATLQQLEPVTGQVSVL 140



>gb:BX248516_1991659 Human DNA sequence from clone DASS-161H22 on
           chromosome 6, complete sequence.
          Length = 218

 Score =  150 bits (380), Expect = 8e-36
 Identities = 73/85 (85%), Positives = 78/85 (91%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 33  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 92

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 93  MGKTAVFVLATLQQLEPVTGQVSVL 117



>gb:BX248516_1991658 Human DNA sequence from clone DASS-161H22 on
           chromosome 6, complete sequence.
          Length = 235

 Score =  150 bits (380), Expect = 8e-36
 Identities = 73/85 (85%), Positives = 78/85 (91%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 33  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 92

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 93  MGKTAVFVLATLQQLEPVTGQVSVL 117



>gb:BX001040_1991475 Human DNA sequence from clone DAQB-72H16 on
           chromosome 6 Contains HCG26, the gene coding for a
           transcript for an MHC class I fragment (clone 3.8-1),
           the MICB gene for MHC class I polypeptide-related
           sequence B, the PPIP9 peptidylprolyl isomerase
           (cyclophilin) pseudogene 9, the RPL15P4 ribosomal
           protein L15 pseudogene 4, the BAT1 gene for HLA-B
           associated transcript 1, the ATP6V1G2 gene for ATPase,
           H+ transporting, lysosomal 13kDa, V1 subunit G isoform
           2, the 5' end of the NFKBIL1 gene for nuclear factor of
           kappa light polypeptide gene enhancer in B-cells
           inhibitor-like 1 and two CpG islands, complete sequence.
          Length = 187

 Score =  150 bits (380), Expect = 8e-36
 Identities = 73/85 (85%), Positives = 78/85 (91%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 56  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 115

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 116 MGKTAVFVLATLQQLEPVTGQVSVL 140



>gb:BX001040_1991474 Human DNA sequence from clone DAQB-72H16 on
           chromosome 6 Contains HCG26, the gene coding for a
           transcript for an MHC class I fragment (clone 3.8-1),
           the MICB gene for MHC class I polypeptide-related
           sequence B, the PPIP9 peptidylprolyl isomerase
           (cyclophilin) pseudogene 9, the RPL15P4 ribosomal
           protein L15 pseudogene 4, the BAT1 gene for HLA-B
           associated transcript 1, the ATP6V1G2 gene for ATPase,
           H+ transporting, lysosomal 13kDa, V1 subunit G isoform
           2, the 5' end of the NFKBIL1 gene for nuclear factor of
           kappa light polypeptide gene enhancer in B-cells
           inhibitor-like 1 and two CpG islands, complete sequence.
          Length = 205

 Score =  150 bits (380), Expect = 8e-36
 Identities = 73/85 (85%), Positives = 78/85 (91%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 33  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 92

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 93  MGKTAVFVLATLQQLEPVTGQVSVL 117



>gb:AL662801_1931488 Human DNA sequence from clone XXbac-296P20 on
           chromosome 6 contains a ribosomal protein L15 (RPL15)
           pseudogene, the BAT1 gene for HLA-B associated
           transcript 1, the ATP6V1G gene for ATPase, H+
           transporting, lysosomal 13kDa, V1 subunit G, the NFKBIL1
           gene for nuclear factor of kappa light polypeptide gene
           enhancer in B-cells inhibitor-like 1, the LTA gene for
           lymphotoxin alpha, the TNF gene for tumour necrosis
           factor, the LTB gene for lymphotoxin beta, the LST1 gene
           for leukocyte specific transcript 1, the LY117 gene for
           lymphocyte antigen 117, the AIF1 gene for alograft
           imflammatory factor 1, the BAT2 gene for HLA-B
           associated transcript 2, the BAT3 gene for HLA-B
           associated transcript 3, the APOM gene for
           apolipoprotein M, the 3' end of the gene for chromosome
           6, open reading frame 47 and four CpG islands, complete
           sequence.>gb:AL662847_1931733 Human DNA sequence from
           clone XXbac-270M2 on chromosome 6 contains the gene for
           a novel protein similar to similar to peptidyl-prolyl
           cis-trans isomerase A (PPIase), a ribosomal protein L15
           (RPL15) pseudogene, the BAT1 gene for HLA-B associated
           transcript 1, the ATP6V1G gene for ATPase, H+
           transporting, lysosomal 13kDa, V1 subunit G, the NFKBIL1
           gene for nuclear factor of kappa light polypeptide gene
           enhancer in B-cells inhibitor-like 1, the LTA gene for
           lymphotoxin alpha, the TNF gene for tumour necrosis
           factor, the LTB gene for lymphotoxin beta, the LST1 gene
           for leukocyte specific transcript 1, the LY117 gene for
           lymphocyte antigen 117, the AIF1 gene for alograft
           imflammatory factor 1, the BAT2 gene for HLA-B
           associated transcript 2, the 3' end of the BAT3 gene for
           HLA-B associated transcript 3 and two CpG islands,
           complete sequence.
          Length = 164

 Score =  150 bits (380), Expect = 8e-36
 Identities = 73/85 (85%), Positives = 78/85 (91%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 33  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 92

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 93  MGKTAVFVLATLQQLEPVTGQVSVL 117



>gb:AL662801_1931487 Human DNA sequence from clone XXbac-296P20 on
           chromosome 6 contains a ribosomal protein L15 (RPL15)
           pseudogene, the BAT1 gene for HLA-B associated
           transcript 1, the ATP6V1G gene for ATPase, H+
           transporting, lysosomal 13kDa, V1 subunit G, the NFKBIL1
           gene for nuclear factor of kappa light polypeptide gene
           enhancer in B-cells inhibitor-like 1, the LTA gene for
           lymphotoxin alpha, the TNF gene for tumour necrosis
           factor, the LTB gene for lymphotoxin beta, the LST1 gene
           for leukocyte specific transcript 1, the LY117 gene for
           lymphocyte antigen 117, the AIF1 gene for alograft
           imflammatory factor 1, the BAT2 gene for HLA-B
           associated transcript 2, the BAT3 gene for HLA-B
           associated transcript 3, the APOM gene for
           apolipoprotein M, the 3' end of the gene for chromosome
           6, open reading frame 47 and four CpG islands, complete
           sequence.>gb:AL662847_1931732 Human DNA sequence from
           clone XXbac-270M2 on chromosome 6 contains the gene for
           a novel protein similar to similar to peptidyl-prolyl
           cis-trans isomerase A (PPIase), a ribosomal protein L15
           (RPL15) pseudogene, the BAT1 gene for HLA-B associated
           transcript 1, the ATP6V1G gene for ATPase, H+
           transporting, lysosomal 13kDa, V1 subunit G, the NFKBIL1
           gene for nuclear factor of kappa light polypeptide gene
           enhancer in B-cells inhibitor-like 1, the LTA gene for
           lymphotoxin alpha, the TNF gene for tumour necrosis
           factor, the LTB gene for lymphotoxin beta, the LST1 gene
           for leukocyte specific transcript 1, the LY117 gene for
           lymphocyte antigen 117, the AIF1 gene for alograft
           imflammatory factor 1, the BAT2 gene for HLA-B
           associated transcript 2, the 3' end of the BAT3 gene for
           HLA-B associated transcript 3 and two CpG islands,
           complete sequence.
          Length = 220

 Score =  150 bits (380), Expect = 8e-36
 Identities = 73/85 (85%), Positives = 78/85 (91%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 33  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 92

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 93  MGKTAVFVLATLQQLEPVTGQVSVL 117



>gb:AL662801_1931486 Human DNA sequence from clone XXbac-296P20 on
           chromosome 6 contains a ribosomal protein L15 (RPL15)
           pseudogene, the BAT1 gene for HLA-B associated
           transcript 1, the ATP6V1G gene for ATPase, H+
           transporting, lysosomal 13kDa, V1 subunit G, the NFKBIL1
           gene for nuclear factor of kappa light polypeptide gene
           enhancer in B-cells inhibitor-like 1, the LTA gene for
           lymphotoxin alpha, the TNF gene for tumour necrosis
           factor, the LTB gene for lymphotoxin beta, the LST1 gene
           for leukocyte specific transcript 1, the LY117 gene for
           lymphocyte antigen 117, the AIF1 gene for alograft
           imflammatory factor 1, the BAT2 gene for HLA-B
           associated transcript 2, the BAT3 gene for HLA-B
           associated transcript 3, the APOM gene for
           apolipoprotein M, the 3' end of the gene for chromosome
           6, open reading frame 47 and four CpG islands, complete
           sequence.>gb:AL662847_1931731 Human DNA sequence from
           clone XXbac-270M2 on chromosome 6 contains the gene for
           a novel protein similar to similar to peptidyl-prolyl
           cis-trans isomerase A (PPIase), a ribosomal protein L15
           (RPL15) pseudogene, the BAT1 gene for HLA-B associated
           transcript 1, the ATP6V1G gene for ATPase, H+
           transporting, lysosomal 13kDa, V1 subunit G, the NFKBIL1
           gene for nuclear factor of kappa light polypeptide gene
           enhancer in B-cells inhibitor-like 1, the LTA gene for
           lymphotoxin alpha, the TNF gene for tumour necrosis
           factor, the LTB gene for lymphotoxin beta, the LST1 gene
           for leukocyte specific transcript 1, the LY117 gene for
           lymphocyte antigen 117, the AIF1 gene for alograft
           imflammatory factor 1, the BAT2 gene for HLA-B
           associated transcript 2, the 3' end of the BAT3 gene for
           HLA-B associated transcript 3 and two CpG islands,
           complete sequence.
          Length = 233

 Score =  150 bits (380), Expect = 8e-36
 Identities = 73/85 (85%), Positives = 78/85 (91%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 33  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 92

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 93  MGKTAVFVLATLQQLEPVTGQVSVL 117



>gb:AL662801_1931485 Human DNA sequence from clone XXbac-296P20 on
           chromosome 6 contains a ribosomal protein L15 (RPL15)
           pseudogene, the BAT1 gene for HLA-B associated
           transcript 1, the ATP6V1G gene for ATPase, H+
           transporting, lysosomal 13kDa, V1 subunit G, the NFKBIL1
           gene for nuclear factor of kappa light polypeptide gene
           enhancer in B-cells inhibitor-like 1, the LTA gene for
           lymphotoxin alpha, the TNF gene for tumour necrosis
           factor, the LTB gene for lymphotoxin beta, the LST1 gene
           for leukocyte specific transcript 1, the LY117 gene for
           lymphocyte antigen 117, the AIF1 gene for alograft
           imflammatory factor 1, the BAT2 gene for HLA-B
           associated transcript 2, the BAT3 gene for HLA-B
           associated transcript 3, the APOM gene for
           apolipoprotein M, the 3' end of the gene for chromosome
           6, open reading frame 47 and four CpG islands, complete
           sequence.>gb:AL662847_1931730 Human DNA sequence from
           clone XXbac-270M2 on chromosome 6 contains the gene for
           a novel protein similar to similar to peptidyl-prolyl
           cis-trans isomerase A (PPIase), a ribosomal protein L15
           (RPL15) pseudogene, the BAT1 gene for HLA-B associated
           transcript 1, the ATP6V1G gene for ATPase, H+
           transporting, lysosomal 13kDa, V1 subunit G, the NFKBIL1
           gene for nuclear factor of kappa light polypeptide gene
           enhancer in B-cells inhibitor-like 1, the LTA gene for
           lymphotoxin alpha, the TNF gene for tumour necrosis
           factor, the LTB gene for lymphotoxin beta, the LST1 gene
           for leukocyte specific transcript 1, the LY117 gene for
           lymphocyte antigen 117, the AIF1 gene for alograft
           imflammatory factor 1, the BAT2 gene for HLA-B
           associated transcript 2, the 3' end of the BAT3 gene for
           HLA-B associated transcript 3 and two CpG islands,
           complete sequence.>gb:BX001040_1991473 Human DNA
           sequence from clone DAQB-72H16 on chromosome 6 Contains
           HCG26, the gene coding for a transcript for an MHC class
           I fragment (clone 3.8-1), the MICB gene for MHC class I
           polypeptide-related sequence B, the PPIP9 peptidylprolyl
           isomerase (cyclophilin) pseudogene 9, the RPL15P4
           ribosomal protein L15 pseudogene 4, the BAT1 gene for
           HLA-B associated transcript 1, the ATP6V1G2 gene for
           ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G
           isoform 2, the 5' end of the NFKBIL1 gene for nuclear
           factor of kappa light polypeptide gene enhancer in
           B-cells inhibitor-like 1 and two CpG islands, complete
           sequence.>gb:BX248516_1991657 Human DNA sequence from
           clone DASS-161H22 on chromosome 6, complete sequence.
          Length = 245

 Score =  150 bits (380), Expect = 8e-36
 Identities = 73/85 (85%), Positives = 78/85 (91%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 33  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 92

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 93  MGKTAVFVLATLQQLEPVTGQVSVL 117



>gb:AX885456_1480909 Sequence 1319 from Patent EP1033401.
          Length = 133

 Score =  150 bits (380), Expect = 8e-36
 Identities = 73/85 (85%), Positives = 78/85 (91%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 33  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 92

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 93  MGKTAVFVLATLQQLEPVTGQVSVL 117



>gb:AY423389_1430089 Canis familiaris BAC 231G24 MHC class I locus,
           partial sequence.
          Length = 428

 Score =  150 bits (380), Expect = 8e-36
 Identities = 73/85 (85%), Positives = 78/85 (91%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 33  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 92

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 93  MGKTAVFVLATLQQLEPVTGQVSVL 117



>gb:CR859800_1183903 Pongo pygmaeus mRNA; cDNA DKFZp469F1834 (from
           clone DKFZp469F1834).
          Length = 143

 Score =  150 bits (380), Expect = 8e-36
 Identities = 73/85 (85%), Positives = 78/85 (91%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 33  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 92

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 93  MGKTAVFVLATLQQLEPVTGQVSVL 117



>gb:AK051034_1169553 Mus musculus 9 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:D030057O22
           product:HLA-B ASSOCIATED TRANSCRIPT-1 homolog [Homo
           sapiens], full insert sequence.>gb:AK088867_1175675 Mus
           musculus 2 days neonate thymus thymic cells cDNA, RIKEN
           full-length enriched library, clone:E430029G07
           product:HLA-B ASSOCIATED TRANSCRIPT-1 homolog [Homo
           sapiens], full insert sequence.>gb:AC007080_2049819 Mus
           musculus chromosome 17 clone BAC 205A4, complete
           sequence.>gb:AF118128_2055116 Mus musculus nuclear RNA
           helicase Bat1 mRNA, complete cds.>gb:AY255786_2080935
           Mus musculus strain B10.D2 HLA-B associated transcript 1
           (Bat1a) mRNA, complete cds.>gb:AY255787_2080936 Mus
           musculus strain BALB/c HLA-B associated transcript 1
           (Bat1a) mRNA, complete cds.>gb:BC011067_2091207 Mus
           musculus HLA-B-associated transcript 1A, mRNA (cDNA
           clone MGC:19235 IMAGE:3498520), complete
           cds.>gb:BC024859_2094764 Mus musculus HLA-B-associated
           transcript 1A, mRNA (cDNA clone MGC:38799
           IMAGE:5359825), complete cds.>gb:BC080243_2107725 Rattus
           norvegicus HLA-B-associated transcript 1A, mRNA (cDNA
           clone MGC:91440 IMAGE:7100155), complete
           cds.>gb:RNO314857_2135889 Rattus norvegicus Nfkbil1 gene
           (partial), Atp6G, Bat1, RT1-C/E1, RT1-C/E2, RT1-C/E3,
           RT1-C/E4, RT1-C/E5, RT1-C/E7 genes and RT1-C/E6,
           RT1-C/E8, RT1-C/E9 pseudogenes.>gb:BC084004_2563412
           Xenopus laevis hypothetical LOC494926, mRNA (cDNA clone
           MGC:98155 IMAGE:7200876), complete cds.
          Length = 428

 Score =  150 bits (380), Expect = 8e-36
 Identities = 73/85 (85%), Positives = 78/85 (91%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 33  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 92

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 93  MGKTAVFVLATLQQLEPVTGQVSVL 117



>pir|A42811|A42811 nuclear RNA helicase (DEAD family) homolog -
           rat>gb:RATP49A_2133291 Rattus norvegicus liver nuclear
           protein p47 mRNA,.
          Length = 399

 Score =  150 bits (380), Expect = 8e-36
 Identities = 73/85 (85%), Positives = 78/85 (91%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 33  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 92

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 93  MGKTAVFVLATLQQLEPVTGQVSVL 117



>sp|Q63413|HE47_RAT Probable ATP-dependent RNA helicase p47.
          Length = 428

 Score =  150 bits (380), Expect = 8e-36
 Identities = 73/85 (85%), Positives = 78/85 (91%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 33  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 92

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 93  MGKTAVFVLATLQQLEPVTGQVSVL 117



>sp|Q13838|HE47_HUMAN Probable ATP-dependent RNA helicase p47 (HLA-B
           associated transcript- 1).>sp|P60024|HE47_PANTR Probable
           ATP-dependent RNA helicase p47 (HLA-B associated
           transcript- 1).>sp|Q29024|HE47_PIG Probable
           ATP-dependent RNA helicase p47.>pir|I37201|I37201
           nuclear RNA helicase (DEAD family) BAT1 -
           human>gb:CR857691_1181908 Pongo pygmaeus mRNA; cDNA
           DKFZp468K0120 (from clone
           DKFZp468K0120).>gb:SSC251914_1445098 Sus scrofa MHC
           class I SLA genes, haplotype H01, clone BAC
           493A6.>gb:AB054536_1868235 Pan troglodytes LTB, TNF
           alpha, LTA, IKBL, ATP6G, BAT1, Patr-MIC and Patr-B
           genes, complete cds.>gb:AB088115_1872132 Homo sapiens
           IKBL, ATP6G, BAT1 genes for nuclear factor of kappa
           light polypeptide gene enhancer in B-cells
           inhibitor-like 1, putative vacuolar ATPase G subunit,
           HLA-B associated transcript 1, complete
           cds.>gb:AB128049_1873925 Macaca mulatta genes, MHC class
           I region, partial and complete cds.>gb:AL662801_1931482
           Human DNA sequence from clone XXbac-296P20 on chromosome
           6 contains a ribosomal protein L15 (RPL15) pseudogene,
           the BAT1 gene for HLA-B associated transcript 1, the
           ATP6V1G gene for ATPase, H+ transporting, lysosomal
           13kDa, V1 subunit G, the NFKBIL1 gene for nuclear factor
           of kappa light polypeptide gene enhancer in B-cells
           inhibitor-like 1, the LTA gene for lymphotoxin alpha,
           the TNF gene for tumour necrosis factor, the LTB gene
           for lymphotoxin beta, the LST1 gene for leukocyte
           specific transcript 1, the LY117 gene for lymphocyte
           antigen 117, the AIF1 gene for alograft imflammatory
           factor 1, the BAT2 gene for HLA-B associated transcript
           2, the BAT3 gene for HLA-B associated transcript 3, the
           APOM gene for apolipoprotein M, the 3' end of the gene
           for chromosome 6, open reading frame 47 and four CpG
           islands, complete sequence.>gb:AL662847_1931727 Human
           DNA sequence from clone XXbac-270M2 on chromosome 6
           contains the gene for a novel protein similar to similar
           to peptidyl-prolyl cis-trans isomerase A (PPIase), a
           ribosomal protein L15 (RPL15) pseudogene, the BAT1 gene
           for HLA-B associated transcript 1, the ATP6V1G gene for
           ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G,
           the NFKBIL1 gene for nuclear factor of kappa light
           polypeptide gene enhancer in B-cells inhibitor-like 1,
           the LTA gene for lymphotoxin alpha, the TNF gene for
           tumour necrosis factor, the LTB gene for lymphotoxin
           beta, the LST1 gene for leukocyte specific transcript 1,
           the LY117 gene for lymphocyte antigen 117, the AIF1 gene
           for alograft imflammatory factor 1, the BAT2 gene for
           HLA-B associated transcript 2, the 3' end of the BAT3
           gene for HLA-B associated transcript 3 and two CpG
           islands, complete sequence.>gb:BA000025_1966156 Homo
           sapiens genomic DNA, chromosome 6p21.3, HLA Class I
           region.>gb:BA000041_1966258 Pan troglodytes DNA, major
           histocompatibility complex class I
           region.>gb:BC000361_1966650 Homo sapiens HLA-B
           associated transcript 1, transcript variant 2, mRNA
           (cDNA clone MGC:8674 IMAGE:2964517), complete
           cds.>gb:BC004350_1969196 Homo sapiens cDNA clone
           MGC:1518 IMAGE:3536103, complete
           cds.>gb:BC013006_1973900 Homo sapiens HLA-B associated
           transcript 1, transcript variant 1, mRNA (cDNA clone
           MGC:3991 IMAGE:3010263), complete
           cds.>gb:BT009909_1991007 Homo sapiens HLA-B associated
           transcript 1 mRNA, complete cds.>gb:BX001040_1991471
           Human DNA sequence from clone DAQB-72H16 on chromosome 6
           Contains HCG26, the gene coding for a transcript for an
           MHC class I fragment (clone 3.8-1), the MICB gene for
           MHC class I polypeptide-related sequence B, the PPIP9
           peptidylprolyl isomerase (cyclophilin) pseudogene 9, the
           RPL15P4 ribosomal protein L15 pseudogene 4, the BAT1
           gene for HLA-B associated transcript 1, the ATP6V1G2
           gene for ATPase, H+ transporting, lysosomal 13kDa, V1
           subunit G isoform 2, the 5' end of the NFKBIL1 gene for
           nuclear factor of kappa light polypeptide gene enhancer
           in B-cells inhibitor-like 1 and two CpG islands,
           complete sequence.>gb:BX248516_1991655 Human DNA
           sequence from clone DASS-161H22 on chromosome 6,
           complete sequence.>gb:HSBAT1MR_2010983 H.sapiens BAT1
           mRNA for nuclear RNA helicase (DEAD family).
          Length = 428

 Score =  150 bits (380), Expect = 8e-36
 Identities = 73/85 (85%), Positives = 78/85 (91%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 33  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 92

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 93  MGKTAVFVLATLQQLEPVTGQVSVL 117



>gb:BC086328_2109523 Rattus norvegicus nuclear RNA helicase, DECD
           variant of DEAD box family, mRNA (cDNA clone MGC:105369
           IMAGE:7132938), complete cds.
          Length = 427

 Score =  150 bits (379), Expect = 1e-35
 Identities = 73/85 (85%), Positives = 78/85 (91%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 32  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 91

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQIEP+ GQV+ L
Sbjct: 92  MGKTAVFVLATLQQIEPINGQVSVL 116



>gb:AF063447_2052988 Rattus norvegicus nuclear RNA helicase mRNA,
           complete cds.
          Length = 427

 Score =  150 bits (379), Expect = 1e-35
 Identities = 73/85 (85%), Positives = 78/85 (91%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 32  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 91

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQIEP+ GQV+ L
Sbjct: 92  MGKTAVFVLATLQQIEPINGQVSVL 116



>gb:BT021050_1436408 Bos taurus DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 39 (DDX39), mRNA, complete cds.
          Length = 427

 Score =  150 bits (379), Expect = 1e-35
 Identities = 75/97 (77%), Positives = 80/97 (82%)
 Frame = +1

Query: 229 KAPDSVGAKVNGESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI 408
           +AP         + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAI
Sbjct: 20  QAPPESAPPPPKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAI 79

Query: 409 LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           LGMD++CQAKSGMGKTAVFVL+TLQQIEPV GQV  L
Sbjct: 80  LGMDILCQAKSGMGKTAVFVLATLQQIEPVNGQVTVL 116



>gb:BC032128_1980336 Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 39, mRNA (cDNA clone MGC:29546
           IMAGE:5017293), complete cds.
          Length = 322

 Score =  150 bits (378), Expect = 1e-35
 Identities = 73/85 (85%), Positives = 77/85 (90%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + +K  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 32  KDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 91

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQIEPV GQV  L
Sbjct: 92  MGKTAVFVLATLQQIEPVNGQVTVL 116



>gb:BC010455_1972648 Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 39, transcript variant 2, mRNA (cDNA clone
           MGC:18203 IMAGE:4155840), complete cds.
          Length = 316

 Score =  150 bits (378), Expect = 1e-35
 Identities = 73/85 (85%), Positives = 77/85 (90%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + +K  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 32  KDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 91

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQIEPV GQV  L
Sbjct: 92  MGKTAVFVLATLQQIEPVNGQVTVL 116



>gb:BC001009_1967207 Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 39, transcript variant 1, mRNA (cDNA clone
           MGC:8417 IMAGE:2820926), complete cds.
          Length = 427

 Score =  150 bits (378), Expect = 1e-35
 Identities = 73/85 (85%), Positives = 77/85 (90%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + +K  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 32  KDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 91

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQIEPV GQV  L
Sbjct: 92  MGKTAVFVLATLQQIEPVNGQVTVL 116



>gb:AY298950_2525768 Xenopus laevis DECD-box RNA helicase (DDX39)
           mRNA, complete cds.>gb:BC045239_2549094 Xenopus laevis
           similar to nuclear RNA helicase, mRNA (cDNA clone
           MGC:53693 IMAGE:4889168), complete cds.
          Length = 427

 Score =  149 bits (377), Expect = 2e-35
 Identities = 73/97 (75%), Positives = 81/97 (83%)
 Frame = +1

Query: 229 KAPDSVGAKVNGESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI 408
           +AP      +  + VK  YV IHSSGFRDFLLKPELLR+IVD GFEHPSEVQHECIPQAI
Sbjct: 20  QAPAETAVPIARKEVKGSYVSIHSSGFRDFLLKPELLRSIVDCGFEHPSEVQHECIPQAI 79

Query: 409 LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           LGMD++CQAKSGMGKTAVFVL+TLQQIE V GQV+ L
Sbjct: 80  LGMDILCQAKSGMGKTAVFVLATLQQIEAVEGQVSVL 116



>gb:BC082368_2562605 Xenopus laevis MGC81606 protein, mRNA (cDNA
           clone MGC:81606 IMAGE:6863791), complete cds.
          Length = 428

 Score =  149 bits (376), Expect = 2e-35
 Identities = 71/85 (83%), Positives = 78/85 (91%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + +K  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMD++CQAKSG
Sbjct: 33  KEMKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDILCQAKSG 92

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 93  MGKTAVFVLATLQQLEPVTGQVSVL 117



>gb:BC061280_2553057 Xenopus tropicalis hypothetical protein
           MGC75726, mRNA (cDNA clone MGC:75726 IMAGE:5381000),
           complete cds.
          Length = 428

 Score =  149 bits (376), Expect = 2e-35
 Identities = 71/85 (83%), Positives = 78/85 (91%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + +K  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMD++CQAKSG
Sbjct: 33  KEMKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDILCQAKSG 92

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 93  MGKTAVFVLATLQQLEPVTGQVSVL 117



>gb:BX248516_1991660 Human DNA sequence from clone DASS-161H22 on
           chromosome 6, complete sequence.
          Length = 197

 Score =  149 bits (375), Expect = 3e-35
 Identities = 72/82 (87%), Positives = 76/82 (92%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 33  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 92

Query: 445 MGKTAVFVLSTLQQIEPVAGQV 510
           MGKTAVFVL+TLQQ+EPV GQV
Sbjct: 93  MGKTAVFVLATLQQLEPVTGQV 114



>gb:BX001040_1991476 Human DNA sequence from clone DAQB-72H16 on
           chromosome 6 Contains HCG26, the gene coding for a
           transcript for an MHC class I fragment (clone 3.8-1),
           the MICB gene for MHC class I polypeptide-related
           sequence B, the PPIP9 peptidylprolyl isomerase
           (cyclophilin) pseudogene 9, the RPL15P4 ribosomal
           protein L15 pseudogene 4, the BAT1 gene for HLA-B
           associated transcript 1, the ATP6V1G2 gene for ATPase,
           H+ transporting, lysosomal 13kDa, V1 subunit G isoform
           2, the 5' end of the NFKBIL1 gene for nuclear factor of
           kappa light polypeptide gene enhancer in B-cells
           inhibitor-like 1 and two CpG islands, complete sequence.
          Length = 177

 Score =  149 bits (375), Expect = 3e-35
 Identities = 72/82 (87%), Positives = 76/82 (92%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 33  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 92

Query: 445 MGKTAVFVLSTLQQIEPVAGQV 510
           MGKTAVFVL+TLQQ+EPV GQV
Sbjct: 93  MGKTAVFVLATLQQLEPVTGQV 114



>gb:AL662801_1931489 Human DNA sequence from clone XXbac-296P20 on
           chromosome 6 contains a ribosomal protein L15 (RPL15)
           pseudogene, the BAT1 gene for HLA-B associated
           transcript 1, the ATP6V1G gene for ATPase, H+
           transporting, lysosomal 13kDa, V1 subunit G, the NFKBIL1
           gene for nuclear factor of kappa light polypeptide gene
           enhancer in B-cells inhibitor-like 1, the LTA gene for
           lymphotoxin alpha, the TNF gene for tumour necrosis
           factor, the LTB gene for lymphotoxin beta, the LST1 gene
           for leukocyte specific transcript 1, the LY117 gene for
           lymphocyte antigen 117, the AIF1 gene for alograft
           imflammatory factor 1, the BAT2 gene for HLA-B
           associated transcript 2, the BAT3 gene for HLA-B
           associated transcript 3, the APOM gene for
           apolipoprotein M, the 3' end of the gene for chromosome
           6, open reading frame 47 and four CpG islands, complete
           sequence.>gb:AL662847_1931734 Human DNA sequence from
           clone XXbac-270M2 on chromosome 6 contains the gene for
           a novel protein similar to similar to peptidyl-prolyl
           cis-trans isomerase A (PPIase), a ribosomal protein L15
           (RPL15) pseudogene, the BAT1 gene for HLA-B associated
           transcript 1, the ATP6V1G gene for ATPase, H+
           transporting, lysosomal 13kDa, V1 subunit G, the NFKBIL1
           gene for nuclear factor of kappa light polypeptide gene
           enhancer in B-cells inhibitor-like 1, the LTA gene for
           lymphotoxin alpha, the TNF gene for tumour necrosis
           factor, the LTB gene for lymphotoxin beta, the LST1 gene
           for leukocyte specific transcript 1, the LY117 gene for
           lymphocyte antigen 117, the AIF1 gene for alograft
           imflammatory factor 1, the BAT2 gene for HLA-B
           associated transcript 2, the 3' end of the BAT3 gene for
           HLA-B associated transcript 3 and two CpG islands,
           complete sequence.
          Length = 172

 Score =  149 bits (375), Expect = 3e-35
 Identities = 72/82 (87%), Positives = 76/82 (92%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 33  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 92

Query: 445 MGKTAVFVLSTLQQIEPVAGQV 510
           MGKTAVFVL+TLQQ+EPV GQV
Sbjct: 93  MGKTAVFVLATLQQLEPVTGQV 114



>gb:AK026614_1910664 Homo sapiens cDNA: FLJ22961 fis, clone
           KAT10214.
          Length = 461

 Score =  148 bits (373), Expect = 5e-35
 Identities = 72/85 (84%), Positives = 77/85 (90%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + +K  +V IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 66  KDIKGSHVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 125

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQIEPV GQV  L
Sbjct: 126 MGKTAVFVLATLQQIEPVNGQVTVL 150



>gb:HSU90426_2027133 Human nuclear RNA helicase, complete cds.
          Length = 427

 Score =  147 bits (372), Expect = 7e-35
 Identities = 72/85 (84%), Positives = 76/85 (89%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + +K  YV IHSSGFRDFLLKPELLRAIVD G EHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 32  KDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGLEHPSEVQHECIPQAILGMDVLCQAKSG 91

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQIEPV GQV  L
Sbjct: 92  MGKTAVFVLATLQQIEPVNGQVTVL 116



>gb:AF075691_1239002 Crassostrea gigas BAT1 homolog mRNA, complete
           cds.
          Length = 123

 Score =  147 bits (372), Expect = 7e-35
 Identities = 74/94 (78%), Positives = 79/94 (84%)
 Frame = +1

Query: 238 DSVGAKVNGESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGM 417
           D  G     + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAIL M
Sbjct: 23  DGTGDAPVKKDVKGTYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILSM 82

Query: 418 DVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           DV+CQAKSGMGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 83  DVLCQAKSGMGKTAVFVLATLQQLEPVDGQVSVL 116



>gb:AL662801_1931490 Human DNA sequence from clone XXbac-296P20 on
           chromosome 6 contains a ribosomal protein L15 (RPL15)
           pseudogene, the BAT1 gene for HLA-B associated
           transcript 1, the ATP6V1G gene for ATPase, H+
           transporting, lysosomal 13kDa, V1 subunit G, the NFKBIL1
           gene for nuclear factor of kappa light polypeptide gene
           enhancer in B-cells inhibitor-like 1, the LTA gene for
           lymphotoxin alpha, the TNF gene for tumour necrosis
           factor, the LTB gene for lymphotoxin beta, the LST1 gene
           for leukocyte specific transcript 1, the LY117 gene for
           lymphocyte antigen 117, the AIF1 gene for alograft
           imflammatory factor 1, the BAT2 gene for HLA-B
           associated transcript 2, the BAT3 gene for HLA-B
           associated transcript 3, the APOM gene for
           apolipoprotein M, the 3' end of the gene for chromosome
           6, open reading frame 47 and four CpG islands, complete
           sequence.>gb:AL662847_1931735 Human DNA sequence from
           clone XXbac-270M2 on chromosome 6 contains the gene for
           a novel protein similar to similar to peptidyl-prolyl
           cis-trans isomerase A (PPIase), a ribosomal protein L15
           (RPL15) pseudogene, the BAT1 gene for HLA-B associated
           transcript 1, the ATP6V1G gene for ATPase, H+
           transporting, lysosomal 13kDa, V1 subunit G, the NFKBIL1
           gene for nuclear factor of kappa light polypeptide gene
           enhancer in B-cells inhibitor-like 1, the LTA gene for
           lymphotoxin alpha, the TNF gene for tumour necrosis
           factor, the LTB gene for lymphotoxin beta, the LST1 gene
           for leukocyte specific transcript 1, the LY117 gene for
           lymphocyte antigen 117, the AIF1 gene for alograft
           imflammatory factor 1, the BAT2 gene for HLA-B
           associated transcript 2, the 3' end of the BAT3 gene for
           HLA-B associated transcript 3 and two CpG islands,
           complete sequence.
          Length = 113

 Score =  147 bits (371), Expect = 9e-35
 Identities = 71/81 (87%), Positives = 75/81 (92%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 33  KDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 92

Query: 445 MGKTAVFVLSTLQQIEPVAGQ 507
           MGKTAVFVL+TLQQ+EPV GQ
Sbjct: 93  MGKTAVFVLATLQQLEPVTGQ 113



>gb:AX885457_1480910 Sequence 1320 from Patent EP1033401.
          Length = 133

 Score =  147 bits (371), Expect = 9e-35
 Identities = 72/85 (84%), Positives = 77/85 (90%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLK ELLRAIVD GFEHPSEVQHECIPQAILGMDV+CQAKSG
Sbjct: 33  KDVKGSYVSIHSSGFRDFLLKXELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSG 92

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 93  MGKTAVFVLATLQQLEPVTGQVSVL 117



>pir|T37846|T37846 probable ATP-dependent RNA helicase - fission
           yeast  (Schizosaccharomyces pombe)>gb:SPAC17G6_1716759
           S.pombe chromosome I cosmid c17G6.
          Length = 434

 Score =  144 bits (362), Expect = 1e-33
 Identities = 75/89 (84%), Positives = 80/89 (89%), Gaps = 2/89 (2%)
 Frame = +1

Query: 259 NGE-SVKKG-YVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQ 432
           NGE S KKG YVGIHS+GFRDFLLKPELLRAI DSGFEHPSEVQ  CIPQ+ILG DV+CQ
Sbjct: 35  NGEKSDKKGSYVGIHSTGFRDFLLKPELLRAITDSGFEHPSEVQQVCIPQSILGTDVLCQ 94

Query: 433 AKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           AKSGMGKTAVFVLSTLQQIEPV G+V+ L
Sbjct: 95  AKSGMGKTAVFVLSTLQQIEPVDGEVSVL 123



>gb:AE017341_1754546 Cryptococcus neoformans var. neoformans JEC21
           chromosome 1, complete sequence.
          Length = 430

 Score =  142 bits (357), Expect = 4e-33
 Identities = 73/99 (73%), Positives = 82/99 (82%), Gaps = 4/99 (4%)
 Frame = +1

Query: 235 PDSVGAKVNGESV---KKG-YVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQ 402
           P +  A+ NG+     KKG YVGIHS+GFRDFLLKPELLRAI D GFEHPSEVQ ECIPQ
Sbjct: 21  PPAPAAETNGDKADGDKKGSYVGIHSTGFRDFLLKPELLRAISDLGFEHPSEVQQECIPQ 80

Query: 403 AILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           AILG DV+CQAKSGMGKTAVFVL+ LQQIEPV G+V+ +
Sbjct: 81  AILGTDVLCQAKSGMGKTAVFVLAALQQIEPVDGEVSII 119



>gb:AE017341_1754545 Cryptococcus neoformans var. neoformans JEC21
           chromosome 1, complete sequence.
          Length = 442

 Score =  142 bits (357), Expect = 4e-33
 Identities = 73/99 (73%), Positives = 82/99 (82%), Gaps = 4/99 (4%)
 Frame = +1

Query: 235 PDSVGAKVNGESV---KKG-YVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQ 402
           P +  A+ NG+     KKG YVGIHS+GFRDFLLKPELLRAI D GFEHPSEVQ ECIPQ
Sbjct: 33  PPAPAAETNGDKADGDKKGSYVGIHSTGFRDFLLKPELLRAISDLGFEHPSEVQQECIPQ 92

Query: 403 AILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           AILG DV+CQAKSGMGKTAVFVL+ LQQIEPV G+V+ +
Sbjct: 93  AILGTDVLCQAKSGMGKTAVFVLAALQQIEPVDGEVSII 131



>gb:CEU08102_1368390 Caenorhabditis elegans putative RNA helicase
           (hel) mRNA, partial cds.
          Length = 417

 Score =  140 bits (353), Expect = 1e-32
 Identities = 69/97 (71%), Positives = 79/97 (81%)
 Frame = +1

Query: 229 KAPDSVGAKVNGESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI 408
           K P+  G   +    K  Y  IHSSGFRDFLLKPE+LRAI D GFEHPSEVQHECIPQAI
Sbjct: 18  KQPEVGGG--DARKTKGTYASIHSSGFRDFLLKPEILRAIGDCGFEHPSEVQHECIPQAI 75

Query: 409 LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           LGMDV+CQAKSGMGKTAVFV++TLQQ+EPV G+V+ +
Sbjct: 76  LGMDVVCQAKSGMGKTAVFVITTLQQLEPVDGEVSVV 112



>gb:CEC26D10_1360684 Caenorhabditis elegans cosmid C26D10, complete
           sequence.
          Length = 268

 Score =  140 bits (353), Expect = 1e-32
 Identities = 69/97 (71%), Positives = 79/97 (81%)
 Frame = +1

Query: 229 KAPDSVGAKVNGESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI 408
           K P+  G   +    K  Y  IHSSGFRDFLLKPE+LRAI D GFEHPSEVQHECIPQAI
Sbjct: 19  KQPEVGGG--DARKTKGTYASIHSSGFRDFLLKPEILRAIGDCGFEHPSEVQHECIPQAI 76

Query: 409 LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           LGMDV+CQAKSGMGKTAVFV++TLQQ+EPV G+V+ +
Sbjct: 77  LGMDVVCQAKSGMGKTAVFVITTLQQLEPVDGEVSVV 113



>sp|Q18212|HE47_CAEEL Probable ATP-dependent RNA helicase p47
           homolog.>pir|T19484|T19484 hypothetical protein C26D10.2
           - Caenorhabditis elegans>gb:CEC26D10_1360683
           Caenorhabditis elegans cosmid C26D10, complete sequence.
          Length = 425

 Score =  140 bits (353), Expect = 1e-32
 Identities = 69/97 (71%), Positives = 79/97 (81%)
 Frame = +1

Query: 229 KAPDSVGAKVNGESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAI 408
           K P+  G   +    K  Y  IHSSGFRDFLLKPE+LRAI D GFEHPSEVQHECIPQAI
Sbjct: 19  KQPEVGGG--DARKTKGTYASIHSSGFRDFLLKPEILRAIGDCGFEHPSEVQHECIPQAI 76

Query: 409 LGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           LGMDV+CQAKSGMGKTAVFV++TLQQ+EPV G+V+ +
Sbjct: 77  LGMDVVCQAKSGMGKTAVFVITTLQQLEPVDGEVSVV 113



>sp|Q27268|HE47_DROME Probable ATP-dependent RNA helicase
           WM6.>pir|S51601|S51601 DEAD-box RNA helicase WM6 - fruit
           fly (Drosophila melanogaster)>gb:AE014134_1127669
           Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE014134_1127670 Drosophila melanogaster
           chromosome 2L, complete sequence.>gb:AE014134_1127671
           Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003610_1217776 Drosophila melanogaster
           chromosome 2L, section 19 of 83 of the complete
           sequence.>gb:AE003610_1217777 Drosophila melanogaster
           chromosome 2L, section 19 of 83 of the complete
           sequence.>gb:AE003610_1217778 Drosophila melanogaster
           chromosome 2L, section 19 of 83 of the complete
           sequence.>gb:AY118921_1300643 Drosophila melanogaster
           LD23644 full insert cDNA.>gb:DMWM6_1381189
           D.melanogaster WM6 mRNA.>gb:DRORNAHEL_1382643 Drosophila
           melanogaster DECD family putative RNA helicase gene,
           complete cds.
          Length = 424

 Score =  139 bits (350), Expect = 3e-32
 Identities = 65/77 (84%), Positives = 72/77 (93%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPE+LRAIVD GFEHPSEVQHECIPQA+LGMD++CQAKSG
Sbjct: 29  KDVKGTYVSIHSSGFRDFLLKPEILRAIVDCGFEHPSEVQHECIPQAVLGMDILCQAKSG 88

Query: 445 MGKTAVFVLSTLQQIEP 495
           MGKTAVFVL+TLQQ+EP
Sbjct: 89  MGKTAVFVLATLQQLEP 105



>gb:CTE428513_1375860 Chironomus tentans mRNA for HEL protein.
          Length = 421

 Score =  139 bits (349), Expect = 3e-32
 Identities = 66/85 (77%), Positives = 73/85 (85%)
 Frame = +1

Query: 265 ESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSG 444
           + VK  YV IHSSGFRDFLLKPE+LRAIVD GFEHPS VQHECIPQA+LGMD++CQAKSG
Sbjct: 27  KDVKGTYVSIHSSGFRDFLLKPEILRAIVDCGFEHPSAVQHECIPQAVLGMDILCQAKSG 86

Query: 445 MGKTAVFVLSTLQQIEPVAGQVAAL 519
           MGKTAVFVL+TLQQ+EP   Q   L
Sbjct: 87  MGKTAVFVLATLQQLEPTDNQAYVL 111



>gb:AY223417_1176876 Schistosoma japonicum clone ZZZ368 mRNA
           sequence.
          Length = 410

 Score =  137 bits (345), Expect = 1e-31
 Identities = 66/83 (79%), Positives = 73/83 (87%)
 Frame = +1

Query: 247 GAKVNGESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVI 426
           G  V  + VK  YV IHSSGFRDF+LKPELLRAIVD GFEHPSEVQHECIPQAIL MDV+
Sbjct: 25  GEAVAKKGVKGAYVTIHSSGFRDFILKPELLRAIVDCGFEHPSEVQHECIPQAILSMDVL 84

Query: 427 CQAKSGMGKTAVFVLSTLQQIEP 495
           CQAKSGMGKTAVFV++TLQQ++P
Sbjct: 85  CQAKSGMGKTAVFVIATLQQLDP 107



>gb:CR380958_1653373 Candida glabrata strain CBS138 chromosome L
           complete sequence.
          Length = 439

 Score =  133 bits (335), Expect = 1e-30
 Identities = 65/88 (73%), Positives = 77/88 (87%), Gaps = 1/88 (1%)
 Frame = +1

Query: 259 NGESVKKG-YVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQA 435
           NGE+ KKG YVGIHS+GF+DFLLKPEL RAI+D GFEHPSEVQ   IPQ+I G DV+CQA
Sbjct: 40  NGEADKKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQA 99

Query: 436 KSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           KSG+GKTAVFVLSTLQQ++PV G+V+ +
Sbjct: 100 KSGLGKTAVFVLSTLQQLDPVPGEVSVV 127



>gb:CR382125_1658207 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 437

 Score =  131 bits (329), Expect = 7e-30
 Identities = 68/98 (69%), Positives = 80/98 (81%), Gaps = 6/98 (6%)
 Frame = +1

Query: 244 VGAKVNGESV-----KKG-YVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQA 405
           V A+ NGES      KKG YVGIHS+GF+DFLLKPEL RAI+D GFEHPSEVQ   IPQ+
Sbjct: 28  VNAEGNGESQAKDSDKKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQS 87

Query: 406 ILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           I G DV+CQAKSG+GKTAVFVLSTLQQ++PV G+V+ +
Sbjct: 88  IHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVQGEVSVV 125



>sp|Q07478|SUB2_YEAST Probable ATP-dependent RNA helicase
           SUB2.>pir|S67620|S67620 hypothetical protein YDL084w -
           yeast (Saccharomyces cerevisiae)>gb:AY692907_1622954
           Saccharomyces cerevisiae clone FLH112723.01X YDL084W
           gene, complete cds.>gb:SCYDL084W_1711650 S.cerevisiae
           chromosome IV reading frame ORF YDL084w.
          Length = 446

 Score =  129 bits (323), Expect = 3e-29
 Identities = 63/83 (75%), Positives = 73/83 (87%), Gaps = 1/83 (1%)
 Frame = +1

Query: 274 KKG-YVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMG 450
           KKG YVGIHS+GF+DFLLKPEL RAI+D GFEHPSEVQ   IPQ+I G DV+CQAKSG+G
Sbjct: 52  KKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLG 111

Query: 451 KTAVFVLSTLQQIEPVAGQVAAL 519
           KTAVFVLSTLQQ++PV G+VA +
Sbjct: 112 KTAVFVLSTLQQLDPVPGEVAVV 134



>gb:AE016817_1747644 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 438

 Score =  127 bits (320), Expect = 8e-29
 Identities = 62/83 (74%), Positives = 73/83 (87%), Gaps = 1/83 (1%)
 Frame = +1

Query: 274 KKG-YVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMG 450
           KKG YVGIHS+GF+DFLLKPEL RAI+D GFEHPSEVQ   IPQ+I G DV+CQAKSG+G
Sbjct: 44  KKGSYVGIHSTGFKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLG 103

Query: 451 KTAVFVLSTLQQIEPVAGQVAAL 519
           KTAVFVLSTLQQ++PV G+V+ +
Sbjct: 104 KTAVFVLSTLQQLDPVPGEVSVV 126



>gb:AX716945_1473722 Sequence 56 from Patent WO03020757.
          Length = 437

 Score =  123 bits (309), Expect = 1e-27
 Identities = 60/83 (72%), Positives = 71/83 (85%), Gaps = 1/83 (1%)
 Frame = +1

Query: 274 KKG-YVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMG 450
           KKG YVGIHS+GF+DFLLKPEL RAI+D G EHP EVQ   IPQ+I G DV+CQAKSG+G
Sbjct: 44  KKGSYVGIHSTGFKDFLLKPELSRAIIDCGLEHPCEVQQHTIPQSIHGTDVLCQAKSGLG 103

Query: 451 KTAVFVLSTLQQIEPVAGQVAAL 519
           KTAVFVLSTLQQ++PV G+V+ +
Sbjct: 104 KTAVFVLSTLQQLDPVPGEVSVV 126



>pir|G71614|G71614 eIF-4A-like DEAD family RNA helicase PFB0445c -
           malaria parasite (Plasmodium
           falciparum)>gb:AE001362_939330 Plasmodium falciparum 3D7
           chromosome 2 complete sequence.>gb:AE001395_1208641
           Plasmodium falciparum 3D7 chromosome 2 section 32 of 73
           of the complete sequence.
          Length = 457

 Score =  112 bits (279), Expect = 4e-24
 Identities = 52/77 (67%), Positives = 63/77 (81%)
 Frame = +1

Query: 262 GESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKS 441
           G +++  Y  +H+ GF+DF LKPELLRAI +SGFEHPSEVQ E IP AI G D++CQAKS
Sbjct: 42  GGAMRGSYATVHTGGFKDFFLKPELLRAISESGFEHPSEVQQETIPAAITGTDILCQAKS 101

Query: 442 GMGKTAVFVLSTLQQIE 492
           GMGKTAVFVLS LQQ++
Sbjct: 102 GMGKTAVFVLSILQQLD 118



>gb:AY231673_1176966 Drosophila yakuba clone yak-em_Hel25E mRNA
           sequence.
          Length = 260

 Score =  106 bits (264), Expect = 2e-22
 Identities = 48/55 (87%), Positives = 54/55 (98%)
 Frame = +1

Query: 331 ELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP 495
           E+LRAIVD GFEHPSEVQHECIPQA+LGMD++CQAKSGMGKTAVFVL+TLQQ+EP
Sbjct: 1   EILRAIVDCGFEHPSEVQHECIPQAVLGMDILCQAKSGMGKTAVFVLATLQQLEP 55



>gb:AY142142_1303370 Giardia intestinalis putative RNA helicase
           gene, complete cds.
          Length = 454

 Score = 82.4 bits (202), Expect = 4e-15
 Identities = 46/90 (51%), Positives = 59/90 (65%), Gaps = 5/90 (5%)
 Frame = +1

Query: 247 GAKVNGESVKKGYVGIHSSG-----FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL 411
           GA+V   ++++   G   SG     F DF L+ E+L+AI+ +GFE PS+VQ   IP A+ 
Sbjct: 43  GAEVASGALRQARAGSPRSGALLTRFSDFNLREEVLQAIISNGFESPSDVQSMAIPPALE 102

Query: 412 GMDVICQAKSGMGKTAVFVLSTLQQIEPVA 501
             DVICQAKSG GKTAVFVLS L  I+P A
Sbjct: 103 HKDVICQAKSGKGKTAVFVLSLLHMIDPQA 132



>gb:YLAJ11564_1727886 Yarrowia lipolytica DHH1 gene.
          Length = 523

 Score = 81.6 bits (200), Expect = 6e-15
 Identities = 37/73 (50%), Positives = 51/73 (69%)
 Frame = +1

Query: 301 SGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTL 480
           +GF DF LK ELL  I ++GFE+PS +Q E IP A+ G D++ +AK+G GKTA FV+  L
Sbjct: 28  TGFEDFFLKRELLMGIFEAGFENPSPIQEEAIPIALAGRDILARAKNGTGKTAAFVIPAL 87

Query: 481 QQIEPVAGQVAAL 519
           QQ+ P   ++ AL
Sbjct: 88  QQVNPKVNKIQAL 100



>gb:CR382132_1665823 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 522

 Score = 81.6 bits (200), Expect = 6e-15
 Identities = 37/73 (50%), Positives = 51/73 (69%)
 Frame = +1

Query: 301 SGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTL 480
           +GF DF LK ELL  I ++GFE+PS +Q E IP A+ G D++ +AK+G GKTA FV+  L
Sbjct: 28  TGFEDFFLKRELLMGIFEAGFENPSPIQEEAIPIALAGRDILARAKNGTGKTAAFVIPAL 87

Query: 481 QQIEPVAGQVAAL 519
           QQ+ P   ++ AL
Sbjct: 88  QQVNPKVNKIQAL 100



>gb:CR380955_1651662 Candida glabrata strain CBS138 chromosome I
           complete sequence.
          Length = 507

 Score = 79.0 bits (193), Expect = 4e-14
 Identities = 37/73 (50%), Positives = 51/73 (69%)
 Frame = +1

Query: 301 SGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTL 480
           + F DF LK ELL  I ++GFE PS +Q E IP AI G D++ +AK+G GKTA FV+ TL
Sbjct: 31  NSFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTL 90

Query: 481 QQIEPVAGQVAAL 519
           ++I+P   ++ AL
Sbjct: 91  EKIKPKLNKIQAL 103



>gb:CR382123_1656205 Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 514

 Score = 78.2 bits (191), Expect = 7e-14
 Identities = 36/71 (50%), Positives = 50/71 (70%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F DF LK ELL  I ++GFE PS +Q E IP AI G D++ +AK+G GKTA FV+ TL++
Sbjct: 38  FEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAIAGKDILARAKNGTGKTAAFVIPTLEK 97

Query: 487 IEPVAGQVAAL 519
           ++P   ++ AL
Sbjct: 98  VKPKLNKIQAL 108



>sp|P39517|DHH1_YEAST Putative ATP-dependent RNA helicase
           DHH1.>pir|S31229|S31229 probable RNA helicase (EC
           3.6.1.-) DHH1 - yeast  (Saccharomyces
           cerevisiae)>gb:SC41KCIV_1705246 S.cerevisiae DNA (cosmid
           31A2; chromosome IV; 41 kb).>gb:SCRNAH_1709362
           S.cerevisiae gene for RNA-helicase.>gb:SCYDL160C_1711734
           S.cerevisiae chromosome IV reading frame ORF YDL160c.
          Length = 506

 Score = 78.2 bits (191), Expect = 7e-14
 Identities = 36/71 (50%), Positives = 50/71 (70%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F DF LK ELL  I ++GFE PS +Q E IP AI G D++ +AK+G GKTA FV+ TL++
Sbjct: 48  FEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIPTLEK 107

Query: 487 IEPVAGQVAAL 519
           ++P   ++ AL
Sbjct: 108 VKPKLNKIQAL 118



>gb:CR382138_1670944 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 362

 Score = 73.9 bits (180), Expect = 1e-12
 Identities = 33/46 (71%), Positives = 41/46 (89%)
 Frame = +1

Query: 382 QHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           Q  CIPQ+ILG DV+CQAKSG+GKTAVFVLSTLQQ++PV G+++ L
Sbjct: 5   QQVCIPQSILGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEISTL 50



>gb:AY039862_1560376 Arabidopsis thaliana At2g45810/F4I18.21 mRNA,
           complete cds.>gb:BT002709_1636312 Arabidopsis thaliana
           At2g45810/F4I18.21 gene, complete cds.
          Length = 528

 Score = 72.8 bits (177), Expect = 3e-12
 Identities = 33/71 (46%), Positives = 48/71 (67%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D+LLK +LLR I + GFE PS +Q E IP A+ G D++ +AK+G GKT  F + TL++
Sbjct: 156 FEDYLLKRDLLRGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKTGAFCIPTLEK 215

Query: 487 IEPVAGQVAAL 519
           I+P    + A+
Sbjct: 216 IDPENNVIQAV 226



>gb:CR382127_1659975 Yarrowia lipolytica chromosome A of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 377

 Score = 72.4 bits (176), Expect = 4e-12
 Identities = 33/47 (70%), Positives = 41/47 (87%)
 Frame = +1

Query: 379 VQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           VQ  CIPQ+ILG DV+CQAK+G+GKTAVFVLSTLQQ+EPV G+ + +
Sbjct: 19  VQQVCIPQSILGTDVLCQAKAGVGKTAVFVLSTLQQLEPVPGECSVV 65



>gb:AE016816_1746887 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome III, complete sequence.
          Length = 484

 Score = 72.0 bits (175), Expect = 5e-12
 Identities = 33/71 (46%), Positives = 48/71 (67%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F DF L+ ELL  I ++GFE PS +Q E IP A+   D++ +AK+G GKTA FV+ TL+ 
Sbjct: 31  FEDFYLRRELLMGIFEAGFERPSPIQEEAIPIALARRDILARAKNGTGKTAAFVIPTLEI 90

Query: 487 IEPVAGQVAAL 519
           ++P   ++ AL
Sbjct: 91  VKPKVNKIQAL 101



>pir|T02466|T02466 probable ATP-dependent RNA helicase [imported] -
           Arabidopsis thaliana>gb:AC004665_1531936 Arabidopsis
           thaliana chromosome 2 clone F4I18 map CIC02E07, complete
           sequence.
          Length = 528

 Score = 71.2 bits (173), Expect = 8e-12
 Identities = 32/71 (45%), Positives = 47/71 (66%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D+ LK +LLR I + GFE PS +Q E IP A+ G D++ +AK+G GKT  F + TL++
Sbjct: 156 FEDYFLKRDLLRGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKTGAFCIPTLEK 215

Query: 487 IEPVAGQVAAL 519
           I+P    + A+
Sbjct: 216 IDPENNVIQAV 226



>gb:AC084023_1733314 Oryza sativa chromosome 10 BAC OSJNBa0062C05
           genomic sequence, complete sequence.
          Length = 521

 Score = 69.7 bits (169), Expect = 2e-11
 Identities = 31/63 (49%), Positives = 43/63 (68%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D+ LK ELL  I + GFE PS +Q E IP A+ G D++ +AK+G GKTA F +  L++
Sbjct: 149 FEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFCIPALEK 208

Query: 487 IEP 495
           I+P
Sbjct: 209 IDP 211



>gb:AE016959_1023315 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC078840_1541527
           Oryza sativa chromosome 10 BAC OSJNBb0073N24 genomic
           sequence, complete sequence.>gb:AE017110_1753134 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           64 of 77 of the complete sequence.
          Length = 521

 Score = 69.7 bits (169), Expect = 2e-11
 Identities = 31/63 (49%), Positives = 43/63 (68%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D+ LK ELL  I + GFE PS +Q E IP A+ G D++ +AK+G GKTA F +  L++
Sbjct: 149 FEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFCIPALEK 208

Query: 487 IEP 495
           I+P
Sbjct: 209 IDP 211



>sp|Q09181|ST13_SCHPO Putative ATP-dependent RNA helicase
           ste13.>pir|S46654|S46654 probable ATP-dependent RNA
           helicase ste13p - fission yeast  (Schizosaccharomyces
           pombe)>gb:SPBC776_1720412 S.pombe chromosome II cosmid
           c776.>gb:YSPSTE13_1731232 Yeast ste13+ gene for RNA
           helicase, complete cds.
          Length = 485

 Score = 69.7 bits (169), Expect = 2e-11
 Identities = 31/71 (43%), Positives = 48/71 (67%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D+ LK ELL  I ++GFE PS +Q E IP A+ G D++ +AK+G GKTA FV+ +L++
Sbjct: 46  FEDYYLKRELLMGIFEAGFERPSPIQEESIPIALSGRDILARAKNGTGKTAAFVIPSLEK 105

Query: 487 IEPVAGQVAAL 519
           ++    ++  L
Sbjct: 106 VDTKKSKIQTL 116



>gb:AE017343_1755891 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 625

 Score = 69.3 bits (168), Expect = 3e-11
 Identities = 33/73 (45%), Positives = 46/73 (63%)
 Frame = +1

Query: 301 SGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTL 480
           S F DF L+ ELL  I  +GFE PS +Q + IP A+ G D++ +AK+G GKTA F++ TL
Sbjct: 36  SRFEDFGLRRELLMGIYTAGFERPSPIQEQAIPMALTGRDILARAKNGTGKTASFIIPTL 95

Query: 481 QQIEPVAGQVAAL 519
            +I      + AL
Sbjct: 96  NRINTSLSHIQAL 108



>gb:CR382121_1654727 Kluyveromyces lactis strain NRRL Y-1140
           chromosome A of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 398

 Score = 68.6 bits (166), Expect = 5e-11
 Identities = 36/74 (48%), Positives = 46/74 (62%)
 Frame = +1

Query: 298 SSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLST 477
           S+ F    LKP+LLR I   GFE+PS +Q   I Q I G DVI QA+SG GKTA F +  
Sbjct: 22  SATFESMNLKPDLLRGIYFYGFEYPSSIQSRAISQIISGKDVIAQAQSGTGKTATFTIGL 81

Query: 478 LQQIEPVAGQVAAL 519
           LQ I+  + ++ AL
Sbjct: 82  LQAIDSKSKELQAL 95



>pir|T47916|T47916 DEAD box RNA helicase RH12 - Arabidopsis
           thaliana>gb:ATT20K12_1554963 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T20K12.>gb:AY120712_1579594
           Arabidopsis thaliana DEAD box RNA helicase RH12
           (At3g61240) mRNA, complete cds.>gb:BT000038_1634316
           Arabidopsis thaliana DEAD box RNA helicase RH12
           (At3g61240) mRNA, complete cds.
          Length = 498

 Score = 68.2 bits (165), Expect = 7e-11
 Identities = 30/71 (42%), Positives = 46/71 (64%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D+ LK +LL+ I + GFE PS +Q E IP A+ G D++ +AK+G GKT  F +  L++
Sbjct: 126 FEDYFLKRDLLKGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKTGAFCIPVLEK 185

Query: 487 IEPVAGQVAAL 519
           I+P    + A+
Sbjct: 186 IDPNNNVIQAM 196



>gb:CR382127_1659974 Yarrowia lipolytica chromosome A of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 177

 Score = 67.8 bits (164), Expect = 9e-11
 Identities = 36/77 (46%), Positives = 42/77 (54%)
 Frame = +1

Query: 148 QEEAVMGENKENDAXXXXXXXXXXXXXKAPDSVGAKVNGESVKKGYVGIHSSGFRDFLLK 327
           +EE +   + E  A                ++   K      K  YVGIHS+GFRDFLLK
Sbjct: 93  EEELLDYSDSEEIALPSTTVESGSNGDAKAETTTVKEENTEQKGSYVGIHSTGFRDFLLK 152

Query: 328 PELLRAIVDSGFEHPSE 378
           PELLRAIVD GFEHPSE
Sbjct: 153 PELLRAIVDCGFEHPSE 169



>gb:AP004133_1838092 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1112_G03.
          Length = 483

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 30/62 (48%), Positives = 42/62 (67%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D+ LK ELL  I + GFE PS +Q E IP A+ G D++ +AK+G GKTA F +  L++
Sbjct: 111 FEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFCIPALEK 170

Query: 487 IE 492
           I+
Sbjct: 171 ID 172



>gb:AP004133_1838091 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1112_G03.
          Length = 508

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 30/62 (48%), Positives = 42/62 (67%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D+ LK ELL  I + GFE PS +Q E IP A+ G D++ +AK+G GKTA F +  L++
Sbjct: 136 FEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFCIPALEK 195

Query: 487 IE 492
           I+
Sbjct: 196 ID 197



>gb:OSJN00204_1696668 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0039L24, complete sequence.
          Length = 498

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 30/62 (48%), Positives = 42/62 (67%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D+ LK ELL  I + GFE PS +Q E IP A+ G D++ +AK+G GKTA F +  L++
Sbjct: 126 FEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGSDILARAKNGTGKTAAFCIPALEK 185

Query: 487 IE 492
           I+
Sbjct: 186 ID 187



>gb:AY080837_1568530 Arabidopsis thaliana putative RNA helicase
           (At4g00660) mRNA, complete cds.>gb:AY113985_1578396
           Arabidopsis thaliana putative RNA helicase (At4g00660)
           mRNA, complete cds.
          Length = 505

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 30/62 (48%), Positives = 42/62 (67%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D+ LK ELL  I + GFE PS +Q E IP A+ G D++ +AK+G GKTA F +  L++
Sbjct: 133 FEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGRDILARAKNGTGKTAAFCIPVLEK 192

Query: 487 IE 492
           I+
Sbjct: 193 ID 194



>pir|T01230|T01230 probable RNA helicase (EC 3.6.1.-) F6N23.6 -
           Arabidopsis thaliana>gb:ATCHRIV2_1544484 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           2.>gb:F6N23_1678531 Arabidopsis thaliana BAC F6N23.
          Length = 499

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 30/62 (48%), Positives = 42/62 (67%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D+ LK ELL  I + GFE PS +Q E IP A+ G D++ +AK+G GKTA F +  L++
Sbjct: 133 FEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGRDILARAKNGTGKTAAFCIPVLEK 192

Query: 487 IE 492
           I+
Sbjct: 193 ID 194



>pir|T51741|T51741 RNA helicase RH8 [imported] - Arabidopsis
           thaliana>gb:ATH010460_1551893 Arabidopsis thaliana mRNA
           for DEAD box RNA helicase, RH8.
          Length = 505

 Score = 67.0 bits (162), Expect = 2e-10
 Identities = 30/62 (48%), Positives = 42/62 (67%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D+ LK ELL  I + GFE PS +Q E IP A+ G D++ +AK+G GKTA F +  L++
Sbjct: 133 FEDYFLKRELLMGIYEKGFERPSPIQEESIPIALTGRDILARAKNGTGKTAAFCIPVLEK 192

Query: 487 IE 492
           I+
Sbjct: 193 ID 194



>gb:DROHELI_1382110 D.melanogaster RNA helicase mRNA, complete cds.
          Length = 459

 Score = 66.6 bits (161), Expect = 2e-10
 Identities = 31/71 (43%), Positives = 44/71 (61%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F +F LK ELL  I + G+E PS +Q   IP A+ G DV+ +AK+G GKT  + +  L+Q
Sbjct: 60  FEEFCLKRELLMGIFEKGWERPSPIQEAAIPIALSGKDVLARAKNGTGKTGAYCIPVLEQ 119

Query: 487 IEPVAGQVAAL 519
           I+P    + AL
Sbjct: 120 IDPTKDYIQAL 130



>gb:AY232161_1177454 Drosophila yakuba clone yak-ad_me31B mRNA
           sequence.
          Length = 133

 Score = 66.6 bits (161), Expect = 2e-10
 Identities = 31/71 (43%), Positives = 44/71 (61%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F +F LK ELL  I + G+E PS +Q   IP A+ G DV+ +AK+G GKT  + +  L+Q
Sbjct: 59  FEEFCLKRELLMGIFEKGWERPSPIQEAAIPIALSGKDVLARAKNGTGKTGAYCIPVLEQ 118

Query: 487 IEPVAGQVAAL 519
           I+P    + AL
Sbjct: 119 IDPTKDYIQAL 129



>gb:AE014134_1128513 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003628_1218620 Drosophila melanogaster
           chromosome 2L, section 37 of 83 of the complete
           sequence.
          Length = 428

 Score = 66.6 bits (161), Expect = 2e-10
 Identities = 31/71 (43%), Positives = 44/71 (61%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F +F LK ELL  I + G+E PS +Q   IP A+ G DV+ +AK+G GKT  + +  L+Q
Sbjct: 29  FEEFCLKRELLMGIFEKGWERPSPIQEAAIPIALSGKDVLARAKNGTGKTGAYCIPVLEQ 88

Query: 487 IEPVAGQVAAL 519
           I+P    + AL
Sbjct: 89  IDPTKDYIQAL 99



>sp|P23128|ME31_DROME Putative ATP-dependent RNA helicase me31b
           (Maternal expression at 31B).>gb:AE014134_1128512
           Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003628_1218619 Drosophila melanogaster
           chromosome 2L, section 37 of 83 of the complete
           sequence.>gb:AY051663_1290257 Drosophila melanogaster
           LD21247 full length cDNA.
          Length = 459

 Score = 66.6 bits (161), Expect = 2e-10
 Identities = 31/71 (43%), Positives = 44/71 (61%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F +F LK ELL  I + G+E PS +Q   IP A+ G DV+ +AK+G GKT  + +  L+Q
Sbjct: 60  FEEFCLKRELLMGIFEKGWERPSPIQEAAIPIALSGKDVLARAKNGTGKTGAYCIPVLEQ 119

Query: 487 IEPVAGQVAAL 519
           I+P    + AL
Sbjct: 120 IDPTKDYIQAL 130



>pir|T51743|T51743 RNA helicase RH12 [imported] - Arabidopsis
           thaliana>gb:ATH010464_1551897 Arabidopsis thaliana mRNA
           for DEAD box RNA helicase, RH12.
          Length = 498

 Score = 66.2 bits (160), Expect = 3e-10
 Identities = 29/71 (40%), Positives = 46/71 (64%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F ++ LK +LL+ I + GFE PS +Q E IP A+ G D++ +AK+G GKT  F +  L++
Sbjct: 126 FENYFLKRDLLKGIYEKGFEKPSPIQEESIPIALTGSDILARAKNGTGKTGAFCIPVLEK 185

Query: 487 IEPVAGQVAAL 519
           I+P    + A+
Sbjct: 186 IDPNNNVIQAM 196



>gb:XLEIF4AI_2582767 X.laevis mRNA for translation initiation factor
           eIF4A I.
          Length = 406

 Score = 65.5 bits (158), Expect = 5e-10
 Identities = 35/63 (55%), Positives = 38/63 (60%)
 Frame = +1

Query: 304 GFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQ 483
           GF D  L   LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQ
Sbjct: 33  GFDDMSLSESLLRGIYAYGFEKPSAIQQRAIMPCIKGYDVIAQAQSGTGKTATFAISILQ 92

Query: 484 QIE 492
           QIE
Sbjct: 93  QIE 95



>gb:AE017341_1754588 Cryptococcus neoformans var. neoformans JEC21
           chromosome 1, complete sequence.
          Length = 401

 Score = 64.7 bits (156), Expect = 8e-10
 Identities = 36/91 (39%), Positives = 51/91 (56%)
 Frame = +1

Query: 247 GAKVNGESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVI 426
           G +++G+ +   +  +  + F D  LK ELLR I   GFE PS +Q   I   + G D I
Sbjct: 11  GLQIDGDLINSNWNEVVDN-FDDMKLKGELLRGIYAYGFERPSAIQQRAIMPIVTGRDCI 69

Query: 427 CQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
            QA+SG GKTA F +S LQ+I+    +  AL
Sbjct: 70  AQAQSGTGKTATFSVSILQRIDTTVKKTQAL 100



>gb:CR382138_1670945 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 78

 Score = 64.7 bits (156), Expect = 8e-10
 Identities = 32/39 (82%), Positives = 35/39 (89%), Gaps = 1/39 (2%)
 Frame = +1

Query: 265 ESVKKG-YVGIHSSGFRDFLLKPELLRAIVDSGFEHPSE 378
           E+ KKG YVGIH++GFRDFLLKPELLRAI D GFEHPSE
Sbjct: 38  EADKKGSYVGIHATGFRDFLLKPELLRAIGDCGFEHPSE 76



>gb:BA000037_721486 Vibrio vulnificus YJ016 DNA, chromosome I,
           complete sequence.
          Length = 441

 Score = 64.3 bits (155), Expect = 1e-09
 Identities = 30/62 (48%), Positives = 41/62 (66%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L P LL AI + G+E P+++Q E IPQA+ G D++  A +G GKTA FVL  LQ 
Sbjct: 38  FADLDLDPNLLSAIEEMGYERPTQIQAEAIPQALEGRDILASAPTGTGKTAAFVLPALQY 97

Query: 487 IE 492
           ++
Sbjct: 98  LQ 99



>gb:AE016798_335305 Vibrio vulnificus CMCP6 chromosome I section 2
           of 11 of the complete sequence.>gb:AE016795_1045029
           Vibrio vulnificus CMCP6 chromosome I complete sequence.
          Length = 408

 Score = 64.3 bits (155), Expect = 1e-09
 Identities = 30/62 (48%), Positives = 41/62 (66%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L P LL AI + G+E P+++Q E IPQA+ G D++  A +G GKTA FVL  LQ 
Sbjct: 5   FADLDLDPNLLAAIEEMGYERPTQIQAEAIPQALEGRDILASAPTGTGKTAAFVLPALQY 64

Query: 487 IE 492
           ++
Sbjct: 65  LQ 66



>gb:AY752803_1179946 Culicoides sonorensis clone CseIF4a elongation
           factor 4A mRNA, complete cds.
          Length = 219

 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 36/71 (50%), Positives = 41/71 (57%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  LK ELLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F ++ LQQ
Sbjct: 31  FDDMNLKEELLRGIYGYGFEKPSAIQQRAIIPCIKGHDVIAQAQSGTGKTATFSIAILQQ 90

Query: 487 IEPVAGQVAAL 519
           I+       AL
Sbjct: 91  IDTALRDCQAL 101



>sp|P27639|IF4A_CAEEL Eukaryotic initiation factor 4A (eIF4A)
           (eIF-4A).>pir|S26281|S26281 translation initiation
           factor eIF-4A homolog - Caenorhabditis
           elegans>gb:CEEIF4AM_1361909 C.elegans mRNA for eIF-4A
           homologue.>gb:U13876_1401881 Caenorhabditis elegans
           cosmid F57B9, complete sequence.
          Length = 402

 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 39/93 (41%), Positives = 50/93 (53%)
 Frame = +1

Query: 241 SVGAKVNGESVKKGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMD 420
           +V + V+ + + +G        F D  LK ELLR I   GFE PS +Q   I     G D
Sbjct: 9   NVSSVVDADGLIEGNYDQVVESFDDMELKEELLRGIYGFGFEKPSAIQKRAIVPCTTGKD 68

Query: 421 VICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           VI QA+SG GKTA F +S LQ+I+     V AL
Sbjct: 69  VIAQAQSGTGKTATFSVSILQRIDHEDPHVQAL 101



>sp|Q12099|FAL1_YEAST Probable ATP-dependent RNA helicase
           FAL1.>pir|S54644|S54644 translation initiation factor
           eIF-4A homolog FAL1 - yeast  (Saccharomyces
           cerevisiae)>gb:AY723767_1624173 Saccharomyces cerevisiae
           clone FLH001364.01X YDR021W gene, complete
           cds.>gb:SC354CHIV_1705176 S.cerevisiae 35.4kb DNA region
           on left arm of chromosome IV.>gb:SC9335_1705839
           S.cerevisiae chromosome IV cosmid
           9335.>gb:SCYDR021W_1711842 S.cerevisiae chromosome IV
           reading frame ORF YDR021w.
          Length = 399

 Score = 63.9 bits (154), Expect = 1e-09
 Identities = 34/65 (52%), Positives = 39/65 (60%)
 Frame = +1

Query: 298 SSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLST 477
           SS F    LK +LLR I   GFE PS +Q   I Q I G DVI QA+SG GKTA F +  
Sbjct: 22  SSTFESMNLKDDLLRGIYSYGFEAPSSIQSRAITQIISGKDVIAQAQSGTGKTATFTIGL 81

Query: 478 LQQIE 492
           LQ I+
Sbjct: 82  LQAID 86



>gb:AF515726_2498839 Gallus gallus translational eukaryotic
           inititation factor 4AII (EIF4AII) mRNA, complete
           cds.>gb:AJ720280_2502467 Gallus gallus mRNA for
           hypothetical protein, clone 14a6.
          Length = 407

 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 34/62 (54%), Positives = 38/62 (61%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  LK  LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 35  FDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQ 94

Query: 487 IE 492
           +E
Sbjct: 95  LE 96



>gb:MMEIF4AR_2114804 Mouse eIF-4AII mRNA for protein synthesis
           initiation factor 4AII.
          Length = 407

 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 34/62 (54%), Positives = 38/62 (61%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  LK  LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 35  FDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQ 94

Query: 487 IE 492
           +E
Sbjct: 95  LE 96



>gb:HUMELF4AII_2030861 Homo sapiens mRNA for eukaryotic initiation
           factor 4AII, complete cds.
          Length = 407

 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 34/62 (54%), Positives = 38/62 (61%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  LK  LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 35  FDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQ 94

Query: 487 IE 492
           +E
Sbjct: 95  LE 96



>gb:BC015842_1975341 Homo sapiens eukaryotic translation initiation
           factor 4A, isoform 2, mRNA (cDNA clone MGC:27241
           IMAGE:4337581), complete cds.
          Length = 407

 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 34/62 (54%), Positives = 38/62 (61%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  LK  LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 35  FDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQ 94

Query: 487 IE 492
           +E
Sbjct: 95  LE 96



>gb:BC012547_1973667 Homo sapiens eukaryotic translation initiation
           factor 4A, isoform 2, mRNA (cDNA clone MGC:13368
           IMAGE:4079371), complete cds.>gb:BC048105_1984083 Homo
           sapiens eukaryotic translation initiation factor 4A,
           isoform 2, mRNA (cDNA clone MGC:57298 IMAGE:4820774),
           complete cds.>gb:MMEIF4AII_2114798 M.musculus eIF-4AII
           gene for protein synthesis initiation factor 4A.
          Length = 408

 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 34/62 (54%), Positives = 38/62 (61%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  LK  LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 36  FDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQ 95

Query: 487 IE 492
           +E
Sbjct: 96  LE 97



>gb:AX885065_1480518 Sequence 928 from Patent EP1033401.
          Length = 175

 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 34/62 (54%), Positives = 38/62 (61%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  LK  LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 18  FDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQ 77

Query: 487 IE 492
           +E
Sbjct: 78  LE 79



>gb:AK088669_1175543 Mus musculus 2 days neonate thymus thymic cells
           cDNA, RIKEN full-length enriched library,
           clone:E430023D03 product:EUKARYOTIC INITIATION FACTOR
           4A-II (EIF-4A-II) (EIF4A-II), full insert sequence.
          Length = 362

 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 34/62 (54%), Positives = 38/62 (61%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  LK  LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 35  FDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQ 94

Query: 487 IE 492
           +E
Sbjct: 95  LE 96



>gb:AE016767_327895 Escherichia coli CFT073 section 13 of 18 of the
           complete genome.>gb:AE014075_958479 Escherichia coli
           CFT073 complete genome.
          Length = 651

 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 31/71 (43%), Positives = 43/71 (60%)
 Frame = +1

Query: 283 YVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAV 462
           Y+    + F D  LK  +L A+ D G+E PS +Q ECIP  + G DV+  A++G GKTA 
Sbjct: 22  YMAEFETTFADLGLKAPILEALNDLGYEKPSPIQAECIPHLLNGRDVLGMAQTGSGKTAA 81

Query: 463 FVLSTLQQIEP 495
           F L  LQ ++P
Sbjct: 82  FSLPLLQNLDP 92



>gb:ECODEAD_128427 E.coli deaD gene, complete cds.
          Length = 571

 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 31/71 (43%), Positives = 43/71 (60%)
 Frame = +1

Query: 283 YVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAV 462
           Y+    + F D  LK  +L A+ D G+E PS +Q ECIP  + G DV+  A++G GKTA 
Sbjct: 17  YMAEFETTFADLGLKAPILEALNDLGYEKPSPIQAECIPHLLNGRDVLGMAQTGSGKTAA 76

Query: 463 FVLSTLQQIEP 495
           F L  LQ ++P
Sbjct: 77  FSLPLLQNLDP 87



>pir|F65106|F65106 probable ATP-dependent RNA helicase deaD -
           Escherichia coli  (strain K-12)>gb:AE005674_72787
           Shigella flexneri 2a str. 301, complete
           genome.>gb:ECOUW67_130725 Escherichia coli K-12
           chromosomal region from 67.4 to 76.0
           minutes.>gb:U00096_202173 Escherichia coli K-12 MG1655
           complete genome.>gb:AE016989_372931 Shigella flexneri 2a
           str. 2457T section 12 of 16 of the complete
           genome.>gb:AE014073_997681 Shigella flexneri 2a str.
           2457T complete genome.
          Length = 646

 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 31/71 (43%), Positives = 43/71 (60%)
 Frame = +1

Query: 283 YVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAV 462
           Y+    + F D  LK  +L A+ D G+E PS +Q ECIP  + G DV+  A++G GKTA 
Sbjct: 17  YMAEFETTFADLGLKAPILEALNDLGYEKPSPIQAECIPHLLNGRDVLGMAQTGSGKTAA 76

Query: 463 FVLSTLQQIEP 495
           F L  LQ ++P
Sbjct: 77  FSLPLLQNLDP 87



>pir|C91134|C91134 inducible ATP-independent RNA helicase [imported]
           - Escherichia coli (strain O157:H7, substrain RIMD
           0509952)>pir|F85979|F85979 inducible ATP-independent RNA
           helicase [imported] - Escherichia coli (strain O157:H7,
           substrain EDL933)>gb:AE005174_68297 Escherichia coli
           O157:H7 EDL933, complete genome.>gb:BA000007_662055
           Escherichia coli O157:H7 DNA, complete genome.
          Length = 646

 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 31/71 (43%), Positives = 43/71 (60%)
 Frame = +1

Query: 283 YVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAV 462
           Y+    + F D  LK  +L A+ D G+E PS +Q ECIP  + G DV+  A++G GKTA 
Sbjct: 17  YMAEFETTFADLGLKAPILEALNDLGYEKPSPIQAECIPHLLNGRDVLGMAQTGSGKTAA 76

Query: 463 FVLSTLQQIEP 495
           F L  LQ ++P
Sbjct: 77  FSLPLLQNLDP 87



>pir|A39157|A39157 probable RNA helicase (EC 3.6.1.-) - fruit fly
           (Drosophila melanogaster) (fragment)
          Length = 369

 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 30/68 (44%), Positives = 42/68 (61%)
 Frame = +1

Query: 316 FLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEP 495
           F LK ELL  I + G+E PS +Q   IP A+ G DV+ +AK+G GKT  + +  L+QI+P
Sbjct: 1   FCLKRELLMGIFEKGWERPSPIQEAAIPIALSGKDVLARAKNGTGKTGAYCIPVLEQIDP 60

Query: 496 VAGQVAAL 519
               + AL
Sbjct: 61  TKDYIQAL 68



>sp|Q14240|IF42_HUMAN Eukaryotic initiation factor 4A-II (eIF4A-II)
           (eIF-4A-II).>sp|P10630|IF42_MOUSE Eukaryotic initiation
           factor 4A-II (eIF4A-II) (eIF-4A-II).>pir|S00985|S00985
           translation initiation factor eIF-4A II -
           mouse>gb:AK076509_1171421 Mus musculus 0 day neonate
           head cDNA, RIKEN full-length enriched library,
           clone:4833432N07 product:EUKARYOTIC INITIATION FACTOR
           4A-II (EIF-4A-II) (EIF4A-II), full insert
           sequence.>gb:CR861119_1185134 Pongo pygmaeus mRNA; cDNA
           DKFZp459F0214 (from clone
           DKFZp459F0214).>gb:BC013708_1974184 Homo sapiens
           eukaryotic translation initiation factor 4A, isoform 2,
           mRNA (cDNA clone MGC:21863 IMAGE:4341420), complete
           cds.>gb:BT009860_1990997 Homo sapiens eukaryotic
           translation initiation factor 4A, isoform 2 mRNA,
           complete cds.>gb:BC085859_2109418 Rattus norvegicus
           eukaryotic translation initiation factor 4A2
           (predicted), mRNA (cDNA clone MGC:94588 IMAGE:7190333),
           complete cds.>gb:MMEIF4AII_2114799 M.musculus eIF-4AII
           gene for protein synthesis initiation factor 4A.
          Length = 407

 Score = 63.5 bits (153), Expect = 2e-09
 Identities = 34/62 (54%), Positives = 38/62 (61%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  LK  LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 35  FDDMNLKESLLRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQ 94

Query: 487 IE 492
           +E
Sbjct: 95  LE 96



>gb:XLEIF4AII_2582768 X.laevis mRNA for translation initiation
           factor eIF4A II, partial.
          Length = 413

 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 34/62 (54%), Positives = 37/62 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L   LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 40  FDDMSLSESLLRGIYAYGFEKPSAIQQRAIMPCIKGYDVIAQAQSGTGKTATFAISILQQ 99

Query: 487 IE 492
           IE
Sbjct: 100 IE 101



>gb:BC084468_2563842 Xenopus tropicalis hypothetical LOC496556, mRNA
           (cDNA clone MGC:89309 IMAGE:6986347), complete cds.
          Length = 406

 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 34/62 (54%), Positives = 37/62 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L   LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 34  FDDMSLSESLLRGIYAYGFEKPSAIQQRAIMPCIKGYDVIAQAQSGTGKTATFAISILQQ 93

Query: 487 IE 492
           IE
Sbjct: 94  IE 95



>gb:BC077641_2560340 Xenopus laevis translation initiation factor
           eIF4A II, mRNA (cDNA clone MGC:86382 IMAGE:7011148),
           complete cds.
          Length = 406

 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 34/62 (54%), Positives = 37/62 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L   LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 34  FDDMSLSESLLRGIYAYGFEKPSAIQQRAIMPCIKGYDVIAQAQSGTGKTATFAISILQQ 93

Query: 487 IE 492
           IE
Sbjct: 94  IE 95



>gb:BC068800_2555300 Xenopus laevis translation initiation factor
           eIF4A I, mRNA (cDNA clone MGC:81383 IMAGE:6634613),
           complete cds.
          Length = 406

 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 34/62 (54%), Positives = 37/62 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L   LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 34  FDDMSLSESLLRGIYAYGFEKPSAIQQRAIMPCIKGYDVIAQAQSGTGKTATFAISILQQ 93

Query: 487 IE 492
           IE
Sbjct: 94  IE 95



>gb:BC045237_2549092 Xenopus laevis translation initiation factor
           eIF4A II, mRNA (cDNA clone IMAGE:4887970), partial cds.
          Length = 404

 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 34/62 (54%), Positives = 37/62 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L   LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 32  FDDMSLSESLLRGIYAYGFEKPSAIQQRAIMPCIKGYDVIAQAQSGTGKTATFAISILQQ 91

Query: 487 IE 492
           IE
Sbjct: 92  IE 93



>gb:CR382128_1661208 Yarrowia lipolytica chromosome B of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 395

 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 33/64 (51%), Positives = 40/64 (62%)
 Frame = +1

Query: 301 SGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTL 480
           + F D  LK ELLR I   GFE+PS +Q   I   I G DV+ QA+SG GKTA F +S L
Sbjct: 22  TSFDDLGLKDELLRGIYGYGFENPSSIQQRAILPVIKGNDVLAQAQSGTGKTATFSISAL 81

Query: 481 QQIE 492
           Q I+
Sbjct: 82  QNID 85



>gb:AB052858_7693 Enterococcus faecium gene for
           autoaggregation-mediating protein, partial cds.
          Length = 210

 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 30/63 (47%), Positives = 44/63 (69%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F++  L PELL+++  +GFE  + +Q E IP A+ G DVI QA++G GKTA F L  L++
Sbjct: 3   FKELELSPELLKSVERAGFEEATPIQSETIPLALAGKDVIGQAQTGTGKTAAFGLPMLEK 62

Query: 487 IEP 495
           I+P
Sbjct: 63  IDP 65



>pir|JX0314|JX0314 DEAD box protein - Klebsiella
           pneumoniae>gb:KPNDEAD_139420 Klebsiella pneumoniae
           possible RNA helicase (deaD) gene, complete cds.
          Length = 659

 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 31/71 (43%), Positives = 42/71 (59%)
 Frame = +1

Query: 283 YVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAV 462
           Y+    + F D  LK  +L A+ D G+E PS +Q ECIP  + G DV+  A++G GKTA 
Sbjct: 16  YMAEFETTFADLGLKAPILEALTDLGYEKPSPIQAECIPHLLDGRDVLGMAQTGSGKTAA 75

Query: 463 FVLSTLQQIEP 495
           F L  L  I+P
Sbjct: 76  FSLPLLNNIDP 86



>sp|P47943|IF4A_SCHPO Eukaryotic initiation factor 4A (eIF4A)
           (eIF-4A).>pir|S71745|S71745 translation initiation
           factor eIF-4A [similarity] - fission yeast
           (Schizosaccharomyces pombe)>gb:SPAC1006_1716263 S.pombe
           chromosome I cosmid c1006.>gb:SPEIF4A_1721793 S.pombe
           eIF-4A mRNA for translation initiation
           factor.>gb:YSPTIF1A_1731237 Schizosaccharomyces pombe
           cell cycle control protein eIF-4A (tif1) mRNA, complete
           cds.
          Length = 392

 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 35/71 (49%), Positives = 42/71 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  LKPELLR I   GFE PS +Q   I   +   DV+ QA+SG GKTA F +S LQ+
Sbjct: 21  FDDMNLKPELLRGIYAYGFERPSAIQQRAIMPILGERDVLAQAQSGTGKTATFSISVLQK 80

Query: 487 IEPVAGQVAAL 519
           I+    Q  AL
Sbjct: 81  IDTSLKQCQAL 91



>gb:AL662801_1931484 Human DNA sequence from clone XXbac-296P20 on
           chromosome 6 contains a ribosomal protein L15 (RPL15)
           pseudogene, the BAT1 gene for HLA-B associated
           transcript 1, the ATP6V1G gene for ATPase, H+
           transporting, lysosomal 13kDa, V1 subunit G, the NFKBIL1
           gene for nuclear factor of kappa light polypeptide gene
           enhancer in B-cells inhibitor-like 1, the LTA gene for
           lymphotoxin alpha, the TNF gene for tumour necrosis
           factor, the LTB gene for lymphotoxin beta, the LST1 gene
           for leukocyte specific transcript 1, the LY117 gene for
           lymphocyte antigen 117, the AIF1 gene for alograft
           imflammatory factor 1, the BAT2 gene for HLA-B
           associated transcript 2, the BAT3 gene for HLA-B
           associated transcript 3, the APOM gene for
           apolipoprotein M, the 3' end of the gene for chromosome
           6, open reading frame 47 and four CpG islands, complete
           sequence.>gb:AL662847_1931729 Human DNA sequence from
           clone XXbac-270M2 on chromosome 6 contains the gene for
           a novel protein similar to similar to peptidyl-prolyl
           cis-trans isomerase A (PPIase), a ribosomal protein L15
           (RPL15) pseudogene, the BAT1 gene for HLA-B associated
           transcript 1, the ATP6V1G gene for ATPase, H+
           transporting, lysosomal 13kDa, V1 subunit G, the NFKBIL1
           gene for nuclear factor of kappa light polypeptide gene
           enhancer in B-cells inhibitor-like 1, the LTA gene for
           lymphotoxin alpha, the TNF gene for tumour necrosis
           factor, the LTB gene for lymphotoxin beta, the LST1 gene
           for leukocyte specific transcript 1, the LY117 gene for
           lymphocyte antigen 117, the AIF1 gene for alograft
           imflammatory factor 1, the BAT2 gene for HLA-B
           associated transcript 2, the 3' end of the BAT3 gene for
           HLA-B associated transcript 3 and two CpG islands,
           complete sequence.
          Length = 259

 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 29/35 (82%), Positives = 33/35 (94%)
 Frame = +1

Query: 415 MDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           MDV+CQAKSGMGKTAVFVL+TLQQ+EPV GQV+ L
Sbjct: 1   MDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVSVL 35



>pir|S30278|S30278 translation initiation factor eIF-4A - fruit fly
           (Drosophila melanogaster)>gb:DMEIF4A_1379496
           D.melanogaster gene for eIF-4A eukaryotic translation
           initiation factor.
          Length = 402

 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 34/71 (47%), Positives = 42/71 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L+ ELLR I   GFE PS +Q   I   + G DVI QA+SG GKTA F ++ LQQ
Sbjct: 32  FDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQ 91

Query: 487 IEPVAGQVAAL 519
           I+    +  AL
Sbjct: 92  IDTSIRECQAL 102



>sp|Q02748|IF4A_DROME Eukaryotic initiation factor 4A (eIF4A)
           (eIF-4A).>gb:AE014134_1127744 Drosophila melanogaster
           chromosome 2L, complete sequence.>gb:AE014134_1127745
           Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE014134_1127746 Drosophila melanogaster
           chromosome 2L, complete sequence.>gb:AE014134_1127747
           Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003612_1217851 Drosophila melanogaster
           chromosome 2L, section 21 of 83 of the complete
           sequence.>gb:AE003612_1217852 Drosophila melanogaster
           chromosome 2L, section 21 of 83 of the complete
           sequence.>gb:AE003612_1217853 Drosophila melanogaster
           chromosome 2L, section 21 of 83 of the complete
           sequence.>gb:AE003612_1217854 Drosophila melanogaster
           chromosome 2L, section 21 of 83 of the complete
           sequence.>gb:AF145621_1244680 Drosophila melanogaster
           clone GH03937 eukaryotic initiation factor-4a (eIF-4a)
           mRNA, complete cds.>gb:AY069283_1294013 Drosophila
           melanogaster GM14109 full length
           cDNA.>gb:AY121623_1301285 Drosophila melanogaster
           GH17619 full insert cDNA.
          Length = 403

 Score = 62.8 bits (151), Expect = 3e-09
 Identities = 34/71 (47%), Positives = 42/71 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L+ ELLR I   GFE PS +Q   I   + G DVI QA+SG GKTA F ++ LQQ
Sbjct: 32  FDDMNLREELLRGIYGYGFEKPSAIQQRAIIPCVRGRDVIAQAQSGTGKTATFSIAILQQ 91

Query: 487 IEPVAGQVAAL 519
           I+    +  AL
Sbjct: 92  IDTSIRECQAL 102



>gb:BC084034_2563442 Xenopus laevis hypothetical LOC494976, mRNA
           (cDNA clone IMAGE:7197002), partial cds.
          Length = 404

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 34/62 (54%), Positives = 37/62 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L   LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 32  FDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQ 91

Query: 487 IE 492
           IE
Sbjct: 92  IE 93



>gb:BC042330_2548141 Danio rerio zgc:55881, mRNA (cDNA clone
           MGC:55881 IMAGE:3818646), complete cds.
          Length = 346

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 29/35 (82%), Positives = 33/35 (94%)
 Frame = +1

Query: 415 MDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           MD++CQAKSGMGKTAVFVL+TLQQIEPV GQV+ L
Sbjct: 1   MDILCQAKSGMGKTAVFVLATLQQIEPVDGQVSVL 35



>gb:BT019879_2151582 Synthetic construct Homo sapiens eukaryotic
           translation initiation factor 4A, isoform 1 mRNA,
           partial cds.
          Length = 407

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 34/62 (54%), Positives = 37/62 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L   LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 34  FDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQ 93

Query: 487 IE 492
           IE
Sbjct: 94  IE 95



>gb:MUSELF4A5_2125725 Mus musculus protein synthesis initiation
           factor 4A (elf-4A) gene, exons 10 and 11, complete cds.
          Length = 406

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 34/62 (54%), Positives = 37/62 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L   LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 34  FDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQ 93

Query: 487 IE 492
           IE
Sbjct: 94  IE 95



>gb:MMEIF4AI_2114796 Mouse mRNA for initiation factor
           eIF-4AI.>gb:MMEIF4AL_2114801 Mouse mRNA for initiation
           factor eIF-4A long form.
          Length = 390

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 34/62 (54%), Positives = 37/62 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L   LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 18  FDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQ 77

Query: 487 IE 492
           IE
Sbjct: 78  IE 79



>gb:CR382138_1671911 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 474

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 29/58 (50%), Positives = 39/58 (67%)
 Frame = +1

Query: 346 IVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVAGQVAAL 519
           I ++GFE PS VQ E IP A+ G D++ +AK+G GKTA FV+  LQQ  P   ++ AL
Sbjct: 3   IFEAGFEKPSPVQEESIPMALAGRDILARAKNGTGKTASFVIPCLQQARPKVNKIQAL 60



>gb:AX969472_1484781 Sequence 275 from Patent EP1104808.
          Length = 166

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 34/62 (54%), Positives = 37/62 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L   LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 83  FDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQ 142

Query: 487 IE 492
           IE
Sbjct: 143 IE 144



>gb:AX887994_1483447 Sequence 3857 from Patent EP1033401.
          Length = 108

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 34/62 (54%), Positives = 37/62 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L   LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 34  FDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQ 93

Query: 487 IE 492
           IE
Sbjct: 94  IE 95



>gb:AX887993_1483446 Sequence 3856 from Patent EP1033401.
          Length = 125

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 34/62 (54%), Positives = 37/62 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L   LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 34  FDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQ 93

Query: 487 IE 492
           IE
Sbjct: 94  IE 95



>gb:AX885064_1480517 Sequence 927 from Patent EP1033401.
          Length = 123

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 34/62 (54%), Positives = 37/62 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L   LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 34  FDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQ 93

Query: 487 IE 492
           IE
Sbjct: 94  IE 95



>gb:AK011529_1156455 Mus musculus 10 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2610024E09
           product:EUKARYOTIC INITIATION FACTOR 4A-I (EIF-4A-I)
           (EIF4A-I), full insert sequence.
          Length = 236

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 34/62 (54%), Positives = 37/62 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L   LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 34  FDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQ 93

Query: 487 IE 492
           IE
Sbjct: 94  IE 95



>gb:AE017320_441550 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 12 of 12 of the complete
           genome.>gb:AE017285_1074711 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 532

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 34/71 (47%), Positives = 45/71 (63%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F+D  L+ ELL+AI + GF  PS +Q   IP+ + G DVI QA++G GKTA F L  LQ+
Sbjct: 7   FKDLPLEEELLKAIEELGFTEPSPIQSIAIPRLLEGRDVIGQAQTGTGKTAAFGLPLLQR 66

Query: 487 IEPVAGQVAAL 519
           I+     V AL
Sbjct: 67  IDAADRSVQAL 77



>gb:AE008851_244924 Salmonella typhimurium LT2, section 155 of 220
           of the complete genome.>gb:AE006468_1002006 Salmonella
           typhimurium LT2, complete genome.
          Length = 646

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 30/71 (42%), Positives = 42/71 (59%)
 Frame = +1

Query: 283 YVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAV 462
           Y+    + F D  LK  +L A+ D G+E PS +Q ECIP  + G DV+  A++G GKTA 
Sbjct: 17  YMAEFETTFADLGLKAPILEALTDLGYEKPSPIQAECIPHLLGGRDVLGMAQTGSGKTAA 76

Query: 463 FVLSTLQQIEP 495
           F L  L  ++P
Sbjct: 77  FSLPLLNNLDP 87



>pir|AB0901|AB0901 ATP-dependent RNA helicase (dead-box protein)
           [imported] - Salmonella enterica subsp. enterica serovar
           Typhi (strain CT18)>gb:AE016844_347192 Salmonella
           enterica subsp. enterica serovar Typhi Ty2, section 11
           of 16 of the complete genome.>gb:AL627278_543522
           Salmonella enterica serovar Typhi (Salmonella typhi)
           strain CT18, complete chromosome; segment
           14/20.>gb:AE014613_984524 Salmonella enterica subsp.
           enterica serovar Typhi Ty2, complete genome.
          Length = 646

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 30/71 (42%), Positives = 42/71 (59%)
 Frame = +1

Query: 283 YVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAV 462
           Y+    + F D  LK  +L A+ D G+E PS +Q ECIP  + G DV+  A++G GKTA 
Sbjct: 17  YMAEFETTFADLGLKAPILEALTDLGYEKPSPIQAECIPHLLGGRDVLGMAQTGSGKTAA 76

Query: 463 FVLSTLQQIEP 495
           F L  L  ++P
Sbjct: 77  FSLPLLNNLDP 87



>pir|S13269|S13269 translation initiation factor eIF-4A.I - rabbit
           (fragment)
          Length = 398

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 34/62 (54%), Positives = 37/62 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L   LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 26  FDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQ 85

Query: 487 IE 492
           IE
Sbjct: 86  IE 87



>sp|P29562|IF41_RABIT Eukaryotic initiation factor 4A-I (eIF4A-I)
           (eIF-4A-I) (Fragment).
          Length = 398

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 34/62 (54%), Positives = 37/62 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L   LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 26  FDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQ 85

Query: 487 IE 492
           IE
Sbjct: 86  IE 87



>sp|P60842|IF41_HUMAN Eukaryotic initiation factor 4A-I (eIF4A-I)
           (eIF-4A-I).>sp|P60843|IF41_MOUSE Eukaryotic initiation
           factor 4A-I (eIF4A-I) (eIF-4A-I).>pir|JS0039|FIMS4A
           translation initiation factor eIF-4A I -
           mouse>pir|S33681|S33681 translation initiation factor
           eIF-4A.I - human>gb:AK077429_1171847 Mus musculus 8 days
           embryo whole body cDNA, RIKEN full-length enriched
           library, clone:5730408A09 product:EUKARYOTIC INITIATION
           FACTOR 4A-I (EIF-4A-I) (EIF4A-I), full insert
           sequence.>gb:AX306781_1465648 Sequence 14 from Patent
           WO0018961.>gb:BC009585_1972118 Homo sapiens eukaryotic
           translation initiation factor 4A, isoform 1, mRNA (cDNA
           clone MGC:14648 IMAGE:4096621), complete
           cds.>gb:BC073752_1989069 Homo sapiens eukaryotic
           translation initiation factor 4A, isoform 1, mRNA (cDNA
           clone MGC:88756 IMAGE:6371531), complete
           cds.>gb:BT019880_1991281 Homo sapiens eukaryotic
           translation initiation factor 4A, isoform 1 mRNA,
           complete cds.>gb:BT019881_1991282 Homo sapiens
           eukaryotic translation initiation factor 4A, isoform 1
           mRNA, complete cds.>gb:HUM4AI_2028837 Homo sapiens mRNA
           for eukaryotic initiation factor 4AI, complete
           cds.>gb:AB011595_2043669 Mus musculus gene for eIF4A,
           complete cds.>gb:AL603707_2071124 Mouse DNA sequence
           from clone RP23-422L16 on chromosome 11 Contains the 3'
           end of the Sat2 gene for spermidine/spermine N1-acetyl
           transferase 2, a ribosomal potein S15A (Rps15a)
           pseudogene, a ubiquitin-like 5 (Ubl5) pseudogene, the
           Fxr2h gene for autosomal homolog of fragile X mental
           retardation gene 2, the Sox15 gene for SRY-box
           containing gene 15, the Mpdu1 gene for
           mannose-P-dolichol utilization defect 1, the Cd68 gene
           for CD68 antigen, the Eif4a1 gene for eukaryotic
           translation initiation factor 4A1, the gene for
           sentrin/SUMO-specific protease Smt3ip1, the Tnfsf13 and
           Tnfsf12 genes for tumor necrosis factor (ligand)
           superfamily members 13 and 12, three novel genes, a
           ribosomal protein L13 (Rpl13) pseudogene, the Polr2a
           gene for polymerase (RNA) II (DNA directed) polypeptide
           A, the Amac1 gene for acyl-malonyl condensing enzyme,
           the gene for a novel BTB/POZ domain containing C2H2 type
           zinc finger protein, the Chrnb1 gene for nicotinic
           cholinergic receptor beta polypeptide 1 (muscle), the
           Fgf11 gene for fibroblast growth factor 11, a novel
           pseudogene, the gene for the ortholog of human and rat
           neuroligin 2 NLGN2, the gene for a novel protein of
           unknown function (DUF423) family member, the Plscr3 gene
           for phospholipid scramblase 3, the 3' end of the Tnk1
           gene for non-receptor tyrosine kinase 1 and nine CpG
           islands, complete sequence.>gb:BC049915_2100255 Mus
           musculus eukaryotic translation initiation factor 4A1,
           mRNA (cDNA clone MGC:54779 IMAGE:5068709), complete
           cds.>gb:BC063812_2105269 Rattus norvegicus eukaryotic
           translation initiation factor 4A, isoform 1, mRNA (cDNA
           clone MGC:72964 IMAGE:6921521), complete cds.
          Length = 406

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 34/62 (54%), Positives = 37/62 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L   LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 34  FDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQ 93

Query: 487 IE 492
           IE
Sbjct: 94  IE 95



>sp|P23304|DEAD_ECOLI Cold-shock DEAD-box protein A (ATP-dependent
           RNA helicase deaD).
          Length = 628

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 30/63 (47%), Positives = 40/63 (63%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  LK  +L A+ D G+E PS +Q ECIP  + G DV+  A++G GKTA F L  LQ 
Sbjct: 7   FADLGLKAPILEALNDLGYEKPSPIQAECIPHLLNGRDVLGMAQTGSGKTAAFSLPLLQN 66

Query: 487 IEP 495
           ++P
Sbjct: 67  LDP 69



>sp|Q8XA87|DEAD_ECO57 Cold-shock DEAD-box protein A (ATP-dependent
           RNA helicase deaD).
          Length = 628

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 30/63 (47%), Positives = 40/63 (63%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  LK  +L A+ D G+E PS +Q ECIP  + G DV+  A++G GKTA F L  LQ 
Sbjct: 7   FADLGLKAPILEALNDLGYEKPSPIQAECIPHLLNGRDVLGMAQTGSGKTAAFSLPLLQN 66

Query: 487 IEP 495
           ++P
Sbjct: 67  LDP 69



>gb:AF399934_1268224 Spisula solidissima RNA helicase p47 mRNA,
           complete cds.
          Length = 449

 Score = 62.0 bits (149), Expect = 5e-09
 Identities = 28/71 (39%), Positives = 44/71 (61%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F DF LK +LL  I + G+E PS +Q   IP A+ G D++ +AK+G GKT  + +  L++
Sbjct: 55  FEDFCLKRDLLMGIFEKGWESPSPIQEASIPIALTGRDILARAKNGTGKTGAYAIPILER 114

Query: 487 IEPVAGQVAAL 519
           I+    +V A+
Sbjct: 115 IDNTKDEVQAM 125



>pir|F82295|F82295 ATP-dependent RNA helicase SrmB VC0660 [imported]
           - Vibrio cholerae (strain N16961 serogroup
           O1)>gb:AE004152_51056 Vibrio cholerae O1 biovar eltor
           str. N16961 chromosome I, section 60 of 251 of the
           complete chromosome.>gb:AE003852_1051830 Vibrio cholerae
           O1 biovar eltor str. N16961 chromosome I, complete
           chromosome.
          Length = 423

 Score = 62.0 bits (149), Expect = 5e-09
 Identities = 31/61 (50%), Positives = 39/61 (63%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L P LL AI + GF  P++VQ E IPQA+ G DV+  A +G GKTA FV+  LQ 
Sbjct: 5   FADLELDPILLEAIEEMGFSRPTQVQAEAIPQALDGRDVLASAPTGTGKTAAFVIPALQY 64

Query: 487 I 489
           +
Sbjct: 65  L 65



>sp|P33906|DEAD_KLEPN Cold-shock DEAD-box protein A (ATP-dependent
           RNA helicase deaD).
          Length = 642

 Score = 62.0 bits (149), Expect = 5e-09
 Identities = 30/63 (47%), Positives = 39/63 (61%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  LK  +L A+ D G+E PS +Q ECIP  + G DV+  A++G GKTA F L  L  
Sbjct: 7   FADLGLKAPILEALTDLGYEKPSPIQAECIPHLLDGRDVLGMAQTGSGKTAAFSLPLLNN 66

Query: 487 IEP 495
           I+P
Sbjct: 67  IDP 69



>gb:BC049427_2550236 Danio rerio eukaryotic translation initiation
           factor 4A, isoform 1B, mRNA (cDNA clone MGC:56410
           IMAGE:5605327), complete cds.
          Length = 406

 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 33/62 (53%), Positives = 38/62 (61%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L+  LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 34  FDDMNLRETLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQ 93

Query: 487 IE 492
           I+
Sbjct: 94  ID 95



>gb:BC048899_2550074 Danio rerio eukaryotic translation initiation
           factor 4A, isoform 1A, mRNA (cDNA clone MGC:55961
           IMAGE:3819402), complete cds.
          Length = 406

 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 33/62 (53%), Positives = 38/62 (61%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L+  LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 34  FDDMNLREALLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQ 93

Query: 487 IE 492
           I+
Sbjct: 94  ID 95



>gb:AE017349_1758785 Cryptococcus neoformans var. neoformans JEC21
           chromosome 9, complete sequence.
          Length = 484

 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 30/65 (46%), Positives = 40/65 (61%)
 Frame = +1

Query: 295 HSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS 474
           H+  F D  + PEL RA    GF+ PS++Q E IP A+ G D+I  A++G GKTA F L 
Sbjct: 36  HNKTFADLGISPELCRACASMGFKKPSDIQAEAIPHALEGKDIIGLAQTGSGKTAAFSLP 95

Query: 475 TLQQI 489
            LQ +
Sbjct: 96  ILQTL 100



>gb:PFMAL3P7_1394581 Plasmodium falciparum MAL3P7, complete
           sequence.
          Length = 433

 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 27/60 (45%), Positives = 40/60 (66%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D+ LK ELL  I + G+E PS +Q E IP A+ G +++ +AK+G GKTA F +  L++
Sbjct: 62  FEDYFLKRELLMGIFEKGYEKPSPIQEESIPVALAGKNILARAKNGTGKTAAFAIPLLEK 121



>gb:AP006840_568836 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 526

 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 31/71 (43%), Positives = 45/71 (63%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           FRD  L  ++L+A+ D GFE PS +Q + IP  + G DVI QA++G GKTA F +  +++
Sbjct: 8   FRDLALSEKVLKALDDMGFEEPSPIQAQAIPALLQGKDVIGQAQTGTGKTAAFGVPIVER 67

Query: 487 IEPVAGQVAAL 519
           + P    V AL
Sbjct: 68  LVPGQRAVQAL 78



>sp|P44586|DEAD_HAEIN Cold-shock DEAD-box protein A homolog
           (ATP-dependent RNA helicase deaD
           homolog).>pir|F64056|F64056 probable ATP-dependent RNA
           helicase - Haemophilus influenzae (strain Rd
           KW20)>gb:U32709_203914 Haemophilus influenzae Rd KW20
           section 24 of 163 of the complete
           genome.>gb:L42023_1096463 Haemophilus influenzae Rd KW20
           complete genome.
          Length = 613

 Score = 61.6 bits (148), Expect = 7e-09
 Identities = 30/63 (47%), Positives = 39/63 (61%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L   +L+A+ D GFE PS +Q  CIP  + G DV+  A++G GKTA F L  L Q
Sbjct: 7   FNDLGLPEFILKAVSDLGFETPSPIQQSCIPHLLNGNDVLGMAQTGSGKTAAFALPLLAQ 66

Query: 487 IEP 495
           I+P
Sbjct: 67  IDP 69



>gb:CR860906_1184950 Pongo pygmaeus mRNA; cDNA DKFZp470B2433 (from
           clone DKFZp470B2433).
          Length = 406

 Score = 61.2 bits (147), Expect = 9e-09
 Identities = 33/60 (55%), Positives = 36/60 (60%)
 Frame = +1

Query: 313 DFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIE 492
           D  L   LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQIE
Sbjct: 36  DMNLSESLLRGIYAYGFEKPSAIQQRAILSCIKGYDVIAQAQSGTGKTATFAISILQQIE 95



>gb:AE016862_351207 Pseudomonas syringae pv. tomato str. DC3000
           section 7 of 21 of the complete
           genome.>gb:AE016853_1036382 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 562

 Score = 61.2 bits (147), Expect = 9e-09
 Identities = 30/72 (41%), Positives = 44/72 (61%)
 Frame = +1

Query: 304 GFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQ 483
           GF    L P ++ A+V +G+E PS +Q + IP  + G D+I QA++G GKTA F L  L 
Sbjct: 7   GFAALELHPNIVAAVVATGYEEPSAIQQQSIPIILAGHDMIGQAQTGTGKTAAFALPILH 66

Query: 484 QIEPVAGQVAAL 519
           +I+P   +  AL
Sbjct: 67  RIDPTKREPQAL 78



>gb:CP000026_77859 Salmonella enterica subsp. enterica serovar
           Paratypi A str. ATCC 9150.
          Length = 629

 Score = 61.2 bits (147), Expect = 9e-09
 Identities = 29/63 (46%), Positives = 39/63 (61%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  LK  +L A+ D G+E PS +Q ECIP  + G DV+  A++G GKTA F L  L  
Sbjct: 8   FADLGLKAPILEALTDLGYEKPSPIQAECIPHLLGGRDVLGMAQTGSGKTAAFSLPLLNN 67

Query: 487 IEP 495
           ++P
Sbjct: 68  LDP 70



>gb:AY207392_1939194 Homo sapiens eukaryotic translation initiation
           factor 4A isoform 2-like protein mRNA, partial cds.
          Length = 101

 Score = 60.8 bits (146), Expect = 1e-08
 Identities = 33/62 (53%), Positives = 37/62 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  LK  L R I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQ
Sbjct: 25  FDDMNLKESLPRGIYAYGFEKPSAIQQRAIIPCIKGYDVIAQAQSGTGKTATFAISILQQ 84

Query: 487 IE 492
           +E
Sbjct: 85  LE 86



>gb:AY598438_2365404 Diachasmimorpha longicaudata entomopoxvirus
           unknown gene.
          Length = 379

 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 31/66 (46%), Positives = 40/66 (60%)
 Frame = +1

Query: 322 LKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVA 501
           LK  +L+ I   GFE PS +Q + I   I G DVI QA+SG GKTA + +S LQQI+   
Sbjct: 13  LKKNILKGIYSCGFEKPSTIQQKAIFPCISGKDVIVQAQSGTGKTATYAISVLQQIDTSN 72

Query: 502 GQVAAL 519
             + AL
Sbjct: 73  SNIQAL 78



>gb:AE016818_1748551 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 398

 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 34/74 (45%), Positives = 41/74 (55%)
 Frame = +1

Query: 298 SSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLST 477
           S  F    L+  LLR I   GFE PS +Q   I Q I G DVI QA+SG GKTA F +  
Sbjct: 22  SPTFESMKLQENLLRGIYGYGFEAPSAIQSRAITQIIRGKDVIAQAQSGTGKTATFTIGM 81

Query: 478 LQQIEPVAGQVAAL 519
           LQ I+  +  + AL
Sbjct: 82  LQVIDSSSKDLQAL 95



>gb:CR380959_1653935 Candida glabrata strain CBS138 chromosome M
           complete sequence.
          Length = 399

 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 33/65 (50%), Positives = 38/65 (58%)
 Frame = +1

Query: 298 SSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLST 477
           S+ F    LK  LLR I   GFE PS +Q   I Q I G DVI QA+SG GKTA F +  
Sbjct: 22  SATFESMDLKEGLLRGIYSYGFEAPSAIQSRAITQIISGKDVIAQAQSGTGKTATFTIGM 81

Query: 478 LQQIE 492
           LQ I+
Sbjct: 82  LQAID 86



>gb:BX640434_811784 Bordetella parapertussis strain 12822, complete
           genome; segment 12/14.
          Length = 477

 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 29/70 (41%), Positives = 45/70 (64%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F DF L P LL++I D+G+ +P+ +Q + IP  + G DV+  A++G GKTA F L  L +
Sbjct: 19  FADFGLHPLLLKSIADTGYTNPTPIQAQAIPVVVEGRDVMGAAQTGTGKTAAFTLPILHR 78

Query: 487 IEPVAGQVAA 516
           + P+A   A+
Sbjct: 79  LMPLANTSAS 88



>gb:AE017201_403642 Lactobacillus johnsonii NCC 533, section 2 of 7
           of the complete genome.>gb:AE017198_1122129
           Lactobacillus johnsonii NCC 533, complete genome.
          Length = 484

 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 31/71 (43%), Positives = 44/71 (61%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F +  LKPE+L+AI  SGFE  + +Q + IP  + G DVI QA++G GKTA F L  LQ 
Sbjct: 3   FSEMNLKPEILKAIKRSGFEEATPIQEKTIPLVLEGKDVIGQAQTGTGKTAAFGLPILQN 62

Query: 487 IEPVAGQVAAL 519
           ++     + A+
Sbjct: 63  LDKQHDSIQAI 73



>sp|P54824|DDX6_XENLA ATP-dependent RNA helicase p54
           (Xp54).>gb:XLRNAP54H_2583102 X.laevis mRNA for RNA
           helicase p54.
          Length = 481

 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 26/62 (41%), Positives = 42/62 (67%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D+ LK ELL  I + G+E PS +Q E IP A+ G D++ +AK+G GKT  +++  L++
Sbjct: 97  FEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKTGAYLIPLLER 156

Query: 487 IE 492
           ++
Sbjct: 157 LD 158



>gb:MMEIF4AI_2114797 Mouse mRNA for initiation factor
           eIF-4AI.>gb:MMEIF4AL_2114802 Mouse mRNA for initiation
           factor eIF-4A long form.
          Length = 370

 Score = 59.7 bits (143), Expect = 3e-08
 Identities = 32/57 (56%), Positives = 35/57 (61%)
 Frame = +1

Query: 322 LKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIE 492
           L   LLR I   GFE PS +Q   I   I G DVI QA+SG GKTA F +S LQQIE
Sbjct: 3   LSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIE 59



>gb:AB013609_2043770 Cavia porcellus mRNA for DEAD box protein,
           complete cds.
          Length = 472

 Score = 59.7 bits (143), Expect = 3e-08
 Identities = 26/71 (36%), Positives = 45/71 (63%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D+ LK ELL  I + G+E PS +Q E IP A+ G D++ +AK+G GK+  +++  L++
Sbjct: 87  FEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALTGRDILARAKNGTGKSGAYLIPLLER 146

Query: 487 IEPVAGQVAAL 519
           ++     + A+
Sbjct: 147 LDLKKDNIQAM 157



>gb:CAL390488_1644974 Candida albicans partial fal1 gene for
           ATP-dependent RNA helicase.
          Length = 176

 Score = 59.7 bits (143), Expect = 3e-08
 Identities = 32/71 (45%), Positives = 41/71 (57%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F    LKP+LL+ I   GFE PS +Q   I Q I G D I QA+SG GKTA F +  L+ 
Sbjct: 28  FESMNLKPDLLKGIYAYGFEAPSAIQSRAIMQIISGRDTIAQAQSGTGKTATFSIGMLEV 87

Query: 487 IEPVAGQVAAL 519
           I+  + +  AL
Sbjct: 88  IDTKSKECQAL 98



>gb:CAL250879_1644946 Candida albicans fal1 gene for ATP-dependent
           RNA helicase.
          Length = 399

 Score = 59.7 bits (143), Expect = 3e-08
 Identities = 32/71 (45%), Positives = 41/71 (57%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F    LKP+LL+ I   GFE PS +Q   I Q I G D I QA+SG GKTA F +  L+ 
Sbjct: 28  FESMNLKPDLLKGIYAYGFEAPSAIQSRAIMQIISGRDTIAQAQSGTGKTATFSIGMLEV 87

Query: 487 IEPVAGQVAAL 519
           I+  + +  AL
Sbjct: 88  IDTKSKECQAL 98



>gb:EMU292369_1384653 Echinococcus multilocularis mRNA for
           translation initiation factor 4A-like protein (eif4A
           gene).
          Length = 403

 Score = 59.7 bits (143), Expect = 3e-08
 Identities = 30/62 (48%), Positives = 39/62 (62%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F    L+ +LLR I   GFE PS +Q   I Q ILG DVI QA+SG GKTA   +++LQ 
Sbjct: 32  FDSMNLREDLLRGIYAYGFERPSAIQQRAIKQIILGRDVIAQAQSGTGKTATLAIASLQV 91

Query: 487 IE 492
           ++
Sbjct: 92  LD 93



>gb:BX950851_839470 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 637

 Score = 59.7 bits (143), Expect = 3e-08
 Identities = 27/65 (41%), Positives = 39/65 (60%)
 Frame = +1

Query: 301 SGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTL 480
           + F D  L   ++ A+ D G+E PS +Q ECIP  + G DV+  A++G GKTA F L  L
Sbjct: 6   TSFSDLGLSAPIINALTDLGYEKPSPIQAECIPHLLNGRDVLGMAQTGSGKTAAFALPLL 65

Query: 481 QQIEP 495
             ++P
Sbjct: 66  NNLKP 70



>gb:BX640421_807786 Bordetella pertussis strain Tohama I, complete
           genome; segment 11/12.
          Length = 477

 Score = 59.7 bits (143), Expect = 3e-08
 Identities = 29/70 (41%), Positives = 44/70 (62%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F DF L P LL+ I D+G+ +P+ +Q + IP  + G DV+  A++G GKTA F L  L +
Sbjct: 19  FADFGLHPLLLKLIADTGYTNPTPIQAQAIPVVVEGRDVMGAAQTGTGKTAAFTLPILHR 78

Query: 487 IEPVAGQVAA 516
           + P+A   A+
Sbjct: 79  LMPLANTSAS 88



>gb:BA000016_674436 Clostridium perfringens str. 13 DNA, complete
           genome.
          Length = 528

 Score = 59.7 bits (143), Expect = 3e-08
 Identities = 30/53 (56%), Positives = 37/53 (69%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVF 465
           F D  LK  LL+AI D GFE PS++Q E IP A+ G D+I QA++G GKTA F
Sbjct: 6   FDDLGLKESLLKAIKDMGFEEPSQIQAESIPVALEGHDIIGQAQTGTGKTAAF 58



>gb:AF542976_520681 Yersinia enterocolitica PNPase (pnp),
           lipoprotein Nlp1 (nlp1), and DeaD box RNA helicase
           (deaD) genes, complete cds.
          Length = 657

 Score = 59.7 bits (143), Expect = 3e-08
 Identities = 29/65 (44%), Positives = 39/65 (60%)
 Frame = +1

Query: 301 SGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTL 480
           + F D  L   +L A+ D G+E PS +Q ECIP  + G DV+  A++G GKTA F L  L
Sbjct: 7   TSFADLGLSAPILSALTDLGYEKPSPIQLECIPHLLNGRDVLGMAQTGSGKTAAFGLPLL 66

Query: 481 QQIEP 495
             I+P
Sbjct: 67  HNIDP 71



>pir|G64550|G64550 ATP-dependent RNA helicase, DEAD-box family -
           Helicobacter pylori (strain 26695)>gb:AE000544_24424
           Helicobacter pylori 26695 section 22 of 134 of the
           complete genome.>gb:AE000511_879863 Helicobacter pylori
           26695 complete genome.
          Length = 492

 Score = 59.7 bits (143), Expect = 3e-08
 Identities = 26/66 (39%), Positives = 40/66 (60%)
 Frame = +1

Query: 295 HSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS 474
           H   F D  LK  +L+++ ++GF  PS +Q + IP  + G DVI QA++G GKTA F L 
Sbjct: 18  HKPSFNDLGLKESVLKSVYEAGFTSPSPIQEKAIPAVLQGRDVIAQAQTGTGKTAAFALP 77

Query: 475 TLQQIE 492
            +  ++
Sbjct: 78  IINNLK 83



>pir|B71957|B71957 ATP-dependent RNA helicase dead - Helicobacter
           pylori  (strain J99)>gb:AE001461_35226 Helicobacter
           pylori, strain J99 section 22 of 132 of the complete
           genome.>gb:AE001439_883996 Helicobacter pylori, strain
           J99 complete genome.
          Length = 491

 Score = 59.7 bits (143), Expect = 3e-08
 Identities = 26/66 (39%), Positives = 40/66 (60%)
 Frame = +1

Query: 295 HSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLS 474
           H   F D  LK  +L+++ ++GF  PS +Q + IP  + G DVI QA++G GKTA F L 
Sbjct: 18  HKPSFNDLGLKESVLKSVYEAGFTSPSPIQEKAIPAVLQGRDVIAQAQTGTGKTAAFALP 77

Query: 475 TLQQIE 492
            +  ++
Sbjct: 78  IINNLK 83



>gb:AJ720165_2502352 Gallus gallus mRNA for hypothetical protein,
           clone 11n24.
          Length = 483

 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 26/71 (36%), Positives = 45/71 (63%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D+ LK ELL  I + G+E PS +Q E IP A+ G D++ +AK+G GK+  +++  L++
Sbjct: 98  FEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLER 157

Query: 487 IEPVAGQVAAL 519
           ++     + A+
Sbjct: 158 LDLKKDNIQAM 168



>gb:AF038995_2051892 Mus musculus putative RNA helicase RCK mRNA,
           partial cds.
          Length = 453

 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 26/71 (36%), Positives = 45/71 (63%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D+ LK ELL  I + G+E PS +Q E IP A+ G D++ +AK+G GK+  +++  L++
Sbjct: 73  FEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLER 132

Query: 487 IEPVAGQVAAL 519
           ++     + A+
Sbjct: 133 LDLKKDNIQAM 143



>gb:HUMRCK_2036239 Homo sapiens mRNA for RCK, complete cds.
          Length = 472

 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 26/71 (36%), Positives = 45/71 (63%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D+ LK ELL  I + G+E PS +Q E IP A+ G D++ +AK+G GK+  +++  L++
Sbjct: 87  FEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLER 146

Query: 487 IEPVAGQVAAL 519
           ++     + A+
Sbjct: 147 LDLKKDNIQAM 157



>gb:BC039826_1982639 Homo sapiens DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 6, mRNA (cDNA clone IMAGE:5582799), complete
           cds.
          Length = 187

 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 26/71 (36%), Positives = 45/71 (63%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D+ LK ELL  I + G+E PS +Q E IP A+ G D++ +AK+G GK+  +++  L++
Sbjct: 98  FEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLER 157

Query: 487 IEPVAGQVAAL 519
           ++     + A+
Sbjct: 158 LDLKKDNIQAM 168



>gb:AY050367_1562146 Arabidopsis thaliana AT3g19760/MMB12_21 mRNA,
           complete cds.>gb:BT002207_1635810 Arabidopsis thaliana
           At3g19760/MMB12_21 mRNA, complete cds.
          Length = 408

 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 28/73 (38%), Positives = 44/73 (60%)
 Frame = +1

Query: 301 SGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTL 480
           + F D  +K ++LR + + GFE PS +Q   +   + G DVI QA+SG GKT++  LS  
Sbjct: 35  TSFNDMGIKEDVLRGVYEYGFEKPSAIQQRAVMPILQGRDVIAQAQSGTGKTSMIALSVC 94

Query: 481 QQIEPVAGQVAAL 519
           Q ++  + +V AL
Sbjct: 95  QVVDTSSREVQAL 107



>gb:AY089635_1297291 Drosophila melanogaster RE50350 full insert
           cDNA.
          Length = 399

 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 32/71 (45%), Positives = 39/71 (54%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F    LK ELLR I   GFE PS +Q   I   + G DVI QA+SG GKTA F +S LQ 
Sbjct: 28  FNAMNLKEELLRGIYAYGFEKPSAIQQRSITPIVKGRDVIAQAQSGTGKTATFSISILQS 87

Query: 487 IEPVAGQVAAL 519
           ++    +   L
Sbjct: 88  LDTTLRETQVL 98



>gb:CR857097_1181350 Pongo pygmaeus mRNA; cDNA DKFZp469I1738 (from
           clone DKFZp469I1738).
          Length = 483

 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 26/71 (36%), Positives = 45/71 (63%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D+ LK ELL  I + G+E PS +Q E IP A+ G D++ +AK+G GK+  +++  L++
Sbjct: 98  FEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLER 157

Query: 487 IEPVAGQVAAL 519
           ++     + A+
Sbjct: 158 LDLKKDNIQAM 168



>gb:AK054144_1170718 Mus musculus 2 days pregnant adult female
           oviduct cDNA, RIKEN full-length enriched library,
           clone:E230023J21 product:DEAD
           (aspartate-glutamate-alanine-aspartate) box polypeptide
           6, full insert sequence.
          Length = 483

 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 26/71 (36%), Positives = 45/71 (63%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D+ LK ELL  I + G+E PS +Q E IP A+ G D++ +AK+G GK+  +++  L++
Sbjct: 98  FEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLER 157

Query: 487 IEPVAGQVAAL 519
           ++     + A+
Sbjct: 158 LDLKKDNIQAM 168



>gb:AE014297_1138455 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003678_1220448 Drosophila melanogaster
           chromosome 3R, section 16 of 118 of the complete
           sequence.
          Length = 399

 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 32/71 (45%), Positives = 39/71 (54%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F    LK ELLR I   GFE PS +Q   I   + G DVI QA+SG GKTA F +S LQ 
Sbjct: 28  FNAMNLKEELLRGIYAYGFEKPSAIQQRSITPIVKGRDVIAQAQSGTGKTATFSISILQS 87

Query: 487 IEPVAGQVAAL 519
           ++    +   L
Sbjct: 88  LDTTLRETQVL 98



>gb:CP000024_877346 Streptococcus thermophilus CNRZ1066, complete
           genome.
          Length = 528

 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 32/71 (45%), Positives = 42/71 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L  ++  A+V +GFE PS +Q   IP A+ G DVI QA++G GKTA F L TL +
Sbjct: 3   FTDLNLSEDIQSAVVAAGFEQPSPIQELTIPLALEGKDVIGQAQTGTGKTAAFGLPTLDK 62

Query: 487 IEPVAGQVAAL 519
           I      + AL
Sbjct: 63  IRTEENTIQAL 73



>gb:CP000023_875419 Streptococcus thermophilus LMG 18311, complete
           genome.
          Length = 528

 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 32/71 (45%), Positives = 42/71 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L  ++  A+V +GFE PS +Q   IP A+ G DVI QA++G GKTA F L TL +
Sbjct: 3   FTDLNLSEDIQSAVVAAGFEQPSPIQELTIPLALEGKDVIGQAQTGTGKTAAFGLPTLDK 62

Query: 487 IEPVAGQVAAL 519
           I      + AL
Sbjct: 63  IHTEENTIQAL 73



>gb:BA000031_705965 Vibrio parahaemolyticus RIMD 2210633 DNA,
           chromosome 1, complete sequence.
          Length = 407

 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 28/62 (45%), Positives = 40/62 (64%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F +  L   LL AI + G+E P+++Q E IPQA+ G D++  A +G GKTA FVL  LQ 
Sbjct: 5   FAELDLDQNLLEAIEEMGYERPTKIQAEAIPQALDGRDILASAPTGTGKTAAFVLPALQY 64

Query: 487 IE 492
           ++
Sbjct: 65  LQ 66



>gb:AE016949_364919 Enterococcus faecalis V583, section 3 of 11 of
           the complete genome.>gb:AE016830_991407 Enterococcus
           faecalis V583, complete genome.
          Length = 536

 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 32/72 (44%), Positives = 45/72 (62%)
 Frame = +1

Query: 277 KGYVGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKT 456
           K  +G +   F++  L PELL A+  +GFE  + +Q E IP A+ G DVI QA++G GKT
Sbjct: 14  KQNLGGYHLKFKELGLAPELLSAVERAGFEEATPIQSETIPLALAGKDVIGQAQTGTGKT 73

Query: 457 AVFVLSTLQQIE 492
           A F L  L +I+
Sbjct: 74  AAFGLPMLNKID 85



>pir|T51737|T51737 RNA helicase RH2 [imported] - Arabidopsis
           thaliana>gb:ATH010456_1551889 Arabidopsis thaliana mRNA
           for DEAD box RNA helicase, RH2.>gb:AP000417_1820127
           Arabidopsis thaliana genomic DNA, chromosome 3, P1
           clone: MMB12.
          Length = 391

 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 28/73 (38%), Positives = 44/73 (60%)
 Frame = +1

Query: 301 SGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTL 480
           + F D  +K ++LR + + GFE PS +Q   +   + G DVI QA+SG GKT++  LS  
Sbjct: 18  TSFNDMGIKEDVLRGVYEYGFEKPSAIQQRAVMPILQGRDVIAQAQSGTGKTSMIALSVC 77

Query: 481 QQIEPVAGQVAAL 519
           Q ++  + +V AL
Sbjct: 78  QVVDTSSREVQAL 90



>pir|S22651|S22651 probable RNA helicase (EC 3.6.1.-) RCK -
           human>gb:BC065007_1986715 Homo sapiens DEAD
           (Asp-Glu-Ala-Asp) box polypeptide 6, mRNA (cDNA clone
           MGC:74611 IMAGE:6163439), complete cds.
          Length = 483

 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 26/71 (36%), Positives = 45/71 (63%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D+ LK ELL  I + G+E PS +Q E IP A+ G D++ +AK+G GK+  +++  L++
Sbjct: 98  FEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLER 157

Query: 487 IEPVAGQVAAL 519
           ++     + A+
Sbjct: 158 LDLKKDNIQAM 168



>sp|P54823|DDX6_MOUSE Probable ATP-dependent RNA helicase p54
           (Oncogene RCK homolog) (DEAD- box protein
           6).>gb:BC021452_2093470 Mus musculus DEAD
           (Asp-Glu-Ala-Asp) box polypeptide 6, mRNA (cDNA clone
           MGC:29113 IMAGE:5043599), complete
           cds.>gb:MUSMRCK_2129227 Mus musculus mRNA for RCK,
           complete cds.
          Length = 483

 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 26/71 (36%), Positives = 45/71 (63%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D+ LK ELL  I + G+E PS +Q E IP A+ G D++ +AK+G GK+  +++  L++
Sbjct: 98  FEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLER 157

Query: 487 IEPVAGQVAAL 519
           ++     + A+
Sbjct: 158 LDLKKDNIQAM 168



>sp|P26196|DDX6_HUMAN Probable ATP-dependent RNA helicase p54
           (Oncogene RCK) (DEAD-box protein 6).
          Length = 483

 Score = 59.3 bits (142), Expect = 3e-08
 Identities = 26/71 (36%), Positives = 45/71 (63%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D+ LK ELL  I + G+E PS +Q E IP A+ G D++ +AK+G GK+  +++  L++
Sbjct: 98  FEDYCLKRELLMGIFEMGWEKPSPIQEESIPIALSGRDILARAKNGTGKSGAYLIPLLER 157

Query: 487 IEPVAGQVAAL 519
           ++     + A+
Sbjct: 158 LDLKKDNIQAM 168



>gb:NC8D4_1688770 Neurospora crassa DNA linkage group V Cosmid
           contig 8D4.
          Length = 400

 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 35/78 (44%), Positives = 42/78 (53%)
 Frame = +1

Query: 286 VGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVF 465
           V +H + F    LK  LLR I   G+E PS VQ   I Q   G D I QA+SG GKTA F
Sbjct: 22  VTVHPT-FESMSLKESLLRGIYAYGYESPSAVQSRAIVQICKGRDTIAQAQSGTGKTATF 80

Query: 466 VLSTLQQIEPVAGQVAAL 519
            +S LQ I+    +  AL
Sbjct: 81  SISMLQVIDTAVRETQAL 98



>gb:CR382136_1669297 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 397

 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 29/62 (46%), Positives = 38/62 (61%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  LKP ++R I   G+E PS +Q   I     G DV+ QA+SG GKTA F +S LQ+
Sbjct: 25  FDDLNLKPNIVRGIFGYGYESPSAIQQRAILPITEGRDVLAQAQSGTGKTATFTISALQR 84

Query: 487 IE 492
           I+
Sbjct: 85  ID 86



>gb:AC024844_1204946 Caenorhabditis elegans cosmid Y65B4A, complete
           sequence.
          Length = 399

 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 30/66 (45%), Positives = 39/66 (59%)
 Frame = +1

Query: 322 LKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVA 501
           L+ +LLR I   GFE PS +Q   IP  +   DVI QA+SG GKTA F +S LQ ++   
Sbjct: 33  LREDLLRGIYAYGFEKPSAIQQRAIPAILKARDVIAQAQSGTGKTATFSISVLQSLDTQV 92

Query: 502 GQVAAL 519
            +  AL
Sbjct: 93  RETQAL 98



>gb:AB074896_1197549 Marsupenaeus japonicus eIF4A-1 mRNA for
           eukaryotic initiation factor eIF-4A like protein,
           partial cds.
          Length = 201

 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 32/74 (43%), Positives = 42/74 (56%)
 Frame = +1

Query: 298 SSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLST 477
           ++ F D  L   LLR I   GFE PS +Q   I   I G D I QA+SG GKTA F ++ 
Sbjct: 59  ATSFDDMNLNESLLRGIYAYGFEKPSAIQQRAIMPCIKGHDAIAQAQSGTGKTATFSIAI 118

Query: 478 LQQIEPVAGQVAAL 519
           LQ+I+  + +  AL
Sbjct: 119 LQRIDSKSQETQAL 132



>pir|T48731|T48731 probable translation initiation factor eIF-4A
           [imported] - Neurospora crassa
          Length = 387

 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 35/78 (44%), Positives = 42/78 (53%)
 Frame = +1

Query: 286 VGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVF 465
           V +H + F    LK  LLR I   G+E PS VQ   I Q   G D I QA+SG GKTA F
Sbjct: 22  VTVHPT-FESMSLKESLLRGIYAYGYESPSAVQSRAIVQICKGRDTIAQAQSGTGKTATF 80

Query: 466 VLSTLQQIEPVAGQVAAL 519
            +S LQ I+    +  AL
Sbjct: 81  SISMLQVIDTAVRETQAL 98



>sp|Q10055|IF4N_SCHPO Eukaryotic initiation factor 4A-like protein
           C1F5.10.>pir|T38085|T38085 translation initiation factor
           eIF-4a - fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC1F5_1717030 S. pombe chromosome I cosmid
           c1F5.
          Length = 394

 Score = 58.9 bits (141), Expect = 4e-08
 Identities = 32/64 (50%), Positives = 38/64 (59%)
 Frame = +1

Query: 301 SGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTL 480
           S F +  LK +LLR I   G+E PS VQ   I Q   G DVI QA+SG GKTA F +  L
Sbjct: 21  SSFEEMNLKEDLLRGIYAYGYETPSAVQSRAIIQICKGRDVIAQAQSGTGKTATFSIGIL 80

Query: 481 QQIE 492
           Q I+
Sbjct: 81  QSID 84



>pir|T32773|T32773 hypothetical protein F33D11.10 - Caenorhabditis
           elegans>gb:AF039720_1235579 Caenorhabditis elegans
           cosmid F33D11, complete sequence.
          Length = 399

 Score = 58.5 bits (140), Expect = 6e-08
 Identities = 29/66 (43%), Positives = 39/66 (59%)
 Frame = +1

Query: 322 LKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVA 501
           L+ +LLR I   GFE PS +Q   +P  +   DVI QA+SG GKTA F +S LQ ++   
Sbjct: 33  LREDLLRGIYAYGFEKPSAIQQRAVPAILKARDVIAQAQSGTGKTATFSISVLQSLDTQV 92

Query: 502 GQVAAL 519
            +  AL
Sbjct: 93  RETQAL 98



>gb:BC084859_2564103 Xenopus laevis cDNA clone MGC:85498
           IMAGE:6940048, complete cds.
          Length = 415

 Score = 58.2 bits (139), Expect = 7e-08
 Identities = 31/66 (46%), Positives = 40/66 (60%)
 Frame = +1

Query: 322 LKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVA 501
           L+ +LLR I   GFE PS +Q   I Q I G DVI Q++SG GKTA F +S LQ ++   
Sbjct: 49  LREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDIQV 108

Query: 502 GQVAAL 519
            +  AL
Sbjct: 109 RETQAL 114



>gb:BC045939_2549453 Danio rerio zgc:56139, mRNA (cDNA clone
           MGC:56139 IMAGE:5411951), complete cds.
          Length = 406

 Score = 58.2 bits (139), Expect = 7e-08
 Identities = 31/66 (46%), Positives = 40/66 (60%)
 Frame = +1

Query: 322 LKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVA 501
           L+ +LLR I   GFE PS +Q   I Q I G DVI Q++SG GKTA F +S LQ ++   
Sbjct: 40  LREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDIQV 99

Query: 502 GQVAAL 519
            +  AL
Sbjct: 100 RETQAL 105



>gb:AJ719548_2501735 Gallus gallus mRNA for hypothetical protein,
           clone 3e17.
          Length = 412

 Score = 58.2 bits (139), Expect = 7e-08
 Identities = 31/66 (46%), Positives = 40/66 (60%)
 Frame = +1

Query: 322 LKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVA 501
           L+ +LLR I   GFE PS +Q   I Q I G DVI Q++SG GKTA F +S LQ ++   
Sbjct: 46  LREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQV 105

Query: 502 GQVAAL 519
            +  AL
Sbjct: 106 RETQAL 111



>gb:AF020432_2469032 Xenopus laevis eukaryotic translation
           initiation factor XeIF-4AIII mRNA, complete cds.
          Length = 414

 Score = 58.2 bits (139), Expect = 7e-08
 Identities = 31/66 (46%), Positives = 41/66 (62%)
 Frame = +1

Query: 322 LKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVA 501
           L+ +LLR I   GFE PS +Q + I Q I G DVI Q++SG GKTA F +S LQ ++   
Sbjct: 48  LREDLLRGIYAYGFEKPSAIQQKAIKQIIKGRDVIAQSQSGTGKTATFCVSVLQCLDIQI 107

Query: 502 GQVAAL 519
            +  AL
Sbjct: 108 RETQAL 113



>gb:HUMORFJA_2035323 Homo sapiens KIAA0111 mRNA, partial cds.
          Length = 412

 Score = 58.2 bits (139), Expect = 7e-08
 Identities = 31/66 (46%), Positives = 40/66 (60%)
 Frame = +1

Query: 322 LKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVA 501
           L+ +LLR I   GFE PS +Q   I Q I G DVI Q++SG GKTA F +S LQ ++   
Sbjct: 46  LREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQV 105

Query: 502 GQVAAL 519
            +  AL
Sbjct: 106 RETQAL 111



>gb:AC117081_1207951 Dictyostelium discoideum chromosome 2 map
           5862124-6045772 strain AX4, complete sequence.
          Length = 837

 Score = 58.2 bits (139), Expect = 7e-08
 Identities = 27/59 (45%), Positives = 40/59 (67%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQ 483
           F + LL+ E+L+ + D G++ PS +Q + IP  I G+D+I QAKSG GKT VF +  L+
Sbjct: 45  FSELLLQKEVLKGLEDGGYQRPSPIQLKAIPLGISGVDLIAQAKSGTGKTIVFGVIALE 103



>gb:BX571661_778791 Wolinella succinogenes, complete genome; segment
           5/7.
          Length = 505

 Score = 58.2 bits (139), Expect = 7e-08
 Identities = 29/64 (45%), Positives = 41/64 (64%)
 Frame = +1

Query: 301 SGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTL 480
           +GF  F  K  LLR I ++GF+ PS +Q E IP  + G D+I QA++G GKTA F L  +
Sbjct: 14  AGFEQFGFKENLLRGIHEAGFKVPSPIQVEAIPLVLGGHDLIAQAQTGTGKTAAFGLPII 73

Query: 481 QQIE 492
           Q ++
Sbjct: 74  QNLK 77



>gb:AE017155_392974 Haemophilus ducreyi strain 35000HP section 5 of
           6 of the complete genome.>gb:AE017143_1027236
           Haemophilus ducreyi strain 35000HP complete genome.
          Length = 606

 Score = 58.2 bits (139), Expect = 7e-08
 Identities = 29/63 (46%), Positives = 37/63 (58%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L   +L A+ D  F  PS +Q ECIP  + G DV+  A++G GKTA F L  L Q
Sbjct: 8   FSDLGLPQSILDAVNDMSFVTPSPIQQECIPHLLAGSDVLGMAQTGSGKTAAFSLPLLAQ 67

Query: 487 IEP 495
           I+P
Sbjct: 68  IDP 70



>gb:AE006152_216000 Pasteurella multocida subsp. multocida str. Pm70
           section 119 of 204 of the complete
           genome.>gb:AE004439_1118730 Pasteurella multocida subsp.
           multocida str. Pm70, complete genome.
          Length = 610

 Score = 58.2 bits (139), Expect = 7e-08
 Identities = 30/62 (48%), Positives = 37/62 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L   LL A+ D GFE PS +Q  CIP  + G DV+  A++G GKTA F L  L Q
Sbjct: 8   FNDLGLPEFLLNAVSDLGFETPSPIQQSCIPNLLNGHDVLGMAQTGSGKTAAFSLPLLAQ 67

Query: 487 IE 492
           I+
Sbjct: 68  ID 69



>pir|S45142|S45142 translation initiation factor eIF-4A2 homolog -
           human>gb:HSTIF_2021081 H.sapiens nuk_34 mRNA for
           translation initiation factor.
          Length = 411

 Score = 58.2 bits (139), Expect = 7e-08
 Identities = 31/66 (46%), Positives = 40/66 (60%)
 Frame = +1

Query: 322 LKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVA 501
           L+ +LLR I   GFE PS +Q   I Q I G DVI Q++SG GKTA F +S LQ ++   
Sbjct: 45  LREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQV 104

Query: 502 GQVAAL 519
            +  AL
Sbjct: 105 RETQAL 110



>sp|P38919|DD48_HUMAN Probable ATP-dependent helicase DDX48
           (DEAD-box protein 48) (Eukaryotic initiation factor
           4A-like NUK-34) (Nuclear matrix protein 265) (hNMP 265)
           (Eukaryotic translation initiation factor 4A isoform
           3).>gb:BC003662_1968967 Homo sapiens DEAD
           (Asp-Glu-Ala-Asp) box polypeptide 48, mRNA (cDNA clone
           MGC:764 IMAGE:2988931), complete
           cds.>gb:BC004386_1969229 Homo sapiens DEAD
           (Asp-Glu-Ala-Asp) box polypeptide 48, mRNA (cDNA clone
           MGC:10862 IMAGE:3619386), complete
           cds.>gb:BC011151_1972922 Homo sapiens DEAD
           (Asp-Glu-Ala-Asp) box polypeptide 48, mRNA (cDNA clone
           MGC:17481 IMAGE:3452439), complete
           cds.>gb:CR456750_1992957 Homo sapiens full open reading
           frame cDNA clone RZPDo834C0811D for gene DDX48, DEAD
           (Asp-Glu-Ala-Asp) box polypeptide 48; complete cds,
           incl. stopcodon.
          Length = 411

 Score = 58.2 bits (139), Expect = 7e-08
 Identities = 31/66 (46%), Positives = 40/66 (60%)
 Frame = +1

Query: 322 LKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVA 501
           L+ +LLR I   GFE PS +Q   I Q I G DVI Q++SG GKTA F +S LQ ++   
Sbjct: 45  LREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQV 104

Query: 502 GQVAAL 519
            +  AL
Sbjct: 105 RETQAL 110



>gb:CR457215_1993422 Homo sapiens full open reading frame cDNA clone
           RZPDo834G0312D for gene DDX19, DEAD (Asp-Glu-Ala-As) box
           polypeptide 19; complete cds, incl. stopcodon.
          Length = 479

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 27/65 (41%), Positives = 42/65 (64%), Gaps = 2/65 (3%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILG--MDVICQAKSGMGKTAVFVLSTL 480
           F +  LKP+LL+ +   GF  PS++Q   +P  ++    ++I Q++SG GKTA FVL+ L
Sbjct: 94  FEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLVEPPQNLIAQSQSGTGKTAAFVLAML 153

Query: 481 QQIEP 495
            Q+EP
Sbjct: 154 SQVEP 158



>gb:CR382132_1665044 Yarrowia lipolytica chromosome F of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 397

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 31/62 (50%), Positives = 37/62 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F    LK +LLR I   GFE PS +Q   I Q I G D I QA+SG GKTA F +S L+ 
Sbjct: 26  FESMDLKDDLLRGIYAYGFEAPSAIQSRAITQIIKGRDTIAQAQSGTGKTATFSISMLEV 85

Query: 487 IE 492
           I+
Sbjct: 86  ID 87



>gb:BA000045_742400 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 384

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 28/61 (45%), Positives = 38/61 (62%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L P+L+RA+   GF  P+ +Q   IP A+ G DV+  A +G GKTA F+L  LQQ
Sbjct: 3   FADLQLHPDLVRAVEQLGFTQPTPIQTLAIPPALAGRDVLACAMTGSGKTAAFLLPILQQ 62

Query: 487 I 489
           +
Sbjct: 63  L 63



>gb:AE016920_357853 Chromobacterium violaceum ATCC 12472 section 11
           of 16 of the complete genome.>gb:AE016825_1043007
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 439

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 26/61 (42%), Positives = 41/61 (67%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  + P +LRA+  +G+E+P+ VQ E +P AI G D++  A++G GKTA F+L  L +
Sbjct: 3   FSDLGIAPTILRALQAAGYENPTAVQAEAVPAAIAGRDLLVSAQTGSGKTAAFLLPALTK 62

Query: 487 I 489
           +
Sbjct: 63  L 63



>gb:AE016827_343579 Mannheimia succiniciproducens MBEL55E, complete
           genome.
          Length = 462

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 27/61 (44%), Positives = 38/61 (62%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F DF L PELL+A+   G+  P+ +Q E IP A+   DV+  A +G GKTA F+L  +Q 
Sbjct: 23  FEDFDLSPELLKALAQKGYARPTAIQSEAIPAAMDERDVLGSAPTGTGKTAAFLLPAIQH 82

Query: 487 I 489
           +
Sbjct: 83  L 83



>gb:AE012553_283599 Xylella fastidiosa Temecula1, section 1 of 9 of
           the complete genome.>gb:AE009442_960175 Xylella
           fastidiosa Temecula1, complete genome.
          Length = 446

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 28/70 (40%), Positives = 42/70 (60%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F    L P LLRA+ + G+E P+ +Q + IP A+ G D++  A++G GKTA F L  LQ+
Sbjct: 3   FETLGLLPSLLRALSEQGYEIPTPIQQQAIPLALAGHDLLAAAQTGTGKTAAFGLPVLQR 62

Query: 487 IEPVAGQVAA 516
           +   +  V A
Sbjct: 63  LMAASSNVGA 72



>gb:CR378678_97829 Photobacterium profundum SS9 chromosome 2;
           segment 4/7.
          Length = 474

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 25/61 (40%), Positives = 39/61 (63%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F+D  L P LL+ +   GFE  +E+Q   +P AI+G DV+  +K+G GKT  F+L  +Q+
Sbjct: 30  FKDLGLDPRLLKKLTHLGFERATEIQRTAVPVAIMGKDVLASSKTGSGKTLAFLLPAMQR 89

Query: 487 I 489
           +
Sbjct: 90  M 90



>pir|E82835|E82835 ATP-dependent RNA helicase XF0192 [imported] -
           Xylella fastidiosa (strain 9a5c)>gb:AE003873_47834
           Xylella fastidiosa 9a5c, section 19 of 229 of the
           complete genome.>gb:AE003849_1115044 Xylella fastidiosa
           9a5c, complete genome.
          Length = 446

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 28/70 (40%), Positives = 42/70 (60%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F    L P LLRA+ + G+E P+ +Q + IP A+ G D++  A++G GKTA F L  LQ+
Sbjct: 3   FETLGLLPSLLRALSEQGYEIPTPIQQQAIPLALAGHDLLAAAQTGTGKTAAFGLPVLQR 62

Query: 487 IEPVAGQVAA 516
           +   +  V A
Sbjct: 63  LMAASSNVGA 72



>pir|H90136|H90136 RNA helicase [imported] - Guillardia theta
           nucleomorph>gb:AF083031_1766857 Guillardia theta
           nucleomorph chromosome 3, complete sequence.
          Length = 381

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 27/61 (44%), Positives = 40/61 (65%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F+D  LK +LL  + D G+EHPS +Q + IP AI   D++ ++K+G GKT  F++  LQ 
Sbjct: 17  FKDLKLKNDLLLGLNDLGYEHPSLIQEKIIPLAINNKDILARSKNGTGKTLSFLIPILQN 76

Query: 487 I 489
           I
Sbjct: 77  I 77



>sp|P87206|IF4A_CANAL Eukaryotic initiation factor 4A (eIF4A)
           (eIF-4A).>gb:D84472_1674863 Candida albicans DNA for
           translation initiation factor, complete cds.
          Length = 397

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 29/61 (47%), Positives = 37/61 (60%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  LKP ++R I   G+E PS +Q   I     G DV+ QA+SG GKTA F +S LQ+
Sbjct: 25  FDDLNLKPNIVRGIFGYGYETPSAIQQRAILPITEGRDVLAQAQSGTGKTATFTISALQR 84

Query: 487 I 489
           I
Sbjct: 85  I 85



>sp|Q91VC3|DD48_MOUSE Probable ATP-dependent helicase DDX48
           (DEAD-box protein 48).>gb:BC008132_2090632 Mus musculus
           DEAD (Asp-Glu-Ala-Asp) box polypeptide 48, mRNA (cDNA
           clone MGC:6664 IMAGE:3498954), complete
           cds.>gb:BC012862_2091653 Mus musculus DEAD
           (Asp-Glu-Ala-Asp) box polypeptide 48, mRNA (cDNA clone
           MGC:6715 IMAGE:3585696), complete cds.
          Length = 411

 Score = 57.8 bits (138), Expect = 1e-07
 Identities = 31/66 (46%), Positives = 40/66 (60%)
 Frame = +1

Query: 322 LKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVA 501
           L+ +LLR I   GFE PS +Q   I Q I G DVI Q++SG GKTA F +S LQ ++   
Sbjct: 45  LREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSVSVLQCLDIQV 104

Query: 502 GQVAAL 519
            +  AL
Sbjct: 105 RETQAL 110



>gb:BC061342_2553118 Xenopus tropicalis DEAD (Asp-Glu-Ala-As) box
           polypeptide 19, mRNA (cDNA clone MGC:75870
           IMAGE:5382962), complete cds.
          Length = 487

 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 26/65 (40%), Positives = 41/65 (63%), Gaps = 2/65 (3%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAIL--GMDVICQAKSGMGKTAVFVLSTL 480
           F +  LKPELL+ +   GF  PS++Q   +P  +     ++I Q++SG GKTA FVL+ L
Sbjct: 103 FEELRLKPELLKGVYAMGFNRPSKIQENALPMMLAEPSQNLIAQSQSGTGKTAAFVLAML 162

Query: 481 QQIEP 495
            +++P
Sbjct: 163 SRVDP 167



>gb:BC025594_2095092 Mus musculus DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 19b, mRNA (cDNA clone MGC:36422
           IMAGE:5342859), complete cds.
          Length = 479

 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 27/65 (41%), Positives = 41/65 (63%), Gaps = 2/65 (3%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILG--MDVICQAKSGMGKTAVFVLSTL 480
           F +  LKP+LL+ +   GF  PS++Q   +P  +     ++I Q++SG GKTA FVL+ L
Sbjct: 94  FEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAVL 153

Query: 481 QQIEP 495
            Q+EP
Sbjct: 154 SQVEP 158



>gb:AC006605_1203307 Caenorhabditis elegans cosmid C07H6, complete
           sequence.
          Length = 430

 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 25/71 (35%), Positives = 42/71 (59%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F DF L  +LL  I + G+E PS +Q   I  A+ G D++ +AK+G GKT  + +  +++
Sbjct: 45  FEDFCLGRDLLMGIFEKGWEKPSPIQEASIGVALTGQDILARAKNGTGKTGAYCIPVIEK 104

Query: 487 IEPVAGQVAAL 519
           I+P    + A+
Sbjct: 105 IQPALKAIQAM 115



>gb:AK075920_1171103 Mus musculus ES cells cDNA, RIKEN full-length
           enriched library, clone:2400003O03 product:EUKARYOTIC
           INITIATION FACTOR 4A-LIKE NUK-34 homolog [Homo sapiens],
           full insert sequence.
          Length = 411

 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 31/66 (46%), Positives = 40/66 (60%)
 Frame = +1

Query: 322 LKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQIEPVA 501
           L+ +LLR I   GFE PS +Q   I Q I G DVI Q++SG GKTA F +S LQ ++   
Sbjct: 45  LRGDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSVSVLQCLDIQV 104

Query: 502 GQVAAL 519
            +  AL
Sbjct: 105 RETQAL 110



>gb:AK033235_1163249 Mus musculus 15 days embryo male testis cDNA,
           RIKEN full-length enriched library, clone:8030471P14
           product:ATP-DEPENDENT RNA HELICASE DDX19 (DEAD-BOX
           PROTEIN 19) (DEAD-BOX RNA HELICASE DEAD5) homolog [Homo
           sapiens], full insert sequence.
          Length = 494

 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 27/65 (41%), Positives = 41/65 (63%), Gaps = 2/65 (3%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILG--MDVICQAKSGMGKTAVFVLSTL 480
           F +  LKP+LL+ +   GF  PS++Q   +P  +     ++I Q++SG GKTA FVL+ L
Sbjct: 109 FEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAVL 168

Query: 481 QQIEP 495
            Q+EP
Sbjct: 169 SQVEP 173



>gb:AE016780_331301 Pseudomonas putida KT2440 section 7 of 21 of the
           complete genome.>gb:AE015451_946378 Pseudomonas putida
           KT2440 complete genome.
          Length = 559

 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 27/65 (41%), Positives = 41/65 (63%)
 Frame = +1

Query: 298 SSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLST 477
           + GF    L P ++ A+V +G+E PS +Q + IP  + G D+I QA++G GKTA F L  
Sbjct: 5   TGGFAALDLNPNIVAAVVATGYEEPSAIQQQSIPIILAGHDMIGQAQTGTGKTAAFALPI 64

Query: 478 LQQIE 492
           L +I+
Sbjct: 65  LNKID 69



>gb:CR555306_107960 Azoarcus sp. EbN1 complete genome.
          Length = 491

 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 28/61 (45%), Positives = 40/61 (65%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L PELLRA+ +SG+  P+ +Q + IP  + G DV+  A++G GKTA F L  LQ+
Sbjct: 3   FADLGLIPELLRAVAESGYTTPTPIQQQAIPVVLSGRDVMGGAQTGTGKTAGFTLPLLQR 62

Query: 487 I 489
           +
Sbjct: 63  L 63



>pir|A83292|A83292 probable ATP-dependent RNA helicase PA2840
           [imported] - Pseudomonas aeruginosa (strain
           PAO1)>gb:AE004710_57076 Pseudomonas aeruginosa PAO1,
           section 271 of 529 of the complete
           genome.>gb:AE004091_971176 Pseudomonas aeruginosa PAO1,
           complete genome.
          Length = 567

 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 29/64 (45%), Positives = 40/64 (62%)
 Frame = +1

Query: 304 GFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQ 483
           GF    + P +L AIV  G+E PS +Q + IP  + G D+I QA++G GKTA F L  L 
Sbjct: 18  GFAALGIHPNVLAAIVAVGYEEPSPIQAQSIPLILEGHDMIGQAQTGTGKTAAFALPLLS 77

Query: 484 QIEP 495
           +I+P
Sbjct: 78  RIDP 81



>sp|P41380|IF43_NICPL Eukaryotic initiation factor 4A-3 (eIF4A-3)
           (eIF-4A-3).>pir|S22579|S22579 translation initiation
           factor eIF-4A - curled-leaved
           tobacco>gb:NPNEIF4A3_1691096 N. plumbaginifolia NeIF-4A3
           mRNA for nicotiana eukaryotic translation initiation
           factor 4A.
          Length = 391

 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 28/73 (38%), Positives = 43/73 (58%)
 Frame = +1

Query: 301 SGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTL 480
           + F +  +K +LLR +   GFE PS +Q   +   I G DVI QA+SG GKT++  L+  
Sbjct: 18  ASFAEMGIKDDLLRGVYQYGFEKPSAIQQRAVLPIISGRDVIAQAQSGTGKTSMIALTVC 77

Query: 481 QQIEPVAGQVAAL 519
           Q ++  + +V AL
Sbjct: 78  QIVDTKSSEVQAL 90



>gb:AY751756_2088403 Rattus norvegicus zinc responsive protein Zd10A
           mRNA, complete cds, alternatively spliced.
          Length = 482

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 27/65 (41%), Positives = 41/65 (63%), Gaps = 2/65 (3%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILG--MDVICQAKSGMGKTAVFVLSTL 480
           F +  LKP+LL+ +   GF  PS++Q   +P  +     ++I Q++SG GKTA FVL+ L
Sbjct: 97  FEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAML 156

Query: 481 QQIEP 495
            Q+EP
Sbjct: 157 SQVEP 161



>gb:AE017343_1755881 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 396

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 33/71 (46%), Positives = 39/71 (54%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F    LK +LLR I    FE PS +Q   I   I G DVI QA+SG GKTA F +S LQ 
Sbjct: 25  FEALNLKEDLLRGIYAYNFEKPSAIQQRAIIPIIRGRDVIAQAQSGTGKTATFSISMLQS 84

Query: 487 IEPVAGQVAAL 519
           I+    +  AL
Sbjct: 85  IDTNLRETQAL 95



>gb:CR382136_1668772 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 399

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 32/78 (41%), Positives = 44/78 (56%)
 Frame = +1

Query: 286 VGIHSSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVF 465
           + +H++ F    LK +LL+ I   GFE PS +Q   I Q I G D I QA+SG GKTA F
Sbjct: 22  IKVHAT-FESMNLKTDLLKGIYGYGFEAPSAIQSRAIMQIISGKDTIAQAQSGTGKTATF 80

Query: 466 VLSTLQQIEPVAGQVAAL 519
            +  L+ I+  +    AL
Sbjct: 81  SIGMLEVIDTKSKDCQAL 98



>gb:CR382121_1654516 Kluyveromyces lactis strain NRRL Y-1140
           chromosome A of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 396

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 30/62 (48%), Positives = 36/62 (58%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  LK ELLR I   GF  PS +Q   I   I G DV+ QA+SG GKT  F ++ LQ 
Sbjct: 24  FDDLKLKEELLRGIFGYGFVEPSAIQQRAILPIIEGKDVLAQAQSGTGKTGTFSIAALQN 83

Query: 487 IE 492
           I+
Sbjct: 84  ID 85



>gb:BX294145_769104 Pirellula sp. strain 1 complete genome; segment
           13/24.
          Length = 452

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 28/62 (45%), Positives = 40/62 (64%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F +  L P + RA+ D+GF  PS +Q   IP A+ G DVI QA++G GKTA F +  L+Q
Sbjct: 46  FDELDLSPIMRRAVKDAGFTTPSPIQAALIPHALNGKDVIGQARTGTGKTAAFSIPILEQ 105

Query: 487 IE 492
           ++
Sbjct: 106 LD 107



>gb:BA000012_666141 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 527

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 27/62 (43%), Positives = 41/62 (66%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L P++L A+ D+G+  P+ +Q   IP A+LG D++  A++G GKTA FVL  L +
Sbjct: 14  FSDLGLSPKVLSAVTDAGYTVPTPIQAGAIPHALLGKDILGIAQTGTGKTASFVLPMLTR 73

Query: 487 IE 492
           +E
Sbjct: 74  LE 75



>gb:AE017236_413226 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 10 of 16 of the complete
           genome.>gb:AE016958_1056630 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 566

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 29/74 (39%), Positives = 42/74 (56%)
 Frame = +1

Query: 298 SSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLST 477
           S  F D  + P +LRAI D G+E P+ +Q   IP  + G DV+  A++G GKTA F +  
Sbjct: 12  SPTFADLQIHPSVLRAIADVGYETPTGIQAATIPALMAGSDVVGLAQTGTGKTAAFAIPI 71

Query: 478 LQQIEPVAGQVAAL 519
           L +I+  +    AL
Sbjct: 72  LSKIDAASTATQAL 85



>gb:AE017164_395550 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 4 of 6 of the complete
           genome.>gb:AE017126_1031219 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 603

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 26/64 (40%), Positives = 41/64 (64%)
 Frame = +1

Query: 298 SSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLST 477
           S+GF  F     LL+ + + G+E P+ +Q   IP+ +LG D++ QA++G GKTA F L  
Sbjct: 50  SNGFEGFGFSEALLKTLKNKGYEEPTPIQKASIPELMLGRDLLGQAQTGTGKTAAFALPL 109

Query: 478 LQQI 489
           L++I
Sbjct: 110 LERI 113



>gb:AE016913_355964 Chromobacterium violaceum ATCC 12472 section 4
           of 16 of the complete genome.>gb:AE016825_1041118
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 441

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 25/65 (38%), Positives = 42/65 (64%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F +  L PE+LRAI + G+  P+ +Q + IP  + G D++  A++G GKTA F+L  L++
Sbjct: 3   FSELGLSPEILRAIDEQGYSQPTPIQEKAIPLVLSGRDLLAAAQTGTGKTAAFMLPILER 62

Query: 487 IEPVA 501
           ++  A
Sbjct: 63  LKKFA 67



>pir|T41007|T41007 atp dependent helicase - fission yeast
           (Schizosaccharomyces pombe)>gb:SPCC1494_1720935 S.pombe
           chromosome III cosmid c1494.
          Length = 595

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 28/59 (47%), Positives = 38/59 (64%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQ 483
           F DF L P L RAI    FE P+ VQ E IP A+ G D++ QA++G GKTA +++  L+
Sbjct: 16  FSDFNLDPRLQRAIHKCEFEKPTSVQSETIPLALEGKDLVAQARTGSGKTAAYLIPILE 74



>pir|C97238|C97238 ATP dependent RNA helicase DeaD, superfamily II
           [imported] - Clostridium
           acetobutylicum>gb:AE007772_230055 Clostridium
           acetobutylicum ATCC 824 section 260 of 356 of the
           complete genome.>gb:AE001437_1093010 Clostridium
           acetobutylicum ATCC 824, complete genome.
          Length = 481

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 26/62 (41%), Positives = 40/62 (64%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           FRD  L  E+L++I   G++ PS +Q + IP  + G D+I +AK+G GKTA F +   ++
Sbjct: 6   FRDLGLSEEILKSIEKLGYKKPSSIQEKVIPVILNGKDIIAKAKTGSGKTAAFAIPVCEK 65

Query: 487 IE 492
           IE
Sbjct: 66  IE 67



>pir|A83823|A83823 ATP-dependent RNA helicase BH1385 [imported] -
           Bacillus halodurans (strain C-125)>gb:BA000004_655331
           Bacillus halodurans C-125 DNA, complete genome.
          Length = 438

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 30/74 (40%), Positives = 43/74 (58%)
 Frame = +1

Query: 298 SSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLST 477
           S+ F  F +K  LL A+ D G  HP+E+Q   IP    G DVI Q+++G GKT  F+L  
Sbjct: 3   SANFARFQIKKFLLEALSDKGITHPTEIQERLIPAIRNGKDVIGQSQTGTGKTLAFLLPI 62

Query: 478 LQQIEPVAGQVAAL 519
           + +IE    +V A+
Sbjct: 63  VDRIEGEREEVQAV 76



>sp|Q9UMR2|DD19_HUMAN ATP-dependent RNA helicase DDX19 (DEAD-box
           protein 19) (DEAD-box RNA helicase
           DEAD5).>gb:AX879015_1477641 Sequence 13920 from Patent
           EP1074617.>gb:BC003626_1968937 Homo sapiens DEAD
           (Asp-Glu-Ala-As) box polypeptide 19, mRNA (cDNA clone
           MGC:2430 IMAGE:3030038), complete
           cds.>gb:HSA237946_2000677 Homo sapiens mRNA for DEAD Box
           Protein 5.
          Length = 479

 Score = 57.0 bits (136), Expect = 2e-07
 Identities = 27/65 (41%), Positives = 41/65 (63%), Gaps = 2/65 (3%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILG--MDVICQAKSGMGKTAVFVLSTL 480
           F +  LKP+LL+ +   GF  PS++Q   +P  +     ++I Q++SG GKTA FVL+ L
Sbjct: 94  FEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAML 153

Query: 481 QQIEP 495
            Q+EP
Sbjct: 154 SQVEP 158



>gb:AJ719804_2501991 Gallus gallus mRNA for hypothetical protein,
           clone 6k21.
          Length = 758

 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 26/61 (42%), Positives = 38/61 (62%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F+D  L   LL+AI   GF+ P+ +Q  CIP  +LG D+   A +G GKTA F+L  L++
Sbjct: 182 FQDMNLSRPLLKAITALGFKQPTPIQKACIPVGLLGKDICACAATGTGKTAAFILPVLER 241

Query: 487 I 489
           +
Sbjct: 242 L 242



>gb:BC024730_2094697 Mus musculus DEAD (Asp-Glu-Ala-Asp) box
           polypeptide 27, mRNA (cDNA clone MGC:36661
           IMAGE:5366188), complete cds.
          Length = 292

 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 27/64 (42%), Positives = 38/64 (59%)
 Frame = +1

Query: 298 SSGFRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLST 477
           S  F+D  L   LL+AI   GF+ P+ +Q  CIP  +LG D+   A +G GKTA F L  
Sbjct: 183 SLSFQDMNLSRPLLKAITAMGFKQPTPIQKACIPVGLLGKDICACAATGTGKTAAFALPV 242

Query: 478 LQQI 489
           L+++
Sbjct: 243 LERL 246



>gb:CR380955_1651701 Candida glabrata strain CBS138 chromosome I
           complete sequence.
          Length = 396

 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 30/71 (42%), Positives = 39/71 (54%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           F D  L  +LLR +   GF  PS +Q   I   I G DV+ QA+SG GKT  F ++ LQ+
Sbjct: 25  FDDMNLNEKLLRGVFGYGFNKPSAIQQRAIMPIIEGNDVLAQAQSGTGKTGTFSIAALQR 84

Query: 487 IEPVAGQVAAL 519
           I+P      AL
Sbjct: 85  IDPAIKAPQAL 95



>gb:BX294147_769574 Pirellula sp. strain 1 complete genome; segment
           15/24.
          Length = 931

 Score = 56.6 bits (135), Expect = 2e-07
 Identities = 25/62 (40%), Positives = 41/62 (66%)
 Frame = +1

Query: 307 FRDFLLKPELLRAIVDSGFEHPSEVQHECIPQAILGMDVICQAKSGMGKTAVFVLSTLQQ 486
           FRD  L+ E+ +A+  SG++ P+ +Q E IP  + G DV+ Q+++G GKTA F L  L +
Sbjct: 306 FRDLDLRAEVQKAVAASGYDKPTPIQAEIIPYMLDGRDVLAQSQTGTGKTAAFALPILSR 365

Query: 487 IE 492
           ++
Sbjct: 366 VD 367


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 433,433,024
Number of Sequences: 1806583
Number of extensions: 7216233
Number of successful extensions: 18000
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 17479
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17946
length of database: 581,917,975
effective HSP length: 116
effective length of database: 372,354,347
effective search space used: 21224197779
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)