BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig4922
         (724 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|H86240|H86240 hypothetical protein [imported] - Arabidopsis ...   149   5e-35   Arabidopsis thaliana [mouse-ear cress]
pir|D86367|D86367 protein F26F24.20 [imported] - Arabidopsis tha...   142   6e-33   Arabidopsis thaliana [mouse-ear cress]
gb:AC137620_1743672 Oryza sativa (japonica cultivar-group) chrom...   107   2e-22   
gb:AC009398_1536763 Genomic sequence for Arabidopsis thaliana BA...    86   9e-16   
gb:AF208229_488476 Staphylococcus xylosus lipase precursor GehM ...    37   0.27    
gb:AY251019_602569 Lactobacillus casei esterase (estI) gene, com...    36   0.61    
gb:AE016752_324053 Staphylococcus epidermidis ATCC 12228, sectio...    36   0.61    
gb:AE016744_321895 Staphylococcus epidermidis ATCC 12228, sectio...    36   0.61    
gb:CP000029_82913 Staphylococcus epidermidis RP62A, complete gen...    36   0.61    
gb:CP000029_80646 Staphylococcus epidermidis RP62A, complete gen...    36   0.61    
gb:CP000029_82963 Staphylococcus epidermidis RP62A, complete gen...    36   0.80    
gb:AF090142_478365 Staphylococcus epidermidis lipase precursor (...    35   1.0     
gb:AE016744_321835 Staphylococcus epidermidis ATCC 12228, sectio...    35   1.0     
gb:AF208033_488462 Staphylococcus warneri lipase precursor (gehA...    35   1.4     
gb:AF096928_478842 Staphylococcus haemolyticus lipase gene, comp...    35   1.4     
gb:BA000030_703133 Streptomyces avermitilis MA-4680 genomic DNA,...    34   2.3     
gb:CP000029_82875 Staphylococcus epidermidis RP62A, complete gen...    34   2.3     
pir|A47705|A47705 triacylglycerol lipase (EC 3.1.1.3) - Staphylo...    34   2.3     Staphylococcus epidermidis
sp|Q02510|LIP_STAEP|LIP_STAEP Lipase precursor (EC 3.1.1.3) (Glycerol este...    34   2.3     Staphylococcus epidermidis
gb:BX571856_782172 Staphylococcus aureus subsp. aureus strain MR...    34   3.0     
gb:BA000033_712882 Staphylococcus aureus subsp. aureus MW2 DNA, ...    33   5.2     
gb:CP000046_92759 Staphylococcus aureus subsp. aureus COL, compl...    33   5.2     
pir|S68970|S68970 triacylglycerol lipase (EC 3.1.1.3) precursor ...    33   5.2     Staphylococcus aureus
sp|Q99QX0|LIP_STAAM|LIP_STAAM Lipase precursor (EC 3.1.1.3) (Glycerol este...    33   5.2     Staphylococcus aureus
gb:BX572603_802791 Rhodopseudomonas palustris CGA009 complete ge...    32   8.8     


>pir|H86240|H86240 hypothetical protein [imported] - Arabidopsis
           thaliana>gb:AE005172_890087 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AY120749_1579631 Arabidopsis thaliana
           putative lipase (At1g10740) mRNA, complete
           cds.>gb:BT006614_1639501 Arabidopsis thaliana At1g10740
           mRNA, complete cds.>gb:T16B5_1723523 Arabidopsis
           thaliana chromosome 1 BAC T16B5 sequence, complete
           sequence.>gb:AF361099_1791311 Arabidopsis thaliana clone
           C00190 (a) putative lipase (At1g10740) mRNA, complete
           cds.
          Length = 473

 Score =  149 bits (376), Expect = 5e-35
 Identities = 78/123 (63%), Positives = 89/123 (72%)
 Frame = +2

Query: 356 WGILSLQLAELFVTSVVHLAYGFYIFSTAVAGDLSLALSDWFFKPNLENGLRAEESNKTT 535
           W + SLQLAELFV+S+VHL YGFYIFS+AVAGD+S  L+D+ FK N+  G   E     T
Sbjct: 5   WMMTSLQLAELFVSSIVHLLYGFYIFSSAVAGDISQTLNDYLFKSNVAFG---ETGQNQT 61

Query: 536 SSKDLSPIVLVHXXXXXXXXXXXXXSYFAGAEKKDERVLVPDLGSLTSVYDRARELFYYL 715
           + + L PIVLVH             SYF GAEKKDERVLVPDLGSLTS+YDRARELFYYL
Sbjct: 62  NVEGLPPIVLVHGIFGFGKGRLGGLSYFGGAEKKDERVLVPDLGSLTSIYDRARELFYYL 121

Query: 716 KGG 724
           KGG
Sbjct: 122 KGG 124



>pir|D86367|D86367 protein F26F24.20 [imported] - Arabidopsis
           thaliana>gb:AE005172_891286 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC005292_1532429 Genomic sequence for
           Arabidopsis thaliana BAC F26F24 from chromosome I,
           complete sequence.
          Length = 471

 Score =  142 bits (358), Expect = 6e-33
 Identities = 76/127 (59%), Positives = 91/127 (71%), Gaps = 1/127 (0%)
 Frame = +2

Query: 347 MIRWGILS-LQLAELFVTSVVHLAYGFYIFSTAVAGDLSLALSDWFFKPNLENGLRAEES 523
           M+ W ++S +Q+ EL V+SVVH+ YG YIFS+AVAGDL+ +LS+  FKP     ++  + 
Sbjct: 1   MVPWLMVSAIQVVELSVSSVVHMFYGLYIFSSAVAGDLTQSLSESIFKPKSTIEVKQIDQ 60

Query: 524 NKTTSSKDLSPIVLVHXXXXXXXXXXXXXSYFAGAEKKDERVLVPDLGSLTSVYDRAREL 703
            KTT   DL PIVLVH             SYFAGAEKKDERVLVPDLGSLTSV+DRAREL
Sbjct: 61  EKTTDVNDLPPIVLVHGIFGFGKGRLGGLSYFAGAEKKDERVLVPDLGSLTSVHDRAREL 120

Query: 704 FYYLKGG 724
           FYYLKGG
Sbjct: 121 FYYLKGG 127



>gb:AC137620_1743672 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0014K18, complete
           sequence.>gb:AC137928_1743831 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone P0040B10, complete
           sequence.
          Length = 471

 Score =  107 bits (268), Expect = 2e-22
 Identities = 66/131 (50%), Positives = 77/131 (58%), Gaps = 13/131 (9%)
 Frame = +2

Query: 371 LQLAELFVTSVVHLAYGFYIFSTAVAGDLSLA-------LSDWFFKPNLENGLRAEESNK 529
           L L EL V++ VHL +G Y+FSTAVA D+S A       L      P L N   A E  +
Sbjct: 6   LSLLELGVSATVHLLFGLYVFSTAVAADISQAAAASGCLLLRRPAAPGLVNVAAAGEEEE 65

Query: 530 TTSSKDL------SPIVLVHXXXXXXXXXXXXXSYFAGAEKKDERVLVPDLGSLTSVYDR 691
              +  +       PIVLVH             SYFAGAEKKD+RVLVPDLGSLTS++DR
Sbjct: 66  RRGAAPVVLDGSPPPIVLVHGIFGFGKGRLGGLSYFAGAEKKDDRVLVPDLGSLTSIHDR 125

Query: 692 ARELFYYLKGG 724
           ARELFYYLKGG
Sbjct: 126 ARELFYYLKGG 136



>gb:AC009398_1536763 Genomic sequence for Arabidopsis thaliana BAC
           F20B24 from chromosome I, complete sequence.
          Length = 404

 Score = 85.5 bits (210), Expect = 9e-16
 Identities = 55/123 (44%), Positives = 69/123 (56%)
 Frame = +2

Query: 356 WGILSLQLAELFVTSVVHLAYGFYIFSTAVAGDLSLALSDWFFKPNLENGLRAEESNKTT 535
           W + SLQLAELFV+S+VHL YGFYIFS+AVAGD+S  L+D+ FK N+  G   E     T
Sbjct: 5   WMMTSLQLAELFVSSIVHLLYGFYIFSSAVAGDISQTLNDYLFKSNVAFG---ETGQNQT 61

Query: 536 SSKDLSPIVLVHXXXXXXXXXXXXXSYFAGAEKKDERVLVPDLGSLTSVYDRARELFYYL 715
           + + L PIVL+                          V +  + +L S   RARELFYYL
Sbjct: 62  NVEGLPPIVLILIY----------------------HVCIVVMITLVS---RARELFYYL 96

Query: 716 KGG 724
           KGG
Sbjct: 97  KGG 99



>gb:AF208229_488476 Staphylococcus xylosus lipase precursor GehM
           (gehM) gene, complete cds.
          Length = 739

 Score = 37.4 bits (85), Expect = 0.27
 Identities = 26/83 (31%), Positives = 39/83 (46%), Gaps = 13/83 (15%)
 Frame = +2

Query: 515 EESNKTTSS---KDLSPIVLVHXXXXXXXXXX-XXXSYFAGAEKKDER---------VLV 655
           E+ NK       K+  PI+LVH              +++ G +K + R            
Sbjct: 350 EQPNKAAKQGQYKNQDPIILVHGFNGFTDDINPAVLAHYWGGDKLNIRQDLESNGYETYE 409

Query: 656 PDLGSLTSVYDRARELFYYLKGG 724
             +G+L+S YDRA EL+YY+KGG
Sbjct: 410 ASVGALSSNYDRAVELYYYIKGG 432



>gb:AY251019_602569 Lactobacillus casei esterase (estI) gene,
           complete cds.
          Length = 599

 Score = 36.2 bits (82), Expect = 0.61
 Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 10/85 (11%)
 Frame = +2

Query: 500 NGLRAEESNKTTSSKDLSPIVLVHXXXXXXXXXXXXXS--YFAGAEKKDERVLVPD---- 661
           N  +  +S      K+  P+V VH             +  Y+ G +   +R L  +    
Sbjct: 201 NSNQNHQSTHQAQFKNQYPVVFVHGFLGFTGDNQFSLAPKYWGGTKYNIDRNLTNEGYNV 260

Query: 662 ----LGSLTSVYDRARELFYYLKGG 724
               +G+ +S YDRA EL+YY+KGG
Sbjct: 261 HEANIGAFSSNYDRAVELYYYVKGG 285



>gb:AE016752_324053 Staphylococcus epidermidis ATCC 12228, section 9
           of 9 of the complete genome.>gb:AE015929_1148722
           Staphylococcus epidermidis ATCC 12228, complete genome.
          Length = 681

 Score = 36.2 bits (82), Expect = 0.61
 Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 10/85 (11%)
 Frame = +2

Query: 500 NGLRAEESNKTTSSKDLSPIVLVHXXXXXXXXXXXXXS--YFAGAEKKDERVLVPD---- 661
           N  +  +S      K+  P+V VH             +  Y+ G +   +R L  +    
Sbjct: 283 NANQNHQSTHQAQFKNQYPVVFVHGFLGFAGDNQFSLAPKYWGGTKYNIDRNLTNEGYNV 342

Query: 662 ----LGSLTSVYDRARELFYYLKGG 724
               +G+ +S YDRA EL+YY+KGG
Sbjct: 343 HEANIGAFSSNYDRAVELYYYVKGG 367



>gb:AE016744_321895 Staphylococcus epidermidis ATCC 12228, section 1
           of 9 of the complete genome.>gb:AE015929_1146564
           Staphylococcus epidermidis ATCC 12228, complete genome.
          Length = 728

 Score = 36.2 bits (82), Expect = 0.61
 Identities = 27/84 (32%), Positives = 39/84 (46%), Gaps = 14/84 (16%)
 Frame = +2

Query: 515 EESNKTTSSKDLS---PIVLVHXXXXXXXXX---XXXXSYFAGAEKK---DER-----VL 652
           +++NK  S K+     PI+LVH                +Y+ G   K   D R     V+
Sbjct: 336 DQTNKVASQKEYKNHDPIILVHGFNGYASGTGPVTGKGNYWGGNRLKIIQDYRAKGYNVM 395

Query: 653 VPDLGSLTSVYDRARELFYYLKGG 724
              + +  S YDRA EL+YY+KGG
Sbjct: 396 EASVSAFGSNYDRAVELYYYIKGG 419



>gb:CP000029_82913 Staphylococcus epidermidis RP62A, complete
           genome.
          Length = 728

 Score = 36.2 bits (82), Expect = 0.61
 Identities = 27/84 (32%), Positives = 39/84 (46%), Gaps = 14/84 (16%)
 Frame = +2

Query: 515 EESNKTTSSKDLS---PIVLVHXXXXXXXXX---XXXXSYFAGAEKK---DER-----VL 652
           +++NK  S K+     PI+LVH                +Y+ G   K   D R     V+
Sbjct: 336 DQTNKVASQKEYKNHDPIILVHGFNGYASGTGPVTGKGNYWGGDRLKIIQDYRAKGYNVM 395

Query: 653 VPDLGSLTSVYDRARELFYYLKGG 724
              + +  S YDRA EL+YY+KGG
Sbjct: 396 EASVSAFGSNYDRAVELYYYIKGG 419



>gb:CP000029_80646 Staphylococcus epidermidis RP62A, complete
           genome.
          Length = 681

 Score = 36.2 bits (82), Expect = 0.61
 Identities = 24/85 (28%), Positives = 38/85 (44%), Gaps = 10/85 (11%)
 Frame = +2

Query: 500 NGLRAEESNKTTSSKDLSPIVLVHXXXXXXXXXXXXXS--YFAGAEKKDERVLVPD---- 661
           N  +  +S      K+  P+V VH             +  Y+ G +   +R L  +    
Sbjct: 283 NANQNHQSTHQAQFKNQYPVVFVHGFLGFAGDNQFSLAPKYWGGTKYNIDRNLTNEGYNV 342

Query: 662 ----LGSLTSVYDRARELFYYLKGG 724
               +G+ +S YDRA EL+YY+KGG
Sbjct: 343 HEANIGAFSSNYDRAVELYYYVKGG 367



>gb:CP000029_82963 Staphylococcus epidermidis RP62A, complete
           genome.
          Length = 643

 Score = 35.8 bits (81), Expect = 0.80
 Identities = 26/92 (28%), Positives = 42/92 (45%), Gaps = 13/92 (14%)
 Frame = +2

Query: 488 PNLENGLRAEESNKTTSS---KDLSPIVLVHXXXXXXXXXXXXX--SYFAGAE------- 631
           P +    + +  N+ T+    K+  P+V VH               +Y+ G +       
Sbjct: 238 PRVVKSKQTKHINQLTAQAQYKNQYPVVFVHGFVGLVGEDAFSMYPNYWGGTKYNVKQEL 297

Query: 632 -KKDERVLVPDLGSLTSVYDRARELFYYLKGG 724
            K   RV   ++G+ +S YDRA EL+YY+KGG
Sbjct: 298 TKLGYRVHEANVGAFSSNYDRAVELYYYIKGG 329



>gb:AF090142_478365 Staphylococcus epidermidis lipase precursor
           (gehD) gene, complete cds.
          Length = 643

 Score = 35.4 bits (80), Expect = 1.0
 Identities = 26/92 (28%), Positives = 42/92 (45%), Gaps = 13/92 (14%)
 Frame = +2

Query: 488 PNLENGLRAEESNKTTSS---KDLSPIVLVHXXXXXXXXXXXXX--SYFAGAE------- 631
           P +    + +  N+ T+    K+  P+V VH               +Y+ G +       
Sbjct: 238 PRVVKSKQTKHINQLTAQAQYKNQYPVVFVHGFVGLVGEDAFSMYPNYWGGIKYNVKKEL 297

Query: 632 -KKDERVLVPDLGSLTSVYDRARELFYYLKGG 724
            K   RV   ++G+ +S YDRA EL+YY+KGG
Sbjct: 298 TKLGYRVHEANVGAFSSNYDRAVELYYYIKGG 329



>gb:AE016744_321835 Staphylococcus epidermidis ATCC 12228, section 1
           of 9 of the complete genome.>gb:AE015929_1146504
           Staphylococcus epidermidis ATCC 12228, complete genome.
          Length = 643

 Score = 35.4 bits (80), Expect = 1.0
 Identities = 26/92 (28%), Positives = 42/92 (45%), Gaps = 13/92 (14%)
 Frame = +2

Query: 488 PNLENGLRAEESNKTTSS---KDLSPIVLVHXXXXXXXXXXXXX--SYFAGAE------- 631
           P +    + +  N+ T+    K+  P+V VH               +Y+ G +       
Sbjct: 238 PRVVKSKQTKHINQLTAHAQYKNQYPVVFVHGFVGLVGEDSFSMYPNYWGGTKYNVKQEL 297

Query: 632 -KKDERVLVPDLGSLTSVYDRARELFYYLKGG 724
            K   RV   ++G+ +S YDRA EL+YY+KGG
Sbjct: 298 TKLGYRVHEANVGAFSSNYDRAVELYYYIKGG 329



>gb:AF208033_488462 Staphylococcus warneri lipase precursor (gehA)
           gene, complete cds.
          Length = 732

 Score = 35.0 bits (79), Expect = 1.4
 Identities = 26/84 (30%), Positives = 37/84 (44%), Gaps = 14/84 (16%)
 Frame = +2

Query: 515 EESNKTTSS---KDLSPIVLVHXXXXXXXXXX---XXXSYFAG--------AEKKDERVL 652
           +++NK       K+  PI+LVH                +Y+ G        A  K   V 
Sbjct: 342 DQTNKVAPQQQYKNHDPIILVHGFNGFTADNGPGLGDSNYWGGERLNITQEARAKGYNVS 401

Query: 653 VPDLGSLTSVYDRARELFYYLKGG 724
              + +L S YDRA EL+YY+KGG
Sbjct: 402 EASVSALGSNYDRAVELYYYIKGG 425



>gb:AF096928_478842 Staphylococcus haemolyticus lipase gene,
           complete cds.
          Length = 711

 Score = 35.0 bits (79), Expect = 1.4
 Identities = 25/80 (31%), Positives = 37/80 (46%), Gaps = 10/80 (12%)
 Frame = +2

Query: 515 EESNKTTSSKDLSPIVLVHXXXXXXXXXXXXX--SYFAGA--------EKKDERVLVPDL 664
           E + K+   K+  P+VLVH               +Y+ G         EK    V    +
Sbjct: 319 EATIKSNQYKNKYPVVLVHGFLGLVGDNAPALYPNYWGGTKFPVKKRLEKLGYDVHEASV 378

Query: 665 GSLTSVYDRARELFYYLKGG 724
           G+ +S YDRA EL++Y+KGG
Sbjct: 379 GAFSSNYDRAVELYHYIKGG 398



>gb:BA000030_703133 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 530

 Score = 34.3 bits (77), Expect = 2.3
 Identities = 13/42 (30%), Positives = 19/42 (45%)
 Frame = -3

Query: 695 EPYHKH*SMTPNQAQEPFHPSSLPQQNKTGHLISLYQNQRFH 570
           +PY  +  + P  A +PF+P   P    T H   LY    +H
Sbjct: 142 DPYDPYDPLNPQHAPDPFNPQPTPDPYDTHHTSDLYDTHEYH 183



>gb:CP000029_82875 Staphylococcus epidermidis RP62A, complete
           genome.>gb:AF053006_473607 Staphylococcus epidermidis
           lipase precursor (geh1) gene, complete cds.
          Length = 688

 Score = 34.3 bits (77), Expect = 2.3
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 10/86 (11%)
 Frame = +2

Query: 497 ENGLRAEESNKTTSSKDLSPIVLVHXXXXXXXXXX-XXXSYFAGAEKKDERVLVPDLG-- 667
           +N  +  +S K    K+  PI+LVH              +++ G +K + R  + + G  
Sbjct: 293 KNEDQTNKSAKQKQYKNNDPIILVHGFNGFTDDINPSVLTHYWGGDKMNIRQDLEENGYE 352

Query: 668 -------SLTSVYDRARELFYYLKGG 724
                  +  S YDRA EL+YY+KGG
Sbjct: 353 AYEASISAFGSNYDRAVELYYYIKGG 378



>pir|A47705|A47705 triacylglycerol lipase (EC 3.1.1.3) -
           Staphylococcus epidermidis>gb:STAGEHC_192128
           Staphylococcus epidermidis lipase (gehC) gene, complete
           cds.
          Length = 688

 Score = 34.3 bits (77), Expect = 2.3
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 10/86 (11%)
 Frame = +2

Query: 497 ENGLRAEESNKTTSSKDLSPIVLVHXXXXXXXXXX-XXXSYFAGAEKKDERVLVPDLG-- 667
           +N  +  +S K    K+  PI+LVH              +++ G +K + R  + + G  
Sbjct: 293 KNEDQTNKSAKQKQYKNNDPIILVHGFNGFTDDINPSVLTHYWGGDKMNIRQDLEENGYE 352

Query: 668 -------SLTSVYDRARELFYYLKGG 724
                  +  S YDRA EL+YY+KGG
Sbjct: 353 AYEASISAFGSNYDRAVELYYYIKGG 378



>sp|Q02510|LIP_STAEP Lipase precursor (EC 3.1.1.3) (Glycerol ester
           hydrolase).>gb:AE016744_321931 Staphylococcus
           epidermidis ATCC 12228, section 1 of 9 of the complete
           genome.>gb:AE015929_1146600 Staphylococcus epidermidis
           ATCC 12228, complete genome.
          Length = 688

 Score = 34.3 bits (77), Expect = 2.3
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 10/86 (11%)
 Frame = +2

Query: 497 ENGLRAEESNKTTSSKDLSPIVLVHXXXXXXXXXX-XXXSYFAGAEKKDERVLVPDLG-- 667
           +N  +  +S K    K+  PI+LVH              +++ G +K + R  + + G  
Sbjct: 293 KNEDQTNKSAKQKQYKNNDPIILVHGFNGFTDDINPSVLTHYWGGDKMNIRQDLEENGYE 352

Query: 668 -------SLTSVYDRARELFYYLKGG 724
                  +  S YDRA EL+YY+KGG
Sbjct: 353 AYEASISAFGSNYDRAVELYYYIKGG 378



>gb:BX571856_782172 Staphylococcus aureus subsp. aureus strain
           MRSA252, complete genome.
          Length = 681

 Score = 33.9 bits (76), Expect = 3.0
 Identities = 24/85 (28%), Positives = 36/85 (42%), Gaps = 13/85 (15%)
 Frame = +2

Query: 509 RAEESNKTTSS---KDLSPIVLVHXXXXXXXXX--XXXXSYFAG--------AEKKDERV 649
           + +++NK       K+  PIVLVH                Y+ G         E+   + 
Sbjct: 285 KGDQTNKVAKQGQYKNQDPIVLVHGFNGFTDDINPSVLAHYWGGNKMNIRQDLEENGYKA 344

Query: 650 LVPDLGSLTSVYDRARELFYYLKGG 724
               + +  S YDRA EL+YY+KGG
Sbjct: 345 YEASISAFGSNYDRAVELYYYIKGG 369



>gb:BA000033_712882 Staphylococcus aureus subsp. aureus MW2 DNA,
           complete genome, strain:MW2.>gb:BX571857_784793
           Staphylococcus aureus strain MSSA476, complete genome.
          Length = 681

 Score = 33.1 bits (74), Expect = 5.2
 Identities = 24/83 (28%), Positives = 35/83 (42%), Gaps = 13/83 (15%)
 Frame = +2

Query: 515 EESNKTTSS---KDLSPIVLVHXXXXXXXXX--XXXXSYFAG--------AEKKDERVLV 655
           +++NK       K+  PIVLVH                Y+ G         E+   +   
Sbjct: 287 DQTNKVAKQGQYKNQDPIVLVHGFNGFTDDINPSVLAHYWGGNKMNIRQDLEENGYKAYE 346

Query: 656 PDLGSLTSVYDRARELFYYLKGG 724
             + +  S YDRA EL+YY+KGG
Sbjct: 347 ASISAFGSNYDRAVELYYYIKGG 369



>gb:CP000046_92759 Staphylococcus aureus subsp. aureus COL, complete
           genome.
          Length = 680

 Score = 33.1 bits (74), Expect = 5.2
 Identities = 24/83 (28%), Positives = 35/83 (42%), Gaps = 13/83 (15%)
 Frame = +2

Query: 515 EESNKTTSS---KDLSPIVLVHXXXXXXXXX--XXXXSYFAG--------AEKKDERVLV 655
           +++NK       K+  PIVLVH                Y+ G         E+   +   
Sbjct: 286 DQTNKVAKQGQYKNQDPIVLVHGFNGFTDDINPSVLAHYWGGNKMNIRQDLEENGYKAYE 345

Query: 656 PDLGSLTSVYDRARELFYYLKGG 724
             + +  S YDRA EL+YY+KGG
Sbjct: 346 ASISAFGSNYDRAVELYYYIKGG 368



>pir|S68970|S68970 triacylglycerol lipase (EC 3.1.1.3) precursor -
           Staphylococcus aureus>gb:STAGEHLIP_192129 Staphylococcus
           aureus glycerol ester hydrolase (lip) gene, complete
           cds.
          Length = 682

 Score = 33.1 bits (74), Expect = 5.2
 Identities = 24/83 (28%), Positives = 35/83 (42%), Gaps = 13/83 (15%)
 Frame = +2

Query: 515 EESNKTTSS---KDLSPIVLVHXXXXXXXXX--XXXXSYFAG--------AEKKDERVLV 655
           +++NK       K+  PIVLVH                Y+ G         E+   +   
Sbjct: 287 DQTNKVAKQGQYKNQDPIVLVHGFNGFTDDINPSVLAHYWGGNKMNIRQDLEENGYKAYE 346

Query: 656 PDLGSLTSVYDRARELFYYLKGG 724
             + +  S YDRA EL+YY+KGG
Sbjct: 347 ASISAFGSNYDRAVELYYYIKGG 369



>sp|Q99QX0|LIP_STAAM Lipase precursor (EC 3.1.1.3) (Glycerol ester
           hydrolase).>pir|G90075|G90075 triacylglycerol lipase
           precursor [imported] - Staphylococcus aureus (strain
           N315)>gb:BA000017_678356 Staphylococcus aureus subsp.
           aureus Mu50 DNA, complete genome.>gb:BA000018_680950
           Staphylococcus aureus subsp. aureus N315 genomic DNA,
           complete genome.
          Length = 681

 Score = 33.1 bits (74), Expect = 5.2
 Identities = 24/83 (28%), Positives = 35/83 (42%), Gaps = 13/83 (15%)
 Frame = +2

Query: 515 EESNKTTSS---KDLSPIVLVHXXXXXXXXX--XXXXSYFAG--------AEKKDERVLV 655
           +++NK       K+  PIVLVH                Y+ G         E+   +   
Sbjct: 287 DQTNKVAKQGQYKNQDPIVLVHGFNGFTDDINPSVLAHYWGGNKMNIRQDLEENGYKAYE 346

Query: 656 PDLGSLTSVYDRARELFYYLKGG 724
             + +  S YDRA EL+YY+KGG
Sbjct: 347 ASISAFGSNYDRAVELYYYIKGG 369



>gb:BX572603_802791 Rhodopseudomonas palustris CGA009 complete
           genome; segment 11/16.
          Length = 132

 Score = 32.3 bits (72), Expect = 8.8
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 2/63 (3%)
 Frame = +2

Query: 299 KAFWDNKQIY--LWDFMKMIRWGILSLQLAELFVTSVVHLAYGFYIFSTAVAGDLSLALS 472
           +A W +  +Y  L+       + + SL L + +  SVV +   +  F TAV+G L L L+
Sbjct: 67  QATWQSSLVYGALFGVFCYATFELTSLALLKHWTWSVVAVDISWGAFVTAVSGTLGLLLA 126

Query: 473 DWF 481
           DW+
Sbjct: 127 DWW 129


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 756,393,528
Number of Sequences: 1806583
Number of extensions: 15218314
Number of successful extensions: 34640
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 33748
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 34623
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 43235250408
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)