BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig4964
         (1393 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY087830_1572857 Arabidopsis thaliana clone 38751 mRNA, compl...   119   2e-25   
pir|C86325|C86325 T29M8.5 protein - Arabidopsis thaliana>gb:AE00...   117   7e-25   Arabidopsis thaliana [mouse-ear cress]
gb:AY086993_1572029 Arabidopsis thaliana clone 3024 mRNA, comple...   108   3e-22   
pir|C96779|C96779 unknown protein F9E10.20 [imported] - Arabidop...   107   4e-22   Arabidopsis thaliana [mouse-ear cress]
gb:AP005198_1849323 Oryza sativa (japonica cultivar-group) genom...   103   6e-21   
pir|F96748|F96748 unknown protein T10D10.8 [imported] - Arabidop...   102   1e-20   Arabidopsis thaliana [mouse-ear cress]
gb:AC118134_1739472 Oryza sativa chromosome 3 BAC OSJNBb0041J20 ...    95   4e-18   
gb:AP005424_1851622 Oryza sativa (japonica cultivar-group) genom...    93   1e-17   
gb:AF303458_1784349 Ipomoea nil PnFL-2 mRNA, complete cds.             92   2e-17   
gb:AE005172_890714 Arabidopsis thaliana chromosome 1, top arm co...    84   5e-15   
gb:AY087653_1572682 Arabidopsis thaliana clone 37370 mRNA, compl...    83   1e-14   
gb:AY058863_1564399 Arabidopsis thaliana At1g19180/T29M8_5 mRNA,...    76   1e-12   
gb:AC125472_1740516 Oryza sativa (japonica cultivar-group) chrom...    75   3e-12   
gb:OSJN00080_1694524 Oryza sativa genomic DNA, chromosome 4, BAC...    67   1e-09   
gb:AY051013_1562489 Arabidopsis thaliana unknown protein (At5g20...    65   3e-09   
gb:AE016959_1022378 Oryza sativa (japonica cultivar-group) chrom...    64   1e-08   
gb:AC125472_1740515 Oryza sativa (japonica cultivar-group) chrom...    62   3e-08   
gb:AE016959_1022383 Oryza sativa (japonica cultivar-group) chrom...    58   4e-07   
gb:OSJN00205_1696682 Oryza sativa genomic DNA, chromosome 4, BAC...    52   2e-05   
pir|T47386|T47386 hypothetical protein T18D12.10 - Arabidopsis t...    50   1e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AK117854_1815864 Arabidopsis thaliana At4g14720 mRNA for unkn...    49   3e-04   
pir|A71410|A71410 hypothetical protein - Arabidopsis thaliana>gb...    49   3e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AY056444_1563752 Arabidopsis thaliana AT5g13220/T31B5_40 mRNA...    47   0.001   
gb:AY085082_1570164 Arabidopsis thaliana clone 12707 mRNA, compl...    46   0.002   
gb:AB019230_1514142 Arabidopsis thaliana genomic DNA, chromosome...    46   0.002   
pir|D96731|D96731 hypothetical protein F5A18.12 [imported] - Ara...    46   0.002   Arabidopsis thaliana [mouse-ear cress]
gb:AP003898_1834964 Oryza sativa (japonica cultivar-group) genom...    46   0.002   
gb:AF104397_1768259 Cucumis sativus clone dh27 unknown mRNA.           46   0.002   
gb:AY062515_1565171 Arabidopsis thaliana Unknown protein (At1g70...    45   0.004   
gb:AB111943_1527153 Nicotiana benthamiana NbPPS3 mRNA for hypoth...    45   0.004   
gb:BT010167_1640233 Arabidopsis thaliana At4g14710/dl3395c mRNA,...    44   0.008   
gb:AB111942_1527152 Solanum tuberosum PPS3 mRNA for hypothetical...    44   0.008   
pir|H71409|H71409 hypothetical protein - Arabidopsis thaliana>gb...    44   0.008   Arabidopsis thaliana [mouse-ear cress]
pir|T48569|T48569 hypothetical protein T31B5.40 - Arabidopsis th...    41   0.052   Arabidopsis thaliana [mouse-ear cress]
pir|H96524|H96524 protein T1N15.11 [imported] - Arabidopsis thal...    40   0.15    Arabidopsis thaliana [mouse-ear cress]
gb:BA000039_726132 Thermosynechococcus elongatus BP-1 DNA, compl...    39   0.26    
gb:AP005321_1850598 Oryza sativa (japonica cultivar-group) genom...    39   0.33    
gb:AP005321_1850597 Oryza sativa (japonica cultivar-group) genom...    39   0.33    
gb:AE016959_1022380 Oryza sativa (japonica cultivar-group) chrom...    36   2.2     


>gb:AY087830_1572857 Arabidopsis thaliana clone 38751 mRNA, complete
           sequence.
          Length = 253

 Score =  119 bits (297), Expect = 2e-25
 Identities = 80/221 (36%), Positives = 111/221 (50%), Gaps = 3/221 (1%)
 Frame = +1

Query: 205 KSNFSQTCSLLGQFLKGKGSRRDLGLEIRGKLEAAGKSDMSNAATTIDFLANMEKSSQIP 384
           K +FSQTCS LGQ+LK  GS  DL L +  K +  G    S   TT   L   E S+   
Sbjct: 20  KPSFSQTCSRLGQYLKENGSFGDLSLGMACKPDVNGTLGNSRQPTTTMSLFPCEASNMDS 79

Query: 385 EL-DLNSTDPLTEQDDAMGSVRTI--EENANEASTSKEAPREPKAAPLTIFYSGKIMVFD 555
            + D+  T+    Q     S  ++  E+      T++    E + APLTIFY+G+++VF+
Sbjct: 80  MVQDVKPTNLFPRQPSFSSSSSSLPKEDVLKMTQTTRSVKPESQTAPLTIFYAGQVIVFN 139

Query: 556 DFPADKARAVMLLASKVSPQGVFQTAGAEIQPVAANXXXXXXXXXXXXXXXXXXXXXXXX 735
           DF A+KA+ V+ LASK    G   +       + +N                        
Sbjct: 140 DFSAEKAKEVINLASK----GTANSLAKNQTDIRSNIATIANQVPHPRKTTTQEPIQSSP 195

Query: 736 XXXXDLPIARRSSLHRFLEKRKDRATARAPYQLHNPVAPSA 858
               +LPIARR+SLHRFLEKRKDR T++APYQL +P   S+
Sbjct: 196 TPLTELPIARRASLHRFLEKRKDRVTSKAPYQLCDPAKASS 236



>pir|C86325|C86325 T29M8.5 protein - Arabidopsis
           thaliana>gb:AE005172_890879 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AY039894_1560408 Arabidopsis thaliana
           At1g19180/T29M8_5 mRNA, complete
           cds.>gb:AY065146_1566300 Arabidopsis thaliana unknown
           protein (At1g19180; T29M8.5) mRNA, complete
           cds.>gb:AY081633_1568893 Arabidopsis thaliana unknown
           protein (At1g19180) mRNA, complete
           cds.>gb:AY081738_1568998 Arabidopsis thaliana
           At1g19180/T29M8_5 mRNA, complete cds.>gb:T29M8_1723925
           Sequence of BAC T29M8 from Arabidopsis thaliana
           chromosome 1, complete sequence.>gb:AF332421_1787233
           Arabidopsis thaliana unknown protein (At1g19180) mRNA,
           complete cds.
          Length = 253

 Score =  117 bits (292), Expect = 7e-25
 Identities = 79/222 (35%), Positives = 111/222 (50%), Gaps = 3/222 (1%)
 Frame = +1

Query: 202 EKSNFSQTCSLLGQFLKGKGSRRDLGLEIRGKLEAAGKSDMSNAATTIDFLANMEKSSQI 381
           +K +FSQTCS L Q+LK  GS  DL L +  K +  G    S   TT   L   E S+  
Sbjct: 19  KKPSFSQTCSRLSQYLKENGSFGDLSLGMACKPDVNGTLGNSRQPTTTMSLFPCEASNMD 78

Query: 382 PEL-DLNSTDPLTEQDDAMGSVRTI--EENANEASTSKEAPREPKAAPLTIFYSGKIMVF 552
             + D+  T+    Q     S  ++  E+      T++    E + APLTIFY+G+++VF
Sbjct: 79  SMVQDVKPTNLFPRQPSFSSSSSSLPKEDVLKMTQTTRSVKPESQTAPLTIFYAGQVIVF 138

Query: 553 DDFPADKARAVMLLASKVSPQGVFQTAGAEIQPVAANXXXXXXXXXXXXXXXXXXXXXXX 732
           +DF A+KA+ V+ LASK    G   +       + +N                       
Sbjct: 139 NDFSAEKAKEVINLASK----GTANSLAKNQTDIRSNIATIANQVPHPRKTTTQEPIQSS 194

Query: 733 XXXXXDLPIARRSSLHRFLEKRKDRATARAPYQLHNPVAPSA 858
                +LPIARR+SLHRFLEKRKDR T++APYQL +P   S+
Sbjct: 195 PTPLTELPIARRASLHRFLEKRKDRVTSKAPYQLCDPAKASS 236



>gb:AY086993_1572029 Arabidopsis thaliana clone 3024 mRNA, complete
           sequence.
          Length = 249

 Score =  108 bits (269), Expect = 3e-22
 Identities = 77/225 (34%), Positives = 109/225 (48%), Gaps = 7/225 (3%)
 Frame = +1

Query: 205 KSNFSQTCSLLGQFLKGKGSRRDLGLEIRGKLEAAGKSDMSNAATTIDFLAN-MEKSSQI 381
           K +FSQTC+ L ++LK KGS  DL L +  K +  G S            A+ M+ S+  
Sbjct: 15  KPSFSQTCTRLSRYLKDKGSFGDLSLGMTCKPDVNGGSRQPTMMNLFPCEASGMDSSAGQ 74

Query: 382 PELDLNSTDPLTEQDDAMGSVRTIEENANEASTSKEAPREPKAAPLTIFYSGKIMVFDDF 561
            ++   +  P      +  S  T E+      T+K    E ++APLTIFY G++MVFDDF
Sbjct: 75  EDIKPKTMFPRQSSFSSSSSSGTKEDVQMIKETTKSVKPESQSAPLTIFYGGRVMVFDDF 134

Query: 562 PADKARAVMLLASKVSPQGVFQTAGAEIQPVAANXXXXXXXXXXXXXXXXXXXXXXX--- 732
            A+KA+ V+ LA+K S +  F    AE+    +                           
Sbjct: 135 SAEKAKEVIDLANKGSAKS-FTCFTAEVNNNHSAYSQKEIASSPNPVCSPAKTAAQEPIQ 193

Query: 733 ---XXXXXDLPIARRSSLHRFLEKRKDRATARAPYQLHNPVAPSA 858
                   +LPIARR+SLHRFLEKRKDR T++APYQ+      S+
Sbjct: 194 PKPASLACELPIARRASLHRFLEKRKDRITSKAPYQIDGSAEASS 238



>pir|C96779|C96779 unknown protein F9E10.20 [imported] - Arabidopsis
           thaliana>gb:AE005173_895037 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC013258_1537832 Arabidopsis thaliana
           chromosome 1 BAC F9E10 genomic sequence, complete
           sequence.>gb:BT006301_1639193 Arabidopsis thaliana
           At1g74950 mRNA, complete cds.>gb:F25A4_1678018
           Arabidopsis thaliana chromosome 1 BAC F25A4 sequence,
           complete sequence.>gb:AF344319_1789754 Arabidopsis
           thaliana clone C00218 (f) unknown protein (At1g74950)
           mRNA, complete cds.>gb:AF386959_1794764 Arabidopsis
           thaliana Unknown protein (F9E10.20) mRNA, complete cds.
          Length = 249

 Score =  107 bits (268), Expect = 4e-22
 Identities = 77/225 (34%), Positives = 109/225 (48%), Gaps = 7/225 (3%)
 Frame = +1

Query: 205 KSNFSQTCSLLGQFLKGKGSRRDLGLEIRGKLEAAGKSDMSNAATTIDFLAN-MEKSSQI 381
           K +FSQTC+ L ++LK KGS  DL L +  K +  G S            A+ M+ S+  
Sbjct: 15  KPSFSQTCTRLSRYLKEKGSFGDLSLGMTCKPDVNGGSRQPTMMNLFPCEASGMDSSAGQ 74

Query: 382 PELDLNSTDPLTEQDDAMGSVRTIEENANEASTSKEAPREPKAAPLTIFYSGKIMVFDDF 561
            ++   +  P      +  S  T E+      T+K    E ++APLTIFY G++MVFDDF
Sbjct: 75  EDIKPKTMFPRQSSFSSSSSSGTKEDVQMIKETTKSVKPESQSAPLTIFYGGRVMVFDDF 134

Query: 562 PADKARAVMLLASKVSPQGVFQTAGAEIQPVAANXXXXXXXXXXXXXXXXXXXXXXX--- 732
            A+KA+ V+ LA+K S +  F    AE+    +                           
Sbjct: 135 SAEKAKEVIDLANKGSAKS-FTCFTAEVNNNHSAYSQKEIASSPNPVCSPAKTAAQEPIQ 193

Query: 733 ---XXXXXDLPIARRSSLHRFLEKRKDRATARAPYQLHNPVAPSA 858
                   +LPIARR+SLHRFLEKRKDR T++APYQ+      S+
Sbjct: 194 PNPASLACELPIARRASLHRFLEKRKDRITSKAPYQIDGSAEASS 238



>gb:AP005198_1849323 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0616D06.
          Length = 244

 Score =  103 bits (258), Expect = 6e-21
 Identities = 74/211 (35%), Positives = 105/211 (49%), Gaps = 3/211 (1%)
 Frame = +1

Query: 208 SNFSQTCSLLGQFLKGKGSRR-DLGLEIRGKLEAAGKSDMSNAATTIDFLANMEKSSQIP 384
           ++F+  CSLL ++++  G+   +LGL IRG+    G++  +  AT        E+  +  
Sbjct: 16  TSFAMACSLLSRYVRQNGAAAAELGLGIRGE----GEAPRAAPATMSLLPGEAERKKETM 71

Query: 385 ELDLNSTDPLTEQDDAMGSVRTIEENANEASTSKEAPREPKAAPLTIFYSGKIMVFDDFP 564
           EL   S      Q DA+         A+ A+ ++E  +EP+   LTIFY GK++VF+DFP
Sbjct: 72  ELFPQSAG--FGQQDAI--------TADSAADARE--QEPEKRQLTIFYGGKVLVFNDFP 119

Query: 565 ADKARAVMLLASKVSPQGVFQTAGAEIQPVAANXXX--XXXXXXXXXXXXXXXXXXXXXX 738
           ADKA+ +M LASK SP      A      V  N                           
Sbjct: 120 ADKAKGLMQLASKGSPVAPQNAAAPAPAAVTDNTKAPMAVPAPVSSLPTAQADAQKPARA 179

Query: 739 XXXDLPIARRSSLHRFLEKRKDRATARAPYQ 831
              D+PIAR++SLHRFLEKRKDR  A+ PYQ
Sbjct: 180 NASDMPIARKASLHRFLEKRKDRLNAKTPYQ 210



>pir|F96748|F96748 unknown protein T10D10.8 [imported] - Arabidopsis
           thaliana>gb:AE005173_894792 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC016529_1538161 Arabidopsis thaliana
           chromosome 1 BAC T10D10 genomic sequence, complete
           sequence.>gb:AY059089_1564454 Arabidopsis thaliana
           unknown protein (At1g72450) mRNA, complete
           cds.>gb:AY088035_1573059 Arabidopsis thaliana clone
           40573 mRNA, complete sequence.>gb:AF370147_1792035
           Arabidopsis thaliana unknown protein (At1g72450) mRNA,
           complete cds.
          Length = 269

 Score =  102 bits (255), Expect = 1e-20
 Identities = 76/222 (34%), Positives = 111/222 (50%), Gaps = 6/222 (2%)
 Frame = +1

Query: 190 GRAPEKSNFSQTCSLLGQFLKGKGS--RRDLGLEIRGKLEAAGKSDMSNAATTIDFLANM 363
           G+APEKSNFSQ CSLL ++LK KGS    ++GL  +  LE AGK D+             
Sbjct: 4   GQAPEKSNFSQRCSLLSRYLKEKGSFGNINMGLARKSDLELAGKFDLKG----------- 52

Query: 364 EKSSQIPELDLNSTDPL-TEQDDAMGSVRT-IEENANEASTSKEAPREPKA--APLTIFY 531
            + + I +++ + T P    Q  ++G   T  E+ A     S+ A   P++  + LTIF+
Sbjct: 53  -QQNVIKKVETSETRPFKLIQKFSIGEASTSTEDKAIYIDLSEPAKVAPESGNSQLTIFF 111

Query: 532 SGKIMVFDDFPADKARAVMLLASKVSPQGVFQTAGAEIQPVAANXXXXXXXXXXXXXXXX 711
            GK+MVF++FP DKA+ +M +A + +   V          +  +                
Sbjct: 112 GGKVMVFNEFPEDKAKEIMEVAKEANHVAVDSKNSQSHMNLDKSNVVIPDLNEPTSSGNN 171

Query: 712 XXXXXXXXXXXXDLPIARRSSLHRFLEKRKDRATARAPYQLH 837
                       +  IARR+SLHRF  KRKDRA ARAPYQ++
Sbjct: 172 EDQETGQQHQVVE-RIARRASLHRFFAKRKDRAVARAPYQVN 212



>gb:AC118134_1739472 Oryza sativa chromosome 3 BAC OSJNBb0041J20
           genomic sequence, complete sequence.
          Length = 228

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 75/215 (34%), Positives = 98/215 (45%), Gaps = 7/215 (3%)
 Frame = +1

Query: 208 SNFSQTCSLLGQFLKGKGSRR-DLGLEIRGKLEA-AGKSDMSNAATTIDFLANMEKSSQI 381
           S+F+  CSLL ++++  G+   +LGL IRG+ +A  GK  M                   
Sbjct: 12  SSFAMACSLLSRYVRQNGAAAGELGLGIRGEADANKGKETME------------------ 53

Query: 382 PELDLNSTDPLTEQDDAMGSVRTIEENANEASTSKEAP--REPKAAPLTIFYSGKIMVFD 555
                     L  Q+   GS         EA+  KE P  RE +   LTIFY GK++VFD
Sbjct: 54  ----------LFPQNSGFGS---------EAAAVKETPDAREQEKRQLTIFYGGKVLVFD 94

Query: 556 DFPADKARAVMLLASKVSP--QGVFQTAGAEIQPVAANXXXXXXXXXXXXXXXXXXXXXX 729
           DFPA+KA+ +M +ASK S   Q       +    VA N                      
Sbjct: 95  DFPAEKAKDLMQMASKSSSTAQNCVLLPSSATATVADNTKVSAVPAPASALPVAQANAPK 154

Query: 730 XXX-XXXDLPIARRSSLHRFLEKRKDRATARAPYQ 831
                  DLP AR++SLHRFLEKRKDR  A+APYQ
Sbjct: 155 PVRPNAADLPQARKASLHRFLEKRKDRLQAKAPYQ 189



>gb:AP005424_1851622 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC
           clone:P0556H01.>gb:AP005570_1854215 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, BAC
           clone:OJ1344_B01.
          Length = 232

 Score = 93.2 bits (230), Expect = 1e-17
 Identities = 70/222 (31%), Positives = 102/222 (45%), Gaps = 4/222 (1%)
 Frame = +1

Query: 202 EKSNFSQTCSLLGQFLK----GKGSRRDLGLEIRGKLEAAGKSDMSNAATTIDFLANMEK 369
           ++S+F+ TCSLL QFLK    G G  + LGL +R    A   +    A        N+  
Sbjct: 15  DRSSFAVTCSLLSQFLKEKKGGGGGLQGLGLGLRPAPAAPPAAGAGGAFRPPPTTMNLLS 74

Query: 370 SSQIPELDLNSTDPLTEQDDAMGSVRTIEENANEASTSKEAPREPKAAPLTIFYSGKIMV 549
               P +++      T  D+ +  ++   +  ++ S S+ A    KA  LTIFY GK++V
Sbjct: 75  GLDAPAVEVEPNTAETAADE-LPLIKAPADQQSDESASEAAGE--KAQQLTIFYGGKVVV 131

Query: 550 FDDFPADKARAVMLLASKVSPQGVFQTAGAEIQPVAANXXXXXXXXXXXXXXXXXXXXXX 729
           F++FP+ K + ++ + S  +  GV +  G                               
Sbjct: 132 FENFPSTKVKDLLQIVS--TGDGVDKNTG---------------------TAATQSLPRP 168

Query: 730 XXXXXXDLPIARRSSLHRFLEKRKDRATARAPYQLHNPVAPS 855
                 DLPIARR+SLHRFLEKRK R  A APYQ +   APS
Sbjct: 169 AHNSLPDLPIARRNSLHRFLEKRKGRMNANAPYQANCTAAPS 210



>gb:AF303458_1784349 Ipomoea nil PnFL-2 mRNA, complete cds.
          Length = 206

 Score = 92.4 bits (228), Expect = 2e-17
 Identities = 70/222 (31%), Positives = 104/222 (46%), Gaps = 2/222 (0%)
 Frame = +1

Query: 172 LDGGRAGRAPEKSNFSQTCSLLGQFLKGKGSRRDLGLEIRGKLEAAGKSDMSNAATTIDF 351
           +D GR   + ++SNFS TC+LL Q+LK KGS  DL L                   T++ 
Sbjct: 7   MDSGRF--SGQRSNFSHTCALLSQYLKEKGSFGDLSL----------------GTPTMNL 48

Query: 352 LANMEKSSQIPELD-LNSTDPLTEQDDAMGSVRTIEENANEASTSKEAPREPKAAPLTIF 528
           L   EK +Q  +L  LN      + D ++G                    +P+ AP+TIF
Sbjct: 49  LPTFEKPAQNSDLKPLNLFPTQNKIDSSLGKA------------------DPERAPMTIF 90

Query: 529 YSGKIMVFDDFPADKARAVMLLASKVSPQGVFQTAGAEIQPVAANXXXXXXXXXXXXXXX 708
           Y+G++++F++FP +KA+ ++ +A+      +     A++  V                  
Sbjct: 91  YNGQMIMFNEFPVEKAKELIAMATNTQTPNILPC--ADVNSVVPR-----------PAVS 137

Query: 709 XXXXXXXXXXXXXDLPIARRSSLHRFLEKRKDRATAR-APYQ 831
                        DLPIARRSSL RFLEKRKDR T++ APYQ
Sbjct: 138 KVVPSFGNQRAYSDLPIARRSSLARFLEKRKDRITSKAAPYQ 179



>gb:AE005172_890714 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC007843_1536257 Arabidopsis
           thaliana chromosome I BAC F28G4 genomic sequence,
           complete sequence.>gb:AC022492_1539032 Genomic sequence
           for Arabidopsis thaliana BAC F1L3 from chromosome I,
           complete sequence.>gb:BT000430_1634708 Arabidopsis
           thaliana expressed protein (At1g17380) mRNA, complete
           cds.>gb:BT002543_1636146 Arabidopsis thaliana expressed
           protein (At1g17380) mRNA, complete cds.
          Length = 274

 Score = 84.3 bits (207), Expect = 5e-15
 Identities = 65/228 (28%), Positives = 100/228 (43%), Gaps = 13/228 (5%)
 Frame = +1

Query: 193 RAPEKSNFSQTCSLLGQFLKGKGS----------RRDLGLEIRGKLEAAGKSDMSNAATT 342
           +APEKS+F++ CSLL ++LK KGS          + D  L + GK +  GK +       
Sbjct: 11  QAPEKSDFTRRCSLLSRYLKEKGSFGNIDLGLYRKPDSSLALPGKFDPPGKQNA------ 64

Query: 343 IDFLANMEKSSQIPELDLNSTDPLTEQDDAMGSVRTIEENANEASTSKEAPREPKAAPLT 522
                 M K+        +  +P T     +  V  + E+            +P ++ LT
Sbjct: 65  ------MHKAGH------SKGEPSTSSGGKVKDVADLSES------------QPGSSQLT 100

Query: 523 IFYSGKIMVFDDFPADKARAVMLLASKVSPQ---GVFQTAGAEIQPVAANXXXXXXXXXX 693
           IF+ GK++V+++FP DKA+ +M +A +  P     +      E     ++          
Sbjct: 101 IFFGGKVLVYNEFPVDKAKEIMEVAKQAKPVTEINIQTPINDENNNNKSSMVLPDLNEPT 160

Query: 694 XXXXXXXXXXXXXXXXXXDLPIARRSSLHRFLEKRKDRATARAPYQLH 837
                                IARR+SLHRF  KRKDRA ARAPYQ++
Sbjct: 161 DNNHLTKEQQQQQEQNQIVERIARRASLHRFFAKRKDRAVARAPYQVN 208



>gb:AY087653_1572682 Arabidopsis thaliana clone 37370 mRNA, complete
           sequence.
          Length = 274

 Score = 83.2 bits (204), Expect = 1e-14
 Identities = 65/228 (28%), Positives = 99/228 (43%), Gaps = 13/228 (5%)
 Frame = +1

Query: 193 RAPEKSNFSQTCSLLGQFLKGKGS----------RRDLGLEIRGKLEAAGKSDMSNAATT 342
           +APEKS+F++ CSLL ++LK KGS          + D  L + GK +  GK +       
Sbjct: 11  QAPEKSDFTRRCSLLSRYLKEKGSFGNIDLGLYRKPDSSLALPGKFDPPGKQNA------ 64

Query: 343 IDFLANMEKSSQIPELDLNSTDPLTEQDDAMGSVRTIEENANEASTSKEAPREPKAAPLT 522
                 M K+        +  +P T     +  V  + E+            +P +  LT
Sbjct: 65  ------MHKAGH------SKGEPSTSSGGKVKDVADLSES------------QPGSLQLT 100

Query: 523 IFYSGKIMVFDDFPADKARAVMLLASKVSPQ---GVFQTAGAEIQPVAANXXXXXXXXXX 693
           IF+ GK++V+++FP DKA+ +M +A +  P     +      E     ++          
Sbjct: 101 IFFGGKVLVYNEFPVDKAKEIMEVAKQAKPVTEINIQTPINDENNNNKSSMVLPDLNEPT 160

Query: 694 XXXXXXXXXXXXXXXXXXDLPIARRSSLHRFLEKRKDRATARAPYQLH 837
                                IARR+SLHRF  KRKDRA ARAPYQ++
Sbjct: 161 DNNHPTKEQQQQQEQNQIVERIARRASLHRFFAKRKDRAVARAPYQVN 208



>gb:AY058863_1564399 Arabidopsis thaliana At1g19180/T29M8_5 mRNA,
           partial cds.
          Length = 182

 Score = 76.3 bits (186), Expect = 1e-12
 Identities = 51/137 (37%), Positives = 74/137 (54%), Gaps = 3/137 (2%)
 Frame = +1

Query: 202 EKSNFSQTCSLLGQFLKGKGSRRDLGLEIRGKLEAAGKSDMSNAATTIDFLANMEKSSQI 381
           +K +FSQTCS L Q+LK  GS  DL L +  K +  G    S   TT   L   E S+  
Sbjct: 19  KKPSFSQTCSRLSQYLKENGSFGDLSLGMACKPDVNGTLGNSRQPTTTMSLFPCEASNMD 78

Query: 382 PEL-DLNSTDPLTEQDDAMGSVRTI--EENANEASTSKEAPREPKAAPLTIFYSGKIMVF 552
             + D+  T+    Q     S  ++  E+      T++    E + APLTIFY+G+++VF
Sbjct: 79  SMVQDVKPTNLFPRQPSFSSSSSSLPKEDVLKMTQTTRSVKPESQTAPLTIFYAGQVIVF 138

Query: 553 DDFPADKARAVMLLASK 603
           +DF A+KA+ V+ LASK
Sbjct: 139 NDFSAEKAKEVINLASK 155



>gb:AC125472_1740516 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0050H14, complete
           sequence.>gb:AC126223_1740536 Oryza sativa (japonica
           cultivar-group) chromosome 3 clone OSJNBb0076N15,
           complete sequence.
          Length = 185

 Score = 75.1 bits (183), Expect = 3e-12
 Identities = 47/135 (34%), Positives = 58/135 (42%)
 Frame = +1

Query: 454 EENANEASTSKEAPREPKAAPLTIFYSGKIMVFDDFPADKARAVMLLASKVSPQGVFQTA 633
           EE   E    +  P    AAPLTIFY G+++VF+DFPADKA  VM +AS        Q  
Sbjct: 52  EEERREVGEEEAGPATAPAAPLTIFYGGRMVVFEDFPADKAAEVMRMASSGMAAAPAQRE 111

Query: 634 GAEIQPVAANXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLPIARRSSLHRFLEKRKDRAT 813
           GA +                                  D+PI R++SL RF  KRKDR  
Sbjct: 112 GAAL---------------------------------ADMPIMRKASLQRFFAKRKDRLA 138

Query: 814 ARAPYQLHNPVAPSA 858
           A  PY   +P    A
Sbjct: 139 ATTPYARPSPAETKA 153



>gb:OSJN00080_1694524 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0060D06, complete sequence.
          Length = 216

 Score = 66.6 bits (161), Expect = 1e-09
 Identities = 40/126 (31%), Positives = 53/126 (42%), Gaps = 17/126 (13%)
 Frame = +1

Query: 502 PKAAPLTIFYSGKIMVFDDFPADKARAVMLLASKVSPQGVFQTAGAEI------------ 645
           P  + LTIFY G + V+D  P +KA+A+ML+A+  +       + A I            
Sbjct: 69  PNPSQLTIFYGGSVCVYDSVPPEKAQAIMLIAAAAAAAASATKSNAAIAVKPPVMPAANA 128

Query: 646 -----QPVAANXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLPIARRSSLHRFLEKRKDRA 810
                 PV                               DLPIARR SL RFLEKR+DR 
Sbjct: 129 TQAAVSPVLTRSLSLQSTSVATGQPQVAADPSSICKLQADLPIARRHSLQRFLEKRRDRL 188

Query: 811 TARAPY 828
            ++APY
Sbjct: 189 VSKAPY 194



>gb:AY051013_1562489 Arabidopsis thaliana unknown protein
           (At5g20900) mRNA, complete cds.>gb:AF360184_1791139
           Arabidopsis thaliana unknown protein (At5g20900) mRNA,
           complete cds.
          Length = 187

 Score = 65.5 bits (158), Expect = 3e-09
 Identities = 41/140 (29%), Positives = 62/140 (44%), Gaps = 8/140 (5%)
 Frame = +1

Query: 433 MGSVRTIEENANEASTSKEAPREPKAAP--LTIFYSGKIMVFDDFPADKARAVMLLASKV 606
           +G   ++E++ NE  +++    EP   P  LTIF+ G + VFD  P++K + ++ +A+K 
Sbjct: 28  IGGTGSVEKSINEVRSTEIQTAEPTVPPNQLTIFFGGSVTVFDGLPSEKVQEILRIAAKA 87

Query: 607 SPQGVFQTAGAEIQPVAANXXXXXXXXXXXXXXXXXXXX------XXXXXXXXDLPIARR 768
                       I PV++                                   DLPIARR
Sbjct: 88  MET----KNSTSISPVSSPALNRAPSFSSTSNVASPAAQPFPIQPISFCRSTADLPIARR 143

Query: 769 SSLHRFLEKRKDRATARAPY 828
            SL RFLEKR+DR   + PY
Sbjct: 144 HSLQRFLEKRRDRLVNKNPY 163



>gb:AE016959_1022378 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC091734_1734957
           Genomic Sequence for Oryza sativa, Nipponbare strain,
           clone OSJNBa0068A07, from Chromosome 10, complete
           sequence.>gb:AE017089_1752197 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 43 of 77 of the
           complete sequence.
          Length = 166

 Score = 63.5 bits (153), Expect = 1e-08
 Identities = 49/148 (33%), Positives = 68/148 (45%), Gaps = 1/148 (0%)
 Frame = +1

Query: 409 PLTEQDDAMGSVRTIEENANEASTSKEAPREPKAAPLTIFYSGKIMVFDDFPADKARAVM 588
           PL    D  G  R  E     AS++        AA +TIFY G+++V D+ PAD+A A++
Sbjct: 44  PLMPGADVAGDEREEEGGGAAASSA--------AAQMTIFYGGRVLVLDECPADRAAALL 95

Query: 589 LLASKVSPQGVFQTAGAEIQPVAANXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLPIARR 768
            LA+  S +GV +   A     A                              DLP+AR+
Sbjct: 96  RLAA--SSRGVPRDDLASTAAAAGESA--------------------------DLPVARK 127

Query: 769 SSLHRFLEKRKDRATARA-PYQLHNPVA 849
           +SL RF+EKRK R  AR  PY+ H+  A
Sbjct: 128 ASLQRFMEKRKGRLAARGQPYRRHDAAA 155



>gb:AC125472_1740515 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0050H14, complete
           sequence.>gb:AC126223_1740535 Oryza sativa (japonica
           cultivar-group) chromosome 3 clone OSJNBb0076N15,
           complete sequence.
          Length = 209

 Score = 62.0 bits (149), Expect = 3e-08
 Identities = 57/221 (25%), Positives = 82/221 (37%)
 Frame = +1

Query: 163 QLPLDGGRAGRAPEKSNFSQTCSLLGQFLKGKGSRRDLGLEIRGKLEAAGKSDMSNAATT 342
           QL  +      A   S F+ TC LL Q++K                E +G +        
Sbjct: 8   QLVANAAATTVAGNGSRFAVTCGLLRQYMK----------------EHSGSNGGGGFLPA 51

Query: 343 IDFLANMEKSSQIPELDLNSTDPLTEQDDAMGSVRTIEENANEASTSKEAPREPKAAPLT 522
           +  ++ M   +   E          E  +   ++    + A     ++E     + A LT
Sbjct: 52  VTAMSLMTGGADAEE----------EAPEVRKTMELFPQQAGTLKDTQERKEITEKAQLT 101

Query: 523 IFYSGKIMVFDDFPADKARAVMLLASKVSPQGVFQTAGAEIQPVAANXXXXXXXXXXXXX 702
           IFY G ++VFDDFPA+KA  +M LA          TA A +    A              
Sbjct: 102 IFYGGSVVVFDDFPAEKAGELMKLAGSRD-----STAAAAVSDAGA-------------- 142

Query: 703 XXXXXXXXXXXXXXXDLPIARRSSLHRFLEKRKDRATARAP 825
                          D+PIAR+ SL RFLEKRK+R     P
Sbjct: 143 -------AAGQPCLPDMPIARKVSLQRFLEKRKNRIVVAEP 176



>gb:AE016959_1022383 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC091734_1734962
           Genomic Sequence for Oryza sativa, Nipponbare strain,
           clone OSJNBa0068A07, from Chromosome 10, complete
           sequence.>gb:AE017089_1752202 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 43 of 77 of the
           complete sequence.
          Length = 171

 Score = 58.2 bits (139), Expect = 4e-07
 Identities = 57/190 (30%), Positives = 87/190 (45%), Gaps = 4/190 (2%)
 Frame = +1

Query: 298 LEAAGKSDMSNAATTIDFLANMEKSSQIPELDLNSTDPLTEQDDAMGSVRTIEENANEAS 477
           + AAG S  S  A T   L+   +  Q P+  +   + + E+++   + RT++     A+
Sbjct: 1   MAAAGSS--SRFAVTCGLLSQYMRERQQPQPPVTVLEAVAEEEEEEDA-RTMQLFPPRAA 57

Query: 478 TSKEAPREPKA--APLTIFYSGKIMVFDDFPADKARAVMLLA-SKVSPQGVFQTAGAEIQ 648
            + +    P A  APLTIFY G+++V DD P +KA  +M LA S  SP    Q A A   
Sbjct: 58  AA-DGVATPSAGTAPLTIFYDGRMVVVDDVPVEKAAELMRLAGSACSPP---QPAHAAAL 113

Query: 649 PVAANXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLPIARRSSLHRFLEKRKDRATARA-P 825
           P                                ++PIAR++SL RFL+KRK R T  + P
Sbjct: 114 P--------------------------------EMPIARKASLQRFLQKRKHRITTTSEP 141

Query: 826 YQLHNPVAPS 855
           Y+     +P+
Sbjct: 142 YKKAAVASPA 151



>gb:OSJN00205_1696682 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBb0039F02, complete sequence.
          Length = 188

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 36/117 (30%), Positives = 50/117 (42%)
 Frame = +1

Query: 508 AAPLTIFYSGKIMVFDDFPADKARAVMLLASKVSPQGVFQTAGAEIQPVAANXXXXXXXX 687
           AAP+T+FY+G + VFD    DKA A+M +A++ +         A +   A          
Sbjct: 84  AAPMTLFYNGSVAVFD-VSHDKAEAIMRMATEATKAKGLARGNAIVGNFAKE-------- 134

Query: 688 XXXXXXXXXXXXXXXXXXXXDLPIARRSSLHRFLEKRKDRATARAPYQLHNPVAPSA 858
                                 P+ R  SL RFL KRK+R T+  PYQ+  P A  A
Sbjct: 135 ----------------------PLTRTKSLQRFLSKRKERLTSLGPYQVGGPAAVGA 169



>pir|T47386|T47386 hypothetical protein T18D12.10 - Arabidopsis
           thaliana>gb:ATT18D12_1554767 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T18D12.>gb:BT015154_1642124
           Arabidopsis thaliana At3g43440 gene, complete
           cds.>gb:BT015661_1642279 Arabidopsis thaliana At3g43440
           gene, complete cds.
          Length = 238

 Score = 50.1 bits (118), Expect = 1e-04
 Identities = 42/142 (29%), Positives = 58/142 (40%), Gaps = 1/142 (0%)
 Frame = +1

Query: 391 DLNSTDPLTEQDDAMGSVRTIEENANEASTSKEAPREPKAAP-LTIFYSGKIMVFDDFPA 567
           ++N   P+    D  GSV    +   E S  +    EP A+  LTI + G   VF+  PA
Sbjct: 3   EVNGDFPVPSFADGTGSVSAGLDLLVERSIHEARSTEPDASTQLTIIFGGSCRVFNGVPA 62

Query: 568 DKARAVMLLASKVSPQGVFQTAGAEIQPVAANXXXXXXXXXXXXXXXXXXXXXXXXXXXX 747
            K + ++ +A           AG + + V                               
Sbjct: 63  QKVQEIIRIAF----------AGKQTKNVTG--------------INPALNRALSFSTVA 98

Query: 748 DLPIARRSSLHRFLEKRKDRAT 813
           DLPIARR SL RFLEKR+DR+T
Sbjct: 99  DLPIARRRSLQRFLEKRRDRST 120



 Score = 43.9 bits (102), Expect = 0.008
 Identities = 29/104 (27%), Positives = 38/104 (36%)
 Frame = +1

Query: 517 LTIFYSGKIMVFDDFPADKARAVMLLASKVSPQGVFQTAGAEIQPVAANXXXXXXXXXXX 696
           LTI + G   VFD  PA+K + ++ +A+              I P               
Sbjct: 132 LTIIFGGSFSVFDGIPAEKVQEILHIAAAAKATETINLTS--INPALKRAISFSNASTVA 189

Query: 697 XXXXXXXXXXXXXXXXXDLPIARRSSLHRFLEKRKDRATARAPY 828
                            D+PIARR SL RF EKR+ R     PY
Sbjct: 190 CVSTA------------DVPIARRRSLQRFFEKRRHRFVHTKPY 221



>gb:AK117854_1815864 Arabidopsis thaliana At4g14720 mRNA for unknown
           protein, complete cds, clone: RAFL19-01-L19.
          Length = 315

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 50/190 (26%), Positives = 80/190 (42%), Gaps = 8/190 (4%)
 Frame = +1

Query: 280 LEIRGKLEAAGKSDMSNAATTIDFLANMEKSSQIPELDLNSTDPLTEQDDAMGSVRTIEE 459
           +E R +LEA G+  +       D   +   S +  E   +S   + ++D    S +T+  
Sbjct: 92  IEPRNELEACGRIPLQED----DGACHRRDSPRSAEFSGSSGQFVADKD----SHKTV-- 141

Query: 460 NANEASTSKEAPREPKAA--PLTIFYSGKIMVFDDFPADKARAVMLLASK---VSPQGVF 624
                S S  +P E  A    +TIFYSGK+ V+D  P +KAR++M  A+    +   G+F
Sbjct: 142 -----SVSPRSPAETNAVVGQMTIFYSGKVNVYDGVPPEKARSIMHFAANPIDLPENGIF 196

Query: 625 QTAGAEIQPVAANXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLPIARRSSLHRFLEKRKD 804
            ++    +P++                                   R+ SL R+LEKRKD
Sbjct: 197 ASSRMISKPMSKEKMVELPQYGLEKAPASRDSDVEGQAN-------RKVSLQRYLEKRKD 249

Query: 805 R---ATARAP 825
           R    T +AP
Sbjct: 250 RRFSKTKKAP 259



>pir|A71410|A71410 hypothetical protein - Arabidopsis
           thaliana>gb:ATCHRIV39_1545236 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 39.>gb:ATFCA1_1551522
           Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
           fragment No. 1.
          Length = 365

 Score = 48.5 bits (114), Expect = 3e-04
 Identities = 50/190 (26%), Positives = 80/190 (42%), Gaps = 8/190 (4%)
 Frame = +1

Query: 280 LEIRGKLEAAGKSDMSNAATTIDFLANMEKSSQIPELDLNSTDPLTEQDDAMGSVRTIEE 459
           +E R +LEA G+  +       D   +   S +  E   +S   + ++D    S +T+  
Sbjct: 130 IEPRNELEACGRIPLQED----DGACHRRDSPRSAEFSGSSGQFVADKD----SHKTV-- 179

Query: 460 NANEASTSKEAPREPKAA--PLTIFYSGKIMVFDDFPADKARAVMLLASK---VSPQGVF 624
                S S  +P E  A    +TIFYSGK+ V+D  P +KAR++M  A+    +   G+F
Sbjct: 180 -----SVSPRSPAETNAVVGQMTIFYSGKVNVYDGVPPEKARSIMHFAANPIDLPENGIF 234

Query: 625 QTAGAEIQPVAANXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLPIARRSSLHRFLEKRKD 804
            ++    +P++                                   R+ SL R+LEKRKD
Sbjct: 235 ASSRMISKPMSKEKMVELPQYGLEKAPASRDSDVEGQAN-------RKVSLQRYLEKRKD 287

Query: 805 R---ATARAP 825
           R    T +AP
Sbjct: 288 RRFSKTKKAP 297



>gb:AY056444_1563752 Arabidopsis thaliana AT5g13220/T31B5_40 mRNA,
           complete cds.>gb:AY081715_1568975 Arabidopsis thaliana
           AT5g13220/T31B5_40 mRNA, complete cds.
          Length = 197

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 31/105 (29%), Positives = 48/105 (45%)
 Frame = +1

Query: 514 PLTIFYSGKIMVFDDFPADKARAVMLLASKVSPQGVFQTAGAEIQPVAANXXXXXXXXXX 693
           P+TIFY+G + VF     +KA  +M +A++ + +    +   ++  +             
Sbjct: 104 PMTIFYNGSVSVFQ-VSRNKAGEIMKVANEAASKKDESSMETDLSVILPTTLRPKLFGQN 162

Query: 694 XXXXXXXXXXXXXXXXXXDLPIARRSSLHRFLEKRKDRATARAPY 828
                             DLPIARR SL RFLEKRK+R  + +PY
Sbjct: 163 LEG---------------DLPIARRKSLQRFLEKRKERLVSTSPY 192



>gb:AY085082_1570164 Arabidopsis thaliana clone 12707 mRNA, complete
           sequence.
          Length = 352

 Score = 46.2 bits (108), Expect = 0.002
 Identities = 40/152 (26%), Positives = 56/152 (36%), Gaps = 44/152 (28%)
 Frame = +1

Query: 511 APLTIFYSGKIMVFDDFPADKARAVMLLASKVS--PQ----------------------- 615
           A LTIFY+G + V+DD   +KA+A+MLLA   S  PQ                       
Sbjct: 177 AQLTIFYAGSVCVYDDISPEKAKAIMLLAGNGSSMPQVFSPPQTHQQVVHHTRASVDSSA 236

Query: 616 --GVFQTAGAEIQPVAANXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLPI---------- 759
               F    + + P A +                            + P+          
Sbjct: 237 MPPSFMPTISYLSPEAGSSTNGLGATKATRGLTSTYHNNQANGSNINCPVPVSCSTNVMA 296

Query: 760 -------ARRSSLHRFLEKRKDRATARAPYQL 834
                  AR++SL RFLEKRK+R T+ +PY L
Sbjct: 297 PTVALPLARKASLARFLEKRKERVTSVSPYCL 328



>gb:AB019230_1514142 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MEB5.>gb:BT003044_1636626 Arabidopsis thaliana
           At3g17860/MEB5_8 gene, complete cds.>gb:AF372907_1792622
           Arabidopsis thaliana AT3g17860/MEB5_8 mRNA, complete
           cds.
          Length = 352

 Score = 46.2 bits (108), Expect = 0.002
 Identities = 40/152 (26%), Positives = 56/152 (36%), Gaps = 44/152 (28%)
 Frame = +1

Query: 511 APLTIFYSGKIMVFDDFPADKARAVMLLASKVS--PQ----------------------- 615
           A LTIFY+G + V+DD   +KA+A+MLLA   S  PQ                       
Sbjct: 177 AQLTIFYAGSVCVYDDISPEKAKAIMLLAGNGSSMPQVFSPPQTHQQVVHHTRASVDSSA 236

Query: 616 --GVFQTAGAEIQPVAANXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLPI---------- 759
               F    + + P A +                            + P+          
Sbjct: 237 MPPSFMPTISYLSPEAGSSTNGLGATKATRGLTSTYHNNQANGSNINCPVPVSCSTNVMA 296

Query: 760 -------ARRSSLHRFLEKRKDRATARAPYQL 834
                  AR++SL RFLEKRK+R T+ +PY L
Sbjct: 297 PTVALPLARKASLARFLEKRKERVTSVSPYCL 328



>pir|D96731|D96731 hypothetical protein F5A18.12 [imported] -
           Arabidopsis thaliana>gb:AE005173_894654 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC011663_1537318 Arabidopsis thaliana
           chromosome 1 BAC F5A18 genomic sequence, complete
           sequence.
          Length = 217

 Score = 46.2 bits (108), Expect = 0.002
 Identities = 36/127 (28%), Positives = 48/127 (37%), Gaps = 22/127 (17%)
 Frame = +1

Query: 517 LTIFYSGKIMVFDDFPADKARAVMLLA---------SKVSPQGVFQTAGAEIQPVAANXX 669
           LTIFY G I VF+D   DKA+A+ML A              +   +  G +I   AA   
Sbjct: 69  LTIFYGGTISVFNDISPDKAQAIMLCAGNGLKGETGDSKPVREAERMYGKQIHNTAATSS 128

Query: 670 XXXXXXXXXXXXXXXXXXXXXXXXXXD-------------LPIARRSSLHRFLEKRKDRA 810
                                     +              P AR++SL RFLEKRK+R 
Sbjct: 129 SSATHTDNFSRCRDTPVAATNAMSMIESFNAAPRNMIPSVFPQARKASLARFLEKRKERL 188

Query: 811 TARAPYQ 831
            +  PY+
Sbjct: 189 MSAMPYK 195



>gb:AP003898_1834964 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1663_D06.
          Length = 427

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 22/55 (40%), Positives = 32/55 (58%)
 Frame = +1

Query: 496 REPKAAPLTIFYSGKIMVFDDFPADKARAVMLLASKVSPQGVFQTAGAEIQPVAA 660
           + PK   +TIFY G + VFD+ P +KA+ +MLLAS+ S       A     P++A
Sbjct: 196 QNPKVTQMTIFYDGLVNVFDNIPVEKAQELMLLASRASIPSPPSAARKSDSPISA 250



 Score = 36.2 bits (82), Expect = 1.7
 Identities = 16/26 (61%), Positives = 22/26 (84%)
 Frame = +1

Query: 751 LPIARRSSLHRFLEKRKDRATARAPY 828
           +P AR++SL RFLEKRK+R ++ APY
Sbjct: 342 VPQARKASLARFLEKRKERVSSVAPY 367



>gb:AF104397_1768259 Cucumis sativus clone dh27 unknown mRNA.
          Length = 186

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 29/103 (28%), Positives = 51/103 (49%)
 Frame = +1

Query: 346 DFLANMEKSSQIPELDLNSTDPLTEQDDAMGSVRTIEENANEASTSKEAPREPKAAPLTI 525
           +F  + EK +    LDL        Q+   G+   ++    ++ T+      P+ + +TI
Sbjct: 56  EFFNSPEKMADRKSLDL------FPQEAGFGNSNDVDSRVYKSVTAA-----PQTSQMTI 104

Query: 526 FYSGKIMVFDDFPADKARAVMLLASKVSPQGVFQTAGAEIQPV 654
           FY+G++ VF++ PAD+   VM LAS+ S +    T  A   P+
Sbjct: 105 FYAGQVFVFNNIPADRVGDVMFLASQESSRLNIPTVAARQPPI 147



>gb:AY062515_1565171 Arabidopsis thaliana Unknown protein
           (At1g70700; F5A18.12) mRNA, complete
           cds.>gb:AY081676_1568936 Arabidopsis thaliana unknown
           protein (At1g70700) mRNA, complete cds.
          Length = 267

 Score = 45.1 bits (105), Expect = 0.004
 Identities = 35/126 (27%), Positives = 49/126 (38%), Gaps = 21/126 (16%)
 Frame = +1

Query: 517 LTIFYSGKIMVFDDFPADKARAVMLLA---------SKVSPQGVFQTAGAEIQPVAANXX 669
           LTIFY G I VF++   DKA+A+ML A              +   +  G +I   AA   
Sbjct: 120 LTIFYGGTISVFNNISPDKAQAIMLCAGNGLKGETGDSKPVREAERMYGKQIHNTAATSS 179

Query: 670 XXXXXXXXXXXXXXXXXXXXXXXXXXD------------LPIARRSSLHRFLEKRKDRAT 813
                                     +            +P AR++SL RFLEKRK+R  
Sbjct: 180 SSATHTDNFSRCRDTPVAATNAMSMIESFNAAPRNMIPSVPQARKASLARFLEKRKERLM 239

Query: 814 ARAPYQ 831
           +  PY+
Sbjct: 240 SAMPYK 245



>gb:AB111943_1527153 Nicotiana benthamiana NbPPS3 mRNA for
           hypothetical protein, partial cds.
          Length = 346

 Score = 45.1 bits (105), Expect = 0.004
 Identities = 28/83 (33%), Positives = 45/83 (54%), Gaps = 3/83 (3%)
 Frame = +1

Query: 421 QDDAMGSVRTIEENANEASTS--KEAPREPKA-APLTIFYSGKIMVFDDFPADKARAVML 591
           Q+     +  +  N+    T+  + AP+ P   A LTIFY+G + V+D+   +KA+A+ML
Sbjct: 119 QNPVTSPISAVPTNSCVVGTTDLRGAPKTPSGPAQLTIFYAGSVCVYDNASPEKAQAIML 178

Query: 592 LASKVSPQGVFQTAGAEIQPVAA 660
           LA    P  V  +A + + PV A
Sbjct: 179 LAGNAPP--VTPSATSTLSPVQA 199



 Score = 35.0 bits (79), Expect = 3.7
 Identities = 15/26 (57%), Positives = 21/26 (80%)
 Frame = +1

Query: 751 LPIARRSSLHRFLEKRKDRATARAPY 828
           +P AR++SL RFLEKRK+R  + +PY
Sbjct: 283 VPQARKASLARFLEKRKERVISASPY 308



>gb:BT010167_1640233 Arabidopsis thaliana At4g14710/dl3395c mRNA,
           complete cds.
          Length = 313

 Score = 43.9 bits (102), Expect = 0.008
 Identities = 32/128 (25%), Positives = 56/128 (43%), Gaps = 5/128 (3%)
 Frame = +1

Query: 454 EENANEASTSKEAPREPK--AAPLTIFYSGKIMVFDDFPADKARAVMLLASK---VSPQG 618
           E++ ++ + S  +P E       +TIFYSGK+ V+D  P +KAR++M  A+    +   G
Sbjct: 134 EKDGHKTTISPRSPAETSELVGQMTIFYSGKVNVYDGIPPEKARSIMHFAANPIDLPENG 193

Query: 619 VFQTAGAEIQPVAANXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLPIARRSSLHRFLEKR 798
           +F ++    + ++                                   R+ SL R+ EKR
Sbjct: 194 IFASSRMISKLISKEKMMELPQKGLEKANSSRDSGMEGQAN-------RKVSLQRYREKR 246

Query: 799 KDRATARA 822
           KDR  ++A
Sbjct: 247 KDRKFSKA 254



>gb:AB111942_1527152 Solanum tuberosum PPS3 mRNA for hypothetical
           protein, complete cds.
          Length = 390

 Score = 43.9 bits (102), Expect = 0.008
 Identities = 25/58 (43%), Positives = 34/58 (58%), Gaps = 1/58 (1%)
 Frame = +1

Query: 490 APREPKA-APLTIFYSGKIMVFDDFPADKARAVMLLASKVSPQGVFQTAGAEIQPVAA 660
           AP+ P   A LTIFY G + V+D+   +KA+A+MLLA    P  V   A + + PV A
Sbjct: 189 APKTPPGPAQLTIFYGGSVCVYDNVSPEKAQAIMLLAGNAPP--VAPNATSTLSPVQA 244



 Score = 36.2 bits (82), Expect = 1.7
 Identities = 16/34 (47%), Positives = 25/34 (73%)
 Frame = +1

Query: 751 LPIARRSSLHRFLEKRKDRATARAPYQLHNPVAP 852
           +P AR++SL RFLEKRK+R  + +PY  ++  +P
Sbjct: 328 VPQARKASLARFLEKRKERVISASPYPPNSKQSP 361



>pir|H71409|H71409 hypothetical protein - Arabidopsis
           thaliana>gb:ATCHRIV39_1545235 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 39.>gb:ATFCA1_1551521
           Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
           fragment No. 1.
          Length = 940

 Score = 43.9 bits (102), Expect = 0.008
 Identities = 32/128 (25%), Positives = 56/128 (43%), Gaps = 5/128 (3%)
 Frame = +1

Query: 454 EENANEASTSKEAPREPK--AAPLTIFYSGKIMVFDDFPADKARAVMLLASK---VSPQG 618
           E++ ++ + S  +P E       +TIFYSGK+ V+D  P +KAR++M  A+    +   G
Sbjct: 477 EKDGHKTTISPRSPAETSELVGQMTIFYSGKVNVYDGIPPEKARSIMHFAANPIDLPENG 536

Query: 619 VFQTAGAEIQPVAANXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLPIARRSSLHRFLEKR 798
           +F ++    + ++                                   R+ SL R+ EKR
Sbjct: 537 IFASSRMISKLISKEKMMELPQKGLEKANSSRDSGMEGQAN-------RKVSLQRYREKR 589

Query: 799 KDRATARA 822
           KDR  ++A
Sbjct: 590 KDRKFSKA 597



>pir|T48569|T48569 hypothetical protein T31B5.40 - Arabidopsis
           thaliana>gb:ATT31B5_1555824 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T31B5 (ESSA project).
          Length = 230

 Score = 41.2 bits (95), Expect = 0.052
 Identities = 29/98 (29%), Positives = 44/98 (44%)
 Frame = +1

Query: 514 PLTIFYSGKIMVFDDFPADKARAVMLLASKVSPQGVFQTAGAEIQPVAANXXXXXXXXXX 693
           P+TIFY+G + VF     +KA  +M +A++ + +    +   ++  +             
Sbjct: 104 PMTIFYNGSVSVFQ-VSRNKAGEIMKVANEAASKKDESSMETDLSVILPTTLRPKLFGQN 162

Query: 694 XXXXXXXXXXXXXXXXXXDLPIARRSSLHRFLEKRKDR 807
                             DLPIARR SL RFLEKRK+R
Sbjct: 163 LEG---------------DLPIARRKSLQRFLEKRKER 185



>pir|H96524|H96524 protein T1N15.11 [imported] - Arabidopsis
           thaliana>gb:AE005173_892810 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC020889_1538636 Genomic sequence for
           Arabidopsis thaliana BAC T1N15 from chromosome I,
           complete sequence.
          Length = 256

 Score = 39.7 bits (91), Expect = 0.15
 Identities = 36/143 (25%), Positives = 50/143 (34%), Gaps = 32/143 (22%)
 Frame = +1

Query: 475 STSKEAPREPKAAPLTIFYSGKIMVFDDFPADKARAVMLLA---------SKVSPQGVFQ 627
           S S   P  P+   LTIFY+G ++V+ D   +KA+A+MLLA         S+  PQ +  
Sbjct: 116 SRSSSKPLPPQ---LTIFYAGSVLVYQDIAPEKAQAIMLLAGNGPHAKPVSQPKPQKLVH 172

Query: 628 TAGAEIQPV-----------------------AANXXXXXXXXXXXXXXXXXXXXXXXXX 738
            +     P                                                    
Sbjct: 173 HSLPTTDPPTMPPSFLPSISYIVSETRSSGSNGVTGLGPTKTKASLASTRNNQTAAFSMA 232

Query: 739 XXXDLPIARRSSLHRFLEKRKDR 807
               LP  R++SL RFLEKRK+R
Sbjct: 233 PTVGLPQTRKASLARFLEKRKER 255



>gb:BA000039_726132 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 1054

 Score = 38.9 bits (89), Expect = 0.26
 Identities = 30/108 (27%), Positives = 49/108 (45%), Gaps = 2/108 (1%)
 Frame = +1

Query: 325 SNAATTIDFLANMEKSS--QIPELDLNSTDPLTEQDDAMGSVRTIEENANEASTSKEAPR 498
           ++AA   D   N E  +   +P+ +L+S+D   E+DD  G       + +EA  S   P 
Sbjct: 357 TSAAGISDLFTNEEPDAIELLPQPELSSSDAAEEEDDLFGDFLA---SLDEAPESAAQPL 413

Query: 499 EPKAAPLTIFYSGKIMVFDDFPADKARAVMLLASKVSPQGVFQTAGAE 642
            P+A     F   + +   +FPA +  A+   A    P+G    +GAE
Sbjct: 414 SPQAFDPATFEDEQTIAMSEFPAPE--ALRGPAGSAIPEGEASASGAE 459



>gb:AP005321_1850598 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0650H04.
          Length = 308

 Score = 38.5 bits (88), Expect = 0.33
 Identities = 18/28 (64%), Positives = 22/28 (78%)
 Frame = +1

Query: 751 LPIARRSSLHRFLEKRKDRATARAPYQL 834
           +P AR++SL RFLEKRK+R T  APY L
Sbjct: 226 VPQARKASLARFLEKRKERVTTVAPYPL 253



 Score = 38.5 bits (88), Expect = 0.33
 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 4/55 (7%)
 Frame = +1

Query: 505 KAAPLTIFYSGKIMVFDDFPADKARAVMLLASKVS----PQGVFQTAGAEIQPVA 657
           KAA LTIFY+G + VF++   +KA+ +M LAS+ S    P  V +   A + P A
Sbjct: 82  KAAQLTIFYAGSVNVFNNVSPEKAQELMFLASRGSLPSAPTTVARMPEAHVFPPA 136



>gb:AP005321_1850597 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0650H04.
          Length = 416

 Score = 38.5 bits (88), Expect = 0.33
 Identities = 18/28 (64%), Positives = 22/28 (78%)
 Frame = +1

Query: 751 LPIARRSSLHRFLEKRKDRATARAPYQL 834
           +P AR++SL RFLEKRK+R T  APY L
Sbjct: 334 VPQARKASLARFLEKRKERVTTVAPYPL 361



 Score = 38.5 bits (88), Expect = 0.33
 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 4/55 (7%)
 Frame = +1

Query: 505 KAAPLTIFYSGKIMVFDDFPADKARAVMLLASKVS----PQGVFQTAGAEIQPVA 657
           KAA LTIFY+G + VF++   +KA+ +M LAS+ S    P  V +   A + P A
Sbjct: 190 KAAQLTIFYAGSVNVFNNVSPEKAQELMFLASRGSLPSAPTTVARMPEAHVFPPA 244



>gb:AE016959_1022380 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC091734_1734959
           Genomic Sequence for Oryza sativa, Nipponbare strain,
           clone OSJNBa0068A07, from Chromosome 10, complete
           sequence.>gb:AE017089_1752199 Oryza sativa (japonica
           cultivar-group) chromosome 10, section 43 of 77 of the
           complete sequence.
          Length = 330

 Score = 35.8 bits (81), Expect = 2.2
 Identities = 31/99 (31%), Positives = 44/99 (44%), Gaps = 1/99 (1%)
 Frame = +1

Query: 508 AAPLTIFYSGKIMVFDD-FPADKARAVMLLASKVSPQGVFQTAGAEIQPVAANXXXXXXX 684
           AA L I Y G+++VFDD FPA  A   ++ A+  + Q V + AGA  + V          
Sbjct: 65  AAQLKIMYGGRMLVFDDFFPAGGAVVELVRAAARAGQDV-RRAGAARRRVG--------- 114

Query: 685 XXXXXXXXXXXXXXXXXXXXXDLPIARRSSLHRFLEKRK 801
                                 LP+ R+ SL RF+EKR+
Sbjct: 115 --------------DSRGLDAGLPVVRKVSLQRFVEKRR 139


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,365,468,342
Number of Sequences: 1806583
Number of extensions: 27089675
Number of successful extensions: 62236
Number of sequences better than 10.0: 39
Number of HSP's better than 10.0 without gapping: 59669
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 62205
length of database: 581,917,975
effective HSP length: 128
effective length of database: 350,675,351
effective search space used: 117476242585
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)