BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig4858
         (748 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T00407|T00407 60S ribosomal protein L30 [imported] - Arabido...   243   2e-63   Arabidopsis thaliana [mouse-ear cress]
gb:AP004346_1840584 Oryza sativa (japonica cultivar-group) genom...   233   2e-60   
gb:AP002970_1824039 Oryza sativa (japonica cultivar-group) genom...   229   3e-59   
gb:AE017343_1755542 Cryptococcus neoformans var. neoformans JEC2...   183   3e-45   
gb:AC117075_1207751 Dictyostelium discoideum chromosome 2 map 52...   182   6e-45   
gb:BC062237_2104961 Rattus norvegicus cDNA clone MGC:72943 IMAGE...   175   9e-43   
gb:BC003885_2089428 Mus musculus cDNA sequence BC003885, mRNA (c...   175   9e-43   
gb:BC016312_1975532 Homo sapiens chromosome 15 open reading fram...   174   2e-42   
gb:AF212226_1150577 Homo sapiens RPL24 mRNA, complete cds.>gb:AF...   173   3e-42   
gb:BC005344_1969790 Homo sapiens chromosome 15 open reading fram...   172   6e-42   
gb:AX970445_1485754 Sequence 1248 from Patent EP1104808.              172   6e-42   
gb:CR857358_1181601 Pongo pygmaeus mRNA; cDNA DKFZp469K1632 (fro...   172   6e-42   
gb:BC008499_1971422 Homo sapiens chromosome 15 open reading fram...   171   1e-41   
gb:BC042273_2548093 Xenopus laevis similar to chromosome 15 open...   171   2e-41   
gb:BC014576_1974700 Homo sapiens chromosome 15 open reading fram...   171   2e-41   
gb:BC028672_1979304 Homo sapiens chromosome 15 open reading fram...   170   2e-41   
gb:BC073497_2557333 Xenopus laevis MGC81028 protein, mRNA (cDNA ...   170   3e-41   
gb:BC051780_2550447 Danio rerio zgc:56202, mRNA (cDNA clone MGC:...   167   1e-40   
gb:AY292613_1316669 Oikopleura dioica 60S ribosomal protein L24 ...   164   1e-39   
gb:CR382128_1660734 Yarrowia lipolytica chromosome B of strain C...   162   6e-39   
pir|S64831|S64831 ribosomal protein L24 homolog YLR009w - yeast ...   158   9e-38   Saccharomyces cerevisiae [brewer's yeast]
gb:CR380956_1652027 Candida glabrata strain CBS138 chromosome J ...   157   2e-37   
sp|Q10353|RL24_SCHPO|RL24_SCHPO 60S ribosomal protein L24 (L30).>pir|T38170...   155   6e-37   Schizosaccharomyces pombe
gb:AE016817_1747730 Ashbya gossypii (= Eremothecium gossypii) AT...   154   2e-36   
gb:PFA929351_1392964 Plasmodium falciparum strain 3D7, chromosom...   154   2e-36   
gb:CR382125_1657639 Kluyveromyces lactis strain NRRL Y-1140 chro...   152   5e-36   
gb:CR382139_1672987 Debaryomyces hansenii chromosome G of strain...   151   1e-35   
gb:AX887989_1483442 Sequence 3852 from Patent EP1033401.              150   2e-35   
gb:AE014297_1138997 Drosophila melanogaster chromosome 3R, compl...   148   9e-35   
sp|Q17606|RL24_CAEEL|RL24_CAEEL 60S ribosomal protein L24.>pir|T18884|T1888...   144   2e-33   Caenorhabditis elegans [roundworm]
gb:CNS07EG9_1372835 chromosome II of strain GB-M1 of Encephalito...   129   7e-29   
gb:OSA417524_1692532 Oryza sativa partial mRNA for putative ribo...   107   2e-22   
gb:AF266175_2483228 Gillichthys mirabilis 60S ribosomal protein ...    88   1e-16   
gb:BC059530_2552507 Danio rerio ribosomal protein L24, mRNA (cDN...    87   4e-16   
gb:AY099532_2512368 Danio rerio 60S ribosomal protein L24 (rpl24...    87   4e-16   
gb:AY190673_2517992 Pagrus major 60S ribosomal protein L24 mRNA,...    86   5e-16   
gb:AF298827_1784194 Prunus avium 60S ribosomal protein L24 (RL24...    86   5e-16   
sp|P38666|RL24_ARATH|RL24_ARATH 60S ribosomal protein L24.>pir|T47559|T4755...    86   5e-16   Arabidopsis thaliana [mouse-ear cress]
gb:BC002110_2088875 Mus musculus ribosomal protein L24, mRNA (cD...    86   7e-16   
gb:AB099007_1410330 Bos taurus mRNA for similar to ribosomal pro...    86   7e-16   
sp|Q862I1|RL24_BOVIN|RL24_BOVIN 60S ribosomal protein L24 (L30).>sp|P83731|...    86   7e-16   Bos taurus [bovine]
gb:AC006282_1533948 Arabidopsis thaliana chromosome 2 clone F13K...    86   9e-16   
gb:AF401579_2492006 Ictalurus punctatus ribosomal protein L24 mR...    85   1e-15   
gb:AB099001_1410324 Bos taurus mRNA for similar to ribosomal pro...    84   3e-15   
sp|O65743|RL24_CICAR|RL24_CICAR 60S ribosomal protein L24.>gb:CAR225027_164...    84   3e-15   Cicer arietinum [garbanzo]
gb:BC078474_2561015 Xenopus laevis MGC85232 protein, mRNA (cDNA ...    83   5e-15   
gb:AB099003_1410326 Bos taurus mRNA for similar to ribosomal pro...    83   5e-15   
pir|F84782|F84782 60S ribosomal protein L24 [imported] - Arabido...    83   5e-15   Arabidopsis thaliana [mouse-ear cress]
gb:AK077617_1171954 Mus musculus 8 days embryo whole body cDNA, ...    82   8e-15   
sp|P50888|RL24_HORVU|RL24_HORVU 60S ribosomal protein L24.>pir|T06178|T0617...    82   8e-15   Hordeum vulgare [barley]
gb:AB098812_1410181 Bos taurus mRNA for similar to ribosomal pro...    82   1e-14   
gb:AP004331_1840321 Oryza sativa (japonica cultivar-group) genom...    82   1e-14   
sp|P24000|R24B_YEAST|R24B_YEAST 60S ribosomal protein L24-B (L30B) (RP29) (...    82   1e-14   Saccharomyces cerevisiae [brewer's yeast]
sp|P04449|R24A_YEAST|R24A_YEAST 60S ribosomal protein L24-A (L30A) (RP29) (...    81   2e-14   Saccharomyces cerevisiae [brewer's yeast]
gb:CR382131_1664433 Yarrowia lipolytica chromosome E of strain C...    81   2e-14   
gb:AC093952_1736173 Oryza sativa (japonica cultivar-group) chrom...    80   3e-14   
gb:AP003740_1832710 Oryza sativa (japonica cultivar-group) genom...    80   4e-14   
gb:AY826149_1180109 Aedes albopictus clone AL_305 ribosomal prot...    80   5e-14   
gb:AX887970_1483423 Sequence 3833 from Patent EP1033401.               79   7e-14   
gb:AF548322_1281125 Branchiostoma belcheri ribosomal protein L24...    79   9e-14   
gb:AL158815_1921485 Human DNA sequence from clone RP1-125M3 on c...    79   1e-13   
gb:CR380947_1649052 Candida glabrata strain CBS138 chromosome A ...    78   2e-13   
pir|T39071|T39071 60S ribosomal protein L24 - fission yeast  (Sc...    78   2e-13   Schizosaccharomyces pombe
gb:CGI563459_1372110 Crassostrea gigas partial mRNA for ribosoma...    77   3e-13   
pir|T41324|T41324 60s ribosomal protein L24 - fission yeast  (Sc...    77   3e-13   Schizosaccharomyces pombe
gb:AE017347_1757932 Cryptococcus neoformans var. neoformans JEC2...    76   6e-13   
gb:AE014134_1129045 Drosophila melanogaster chromosome 2L, compl...    76   7e-13   
gb:CR382137_1670572 Debaryomyces hansenii chromosome E of strain...    75   1e-12   
sp|P38665|RL24_KLULA|RL24_KLULA 60S ribosomal protein L24 (L30).>gb:CR38212...    75   1e-12   Kluyveromyces lactis
gb:AK019214_1159954 Mus musculus 11 days embryo whole body cDNA,...    74   3e-12   
gb:AE016819_1749312 Ashbya gossypii (= Eremothecium gossypii) AT...    73   5e-12   
gb:AY307168_1317868 Schistosoma japonicum 60S ribosomal protein ...    73   5e-12   
gb:AK028209_1160859 Mus musculus 11 days embryo whole body cDNA,...    72   8e-12   
gb:BX842637_1644129 Neurospora crassa DNA linkage group I cosmid...    72   1e-11   
gb:AY769294_1350445 Bombyx mori ribosomal protein L24 (RpL24) mR...    68   2e-10   
gb:AF400189_1268288 Spodoptera frugiperda ribosomal protein L24 ...    67   3e-10   
sp|P61123|R24E_METMP|R24E_METMP 50S ribosomal protein L24e.>gb:BX957220_843...    67   3e-10   Methanococcus maripaludis
gb:AB180446_1202464 Plutella xylostella mRNA for Ribosomal prote...    66   8e-10   
gb:AP006878_576461 Thermococcus kodakaraensis strain KOD1 DNA, c...    66   8e-10   
sp|O29492|R24E_ARCFU|R24E_ARCFU 50S ribosomal protein L24e.>pir|F69345|F693...    66   8e-10   Archaeoglobus fulgidus
pir|T30926|T30926 hypothetical protein D1007.12 - Caenorhabditis...    65   2e-09   Caenorhabditis elegans [roundworm]
sp|Q9V0W3|R24E_PYRAB|R24E_PYRAB 50S ribosomal protein L24e.>pir|E75109|E751...    65   2e-09   Pyrococcus abyssi
gb:AY829771_1180170 Lonomia obliqua ribosomal protein 14 mRNA, c...    64   3e-09   
gb:AE017261_420299 Picrophilus torridus DSM 9790, complete genome.     64   4e-09   
sp|Q8U158|R24E_PYRFU|R24E_PYRFU 50S ribosomal protein L24e.>gb:AE010241_260...    64   4e-09   Pyrococcus furiosus
sp|P54064|R24E_METJA|R24E_METJA 50S ribosomal protein L24e.>pir|H64449|H644...    64   4e-09   Methanocaldococcus jannaschii
sp|P61124|R24E_PYRHO|R24E_PYRHO 50S ribosomal protein L24e.                       63   5e-09   Pyrococcus horikoshii
gb:AB099064_1410387 Bos taurus mRNA for similar to ribosomal pro...    62   1e-08   
sp|Q975Z9|R24E_SULTO|R24E_SULTO 50S ribosomal protein L24e.>gb:BA000023_690...    60   3e-08   Sulfurisphaera tokodaii
sp|Q8TVE8|R24E_METKA|R24E_METKA 50S ribosomal protein L24e.>gb:AE010437_263...    60   6e-08   Methanopyrus kandleri
sp|Q9HJ58|R24E_THEAC|R24E_THEAC 50S ribosomal protein L24e.>gb:TACID4_19687...    59   7e-08   Thermoplasma acidophilum
sp|Q8ZTA6|R24E_PYRAE|R24E_PYRAE 50S ribosomal protein L24e.>gb:AE009925_257...    59   9e-08   Pyrobaculum aerophilum
sp|Q97BK6|R24E_THEVO|R24E_THEVO 50S ribosomal protein L24e.>gb:BA000011_664...    59   1e-07   Thermoplasma volcanium
sp|Q980Q6|R24E_SULSO|R24E_SULSO 50S ribosomal protein L24e.>pir|E90164|E901...    59   1e-07   Saccharolobus solfataricus
gb:AF011787_1231670 Trypanosoma brucei ribosomal protein L24 mRN...    58   2e-07   
pir|G90116|G90116 60S ribosomal protein L24 [imported] - Guillar...    57   4e-07   Guillardia theta
sp|O26357|R24E_METTH|R24E_METTH 50S ribosomal protein L24e.>pir|C69132|C691...    56   8e-07   Methanothermobacter thermautotrophicus
sp|Q9Y9A7|R24E_AERPE|R24E_AERPE 50S ribosomal protein L24e.>pir|A72467|A724...    55   1e-06   Aeropyrum pernix
sp|P61120|R24E_HALN1|R24E_HALN1 50S ribosomal protein L24e.>sp|P61121|R24E_...    55   2e-06   Halobacterium sp.
sp|Q8TQL7|R24E_METAC|R24E_METAC 50S ribosomal protein L24e.>gb:AE010822_266...    54   3e-06   Methanosarcina acetivorans
sp|Q8PU76|R24E_METMA|R24E_METMA 50S ribosomal protein L24e.>gb:AE013490_292...    54   4e-06   Methanosarcina mazei
gb:AY496460_1330703 Marsupenaeus japonicus ribosomal protein L24...    53   7e-06   
gb:AY596297_631644 Haloarcula marismortui ATCC 43049 chromosome ...    49   7e-05   
sp|P14116|R24E_HALMA|R24E_HALMA 50S ribosomal protein L24e (Hl21/Hl22).>pir...    49   7e-05   Haloarcula marismortui
gb:AJ698398_1283783 Euplotes vannus macronuclear gene for riboso...    48   2e-04   
gb:PFMAL13_1191154 Plasmodium falciparum 3D7 chromosome 13, *** ...    45   0.001   
gb:AY071693_1295777 Drosophila melanogaster RH14088 full insert ...    43   0.007   
sp|O67124|RA50_AQUAE|RA50_AQUAE Probable DNA double-strand break repair rad...    40   0.035   Aquifex aeolicus
gb:CR548612_1375607 Paramecium tetraurelia macronuclear largest ...    37   0.38    
gb:AJ720788_2502975 Gallus gallus mRNA for hypothetical protein,...    36   0.65    
gb:AK051450_1169693 Mus musculus 12 days embryo spinal ganglion ...    36   0.65    
gb:AF488563_1804426 Arabidopsis thaliana clone bHLH019 putative ...    35   1.1     
pir|E84616|E84616 probable bHLH transcription factor [imported] ...    35   1.1     Arabidopsis thaliana [mouse-ear cress]
gb:PFMAL3P4_1394489 Plasmodium falciparum MAL3P4.                      34   2.5     
gb:AY069357_1294087 Drosophila melanogaster LD06138 full length ...    34   2.5     
gb:BA000037_723102 Vibrio vulnificus YJ016 DNA, chromosome I, co...    34   2.5     
gb:AE016804_336807 Vibrio vulnificus CMCP6 chromosome I section ...    34   2.5     
pir|T18477|T18477 hypothetical protein C0485w - malaria parasite...    34   2.5     Plasmodium falciparum 3D7
gb:CR382127_1660141 Yarrowia lipolytica chromosome A of strain C...    34   3.2     
gb:AE005172_891057 Arabidopsis thaliana chromosome 1, top arm co...    34   3.2     
pir|F86342|F86342 F9H16.4 protein - Arabidopsis thaliana               34   3.2     Arabidopsis thaliana [mouse-ear cress]
gb:BC078484_2561025 Xenopus laevis MGC85251 protein, mRNA (cDNA ...    33   4.2     
gb:AF425077_2065495 Mus musculus ABCG4 (Abcg4) mRNA, complete cd...    33   4.2     
gb:AF378330_2064533 Mus musculus ATP-binding cassette transporte...    33   4.2     
gb:HSA300465_2003165 Homo sapiens mRNA for putative white family...    33   4.2     
gb:AL596114_1930608 Human DNA sequence from clone RP11-274A8 on ...    33   4.2     
gb:AK043147_1166521 Mus musculus 7 days neonate cerebellum cDNA,...    33   4.2     
gb:CP000001_852564 Bacillus cereus ZK, complete genome.                33   4.2     
sp|Q9H172|ABG4_HUMAN|ABG4_HUMAN ATP-binding cassette, sub-family G, member ...    33   4.2     Homo sapiens [man]
gb:BC066133_2554254 Xenopus tropicalis hypothetical protein MGC7...    33   5.5     
gb:CNS07EGE_1373680 chromosome VII of strain GB-M1 of Encephalit...    33   5.5     
gb:PFMAL13_1191256 Plasmodium falciparum 3D7 chromosome 13, *** ...    33   5.5     
sp|Q10251|IF2P_SCHPO|IF2P_SCHPO Eukaryotic translation initiation factor 5B...    33   5.5     Schizosaccharomyces pombe
gb:AK041719_1166085 Mus musculus 3 days neonate thymus cDNA, RIK...    33   7.2     
gb:CP000025_879553 Campylobacter jejuni RM1221, complete genome.       33   7.2     
pir|G81262|G81262 probable integral membrane protein Cj1658 [imp...    33   7.2     Campylobacter jejuni
pir|T32372|T32372 hypothetical protein C01B12.8 - Caenorhabditis...    33   7.2     Caenorhabditis elegans [roundworm]
gb:CR380957_1652979 Candida glabrata strain CBS138 chromosome K ...    27   9.0     
gb:BC065430_2553988 Danio rerio annexin A5, mRNA (cDNA clone MGC...    32   9.4     
gb:BC046873_2549772 Danio rerio annexin A5, mRNA (cDNA clone MGC...    32   9.4     
gb:AY178799_2516972 Danio rerio annexin 5 mRNA, complete cds.          32   9.4     
gb:BC081863_2108110 Rattus norvegicus cDNA clone MGC:93685 IMAGE...    32   9.4     
gb:BC066222_2105804 Mus musculus cDNA clone IMAGE:30459247, part...    32   9.4     
gb:BC057191_2102666 Mus musculus DnaJ (Hsp40) homolog, subfamily...    32   9.4     
gb:AB029919_2044578 Mus musculus STAP mRNA for sperm tail associ...    32   9.4     
gb:CR456900_1993107 Homo sapiens full open reading frame cDNA cl...    32   9.4     
gb:AL353354_1922722 Human DNA sequence from clone RP3-429K2 on c...    32   9.4     
gb:NPL18351_1691074 Nicotiana plumbaginifolia mRNA for U2 snRNP ...    32   9.4     
gb:CR548612_1375395 Paramecium tetraurelia macronuclear largest ...    32   9.4     
gb:AK088325_1175334 Mus musculus 2 days neonate thymus thymic ce...    32   9.4     
gb:AF161449_1150342 Homo sapiens HSPC331 mRNA, partial cds.            32   9.4     
gb:AF161433_1150326 Homo sapiens HSPC315 mRNA, partial cds.            32   9.4     
gb:AE014297_1138638 Drosophila melanogaster chromosome 3R, compl...    32   9.4     
pir|A39670|OKFFPS protein-tyrosine kinase (EC 2.7.1.112), fps/fe...    32   9.4     
sp|P18106|FPS_DROME|FPS_DROME Tyrosine-protein kinase Fps85D (EC 2.7.1.112...    32   9.4     Drosophila melanogaster
sp|O75937|DJC8_HUMAN|DJC8_HUMAN DnaJ homolog subfamily C member 8 (Splicing...    32   9.4     Homo sapiens [man]


>pir|T00407|T00407 60S ribosomal protein L30 [imported] -
           Arabidopsis thaliana>gb:AC002388_1530617 Arabidopsis
           thaliana chromosome 2 clone T13E15 map m336, complete
           sequence.>gb:AY049251_1561893 Arabidopsis thaliana
           At2g44860/T13E15.13 mRNA, complete
           cds.>gb:AY087358_1572390 Arabidopsis thaliana clone
           34564 mRNA, complete sequence.>gb:AY098951_1576511
           Arabidopsis thaliana At2g44860/T13E15.13 mRNA, complete
           cds.
          Length = 159

 Score =  243 bits (621), Expect = 2e-63
 Identities = 117/167 (70%), Positives = 138/167 (82%), Gaps = 1/167 (0%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKA+R  HG
Sbjct: 1   MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAFRAAHG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           KDMT+D TFEFE+KRNRPER+D+NVTENTL AIKKI K+R AREA H +NR++PNK +K 
Sbjct: 61  KDMTKDTTFEFEKKRNRPERYDRNVTENTLMAIKKIAKIRTAREAKHIENRLKPNKQKKL 120

Query: 420 KEAARELEQGIHLVKAPSVLQQDPSLTLPIKVKVSQQQS-EEKRMEE 557
            +  +EL+Q IH+V+AP   +        IKV VS+++S + + MEE
Sbjct: 121 NDDMKELDQNIHMVQAPGAQK--------IKVDVSEKKSVQNEAMEE 159



>gb:AP004346_1840584 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC
           clone:P0656C04.>gb:AP005258_1849719 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0446G09.
          Length = 163

 Score =  233 bits (595), Expect = 2e-60
 Identities = 113/166 (68%), Positives = 130/166 (78%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MRLEKCWFCSST+YPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYR LHG
Sbjct: 1   MRLEKCWFCSSTVYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRCLHG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           KDMTQD+TFEFERKRNRPER+D+NVTE TLKAI  I K+R  R+  H   R +  K +++
Sbjct: 61  KDMTQDSTFEFERKRNRPERYDRNVTEQTLKAISLITKIRHERQKKHITERQKQGKTKQR 120

Query: 420 KEAARELEQGIHLVKAPSVLQQDPSLTLPIKVKVSQQQSEEKRMEE 557
           +  A+ELEQ I ++     L    +    + VKVSQQQ+EE  MEE
Sbjct: 121 ERDAKELEQDIQMLPKKVTLSTQKT---KVVVKVSQQQTEENLMEE 163



>gb:AP002970_1824039 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0504D03.>gb:AP003202_1825072 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:B1075D06.
          Length = 164

 Score =  229 bits (585), Expect = 3e-59
 Identities = 114/167 (68%), Positives = 131/167 (78%), Gaps = 1/167 (0%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYR LHG
Sbjct: 1   MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRCLHG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           KDMTQD+TFEFERKRNRPER+D+NVT  TLKAI  I K+R  R   H   R +  K +++
Sbjct: 61  KDMTQDSTFEFERKRNRPERYDRNVTAQTLKAIPLITKIRHERHKKHITERQKQGKTKQR 120

Query: 420 KEAARELEQGIHLV-KAPSVLQQDPSLTLPIKVKVSQQQSEEKRMEE 557
           +  A+ELEQ I ++ K  ++L    +    + VKVSQQQ+EE  MEE
Sbjct: 121 ERDAKELEQDIQMLPKKDTMLSTQKT---KVVVKVSQQQTEENLMEE 164



>gb:AE017343_1755542 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 200

 Score =  183 bits (464), Expect = 3e-45
 Identities = 90/184 (48%), Positives = 122/184 (66%), Gaps = 18/184 (9%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+EKC+FCS+ +YPGHG  FVRNDAK FRFC SKCHKNFKMKRNPRKV+WTKA+RR +G
Sbjct: 1   MRIEKCYFCSANVYPGHGTMFVRNDAKCFRFCSSKCHKNFKMKRNPRKVRWTKAFRRANG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K+M  D TFEFE++RN P R+D+ +   TLKA++++ ++R  RE A  KNRM  N  +  
Sbjct: 61  KEMVVDTTFEFEKRRNVPVRYDRELVATTLKAMERVAEIRQKREKAFWKNRMSGNTAKNM 120

Query: 420 KEAARELEQGIHLV-----------KAPSVLQQDPSLTLPIKVKVS-------QQQSEEK 545
           +++A E+E+ I LV           KA   L+Q   +   IKV+ +       QQ  + K
Sbjct: 121 RDSALEIERHIELVQPRSATAVSTSKASEALEQREKVREKIKVRAAGRKAMALQQMGQGK 180

Query: 546 RMEE 557
           + +E
Sbjct: 181 KQKE 184



>gb:AC117075_1207751 Dictyostelium discoideum chromosome 2 map
           5201047-5455781 strain AX4, complete sequence.
          Length = 164

 Score =  182 bits (462), Expect = 6e-45
 Identities = 77/142 (54%), Positives = 108/142 (76%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+EKC+FCS  +YPGHG+ FVRND K FRFCRSKCHKNFK+KRNPRK +WTKA+R+L+G
Sbjct: 1   MRIEKCYFCSGPVYPGHGVMFVRNDCKQFRFCRSKCHKNFKLKRNPRKTRWTKAFRKLNG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K+MT D T EFE+KRNRP ++D+ +  NT+ A+ ++ K++  RE   +KNRM   K  ++
Sbjct: 61  KEMTVDKTLEFEKKRNRPVKYDRELINNTIIAMARVQKIKERREKTFYKNRMEGVKGMQK 120

Query: 420 KEAARELEQGIHLVKAPSVLQQ 485
           K+  +E+ Q + L++ PS L +
Sbjct: 121 KQKLKEINQNLSLIRGPSALNK 142



>gb:BC062237_2104961 Rattus norvegicus cDNA clone MGC:72943
           IMAGE:6919069, complete cds.
          Length = 163

 Score =  175 bits (443), Expect = 9e-43
 Identities = 78/166 (46%), Positives = 118/166 (71%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+EKC+FCS  IYPGHG+ FVRND K+FRFC+SKCHKNFK KRNPRKV+WTKA+R+  G
Sbjct: 1   MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K++T D +FEFE++RN P ++ + +   T+ A+K++++++  R+A    NR++ NK  ++
Sbjct: 61  KELTVDNSFEFEKRRNEPVKYQRELWNKTIDAMKRVEEIKQRRQAKFIMNRLKKNKELQK 120

Query: 420 KEAARELEQGIHLVKAPSVLQQDPSLTLPIKVKVSQQQSEEKRMEE 557
            +  RE++Q IHL++AP            ++ K+ QQ  E+  ME+
Sbjct: 121 VQDIREVKQNIHLIRAPLA-----GKGKQLEEKMVQQLQEDVDMED 161



>gb:BC003885_2089428 Mus musculus cDNA sequence BC003885, mRNA (cDNA
           clone MGC:6735 IMAGE:3590401), complete
           cds.>gb:BC089481_2110844 Mus musculus cDNA sequence
           BC003885, mRNA (cDNA clone MGC:107129 IMAGE:30254073),
           complete cds.
          Length = 163

 Score =  175 bits (443), Expect = 9e-43
 Identities = 78/166 (46%), Positives = 118/166 (71%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+EKC+FCS  IYPGHG+ FVRND K+FRFC+SKCHKNFK KRNPRKV+WTKA+R+  G
Sbjct: 1   MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K++T D +FEFE++RN P ++ + +   T+ A+K++++++  R+A    NR++ NK  ++
Sbjct: 61  KELTVDNSFEFEKRRNEPVKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQK 120

Query: 420 KEAARELEQGIHLVKAPSVLQQDPSLTLPIKVKVSQQQSEEKRMEE 557
            +  +E++Q IHL++AP            ++ K+ QQ  E+  MEE
Sbjct: 121 VQDIKEVKQNIHLIRAPLA-----GKGKQLEEKMVQQLQEDVDMEE 161



>gb:BC016312_1975532 Homo sapiens chromosome 15 open reading frame
           15, mRNA (cDNA clone MGC:22728 IMAGE:4096867), complete
           cds.
          Length = 163

 Score =  174 bits (440), Expect = 2e-42
 Identities = 77/166 (46%), Positives = 118/166 (71%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+EKC+FCS  IYPGHG+ FVRND K+FRFC+SKCHKNFK KRNPRKV+WTKA+R+  G
Sbjct: 1   MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K++T D +FEFE++RN P ++ + +   T+ A+K++++++  R+A    NR++ NK  ++
Sbjct: 61  KELTVDNSFEFEKRRNEPIKYQRELRNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQK 120

Query: 420 KEAARELEQGIHLVKAPSVLQQDPSLTLPIKVKVSQQQSEEKRMEE 557
            +  +E++Q IHL++AP            ++ K+ QQ  E+  ME+
Sbjct: 121 VQDIKEVKQNIHLIRAPLA-----GKGKQLEEKMVQQLQEDVDMED 161



>gb:AF212226_1150577 Homo sapiens RPL24 mRNA, complete
           cds.>gb:AF060926_1879849 Homo sapiens clone 018e04 My024
           protein mRNA, complete cds.>gb:AF165521_1887261 Homo
           sapiens ribosomal protein L30 isolog (L30) mRNA,
           complete cds.>gb:AF201949_1889825 Homo sapiens 60S
           ribosomal protein L30 isolog mRNA, complete
           cds.>gb:BC008409_1971362 Homo sapiens chromosome 15 open
           reading frame 15, mRNA (cDNA clone MGC:14543
           IMAGE:4097130), complete cds.>gb:BC008422_1971371 Homo
           sapiens chromosome 15 open reading frame 15, mRNA (cDNA
           clone MGC:14573 IMAGE:4096889), complete
           cds.>gb:BC008449_1971388 Homo sapiens chromosome 15 open
           reading frame 15, mRNA (cDNA clone MGC:14686
           IMAGE:4133589), complete cds.>gb:BC009593_1972123 Homo
           sapiens chromosome 15 open reading frame 15, mRNA (cDNA
           clone MGC:14678 IMAGE:4109097), complete
           cds.>gb:BC009604_1972133 Homo sapiens chromosome 15 open
           reading frame 15, mRNA (cDNA clone MGC:14750
           IMAGE:4282059), complete cds.>gb:BC012913_1973846 Homo
           sapiens chromosome 15 open reading frame 15, mRNA (cDNA
           clone MGC:21433 IMAGE:4514979), complete
           cds.>gb:BC016331_1975545 Homo sapiens chromosome 15 open
           reading frame 15, mRNA (cDNA clone MGC:23761
           IMAGE:4108672), complete cds.>gb:BC016725_1975682 Homo
           sapiens chromosome 15 open reading frame 15, mRNA (cDNA
           clone MGC:24451 IMAGE:4078305), complete
           cds.>gb:BC016777_1975715 Homo sapiens chromosome 15 open
           reading frame 15, mRNA (cDNA clone MGC:23743
           IMAGE:4104810), complete cds.>gb:BC026266_1978771 Homo
           sapiens chromosome 15 open reading frame 15, mRNA (cDNA
           clone MGC:22752 IMAGE:4276092), complete
           cds.>gb:BC026267_1978772 Homo sapiens chromosome 15 open
           reading frame 15, mRNA (cDNA clone MGC:22753
           IMAGE:4277062), complete cds.>gb:BC035995_1981786 Homo
           sapiens chromosome 15 open reading frame 15, mRNA (cDNA
           clone MGC:32790 IMAGE:4671856), complete
           cds.>gb:CR457179_1993386 Homo sapiens full open reading
           frame cDNA clone RZPDo834D108D for gene C15orf15,
           chromosome 15 open reading frame 15; complete cds, incl.
           stopcodon.
          Length = 163

 Score =  173 bits (439), Expect = 3e-42
 Identities = 77/166 (46%), Positives = 118/166 (71%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+EKC+FCS  IYPGHG+ FVRND K+FRFC+SKCHKNFK KRNPRKV+WTKA+R+  G
Sbjct: 1   MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K++T D +FEFE++RN P ++ + +   T+ A+K++++++  R+A    NR++ NK  ++
Sbjct: 61  KELTVDNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQK 120

Query: 420 KEAARELEQGIHLVKAPSVLQQDPSLTLPIKVKVSQQQSEEKRMEE 557
            +  +E++Q IHL++AP            ++ K+ QQ  E+  ME+
Sbjct: 121 VQDIKEVKQNIHLIRAPLA-----GKGKQLEEKMVQQLQEDVDMED 161



>gb:BC005344_1969790 Homo sapiens chromosome 15 open reading frame
           15, mRNA (cDNA clone IMAGE:3930512), complete cds.
          Length = 150

 Score =  172 bits (436), Expect = 6e-42
 Identities = 71/137 (51%), Positives = 107/137 (78%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+EKC+FCS  IYPGHG+ FVRND K+FRFC+SKCHKNFK KRNPRKV+WTKA+R+  G
Sbjct: 1   MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K++T D +FEFE++RN P ++ + +   T+ A+K++++++  R+A    NR++ NK  ++
Sbjct: 61  KELTVDNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQK 120

Query: 420 KEAARELEQGIHLVKAP 470
            +  +E++Q IHL++AP
Sbjct: 121 VQDIKEVKQNIHLIRAP 137



>gb:AX970445_1485754 Sequence 1248 from Patent EP1104808.
          Length = 157

 Score =  172 bits (436), Expect = 6e-42
 Identities = 71/137 (51%), Positives = 107/137 (78%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+EKC+FCS  IYPGHG+ FVRND K+FRFC+SKCHKNFK KRNPRKV+WTKA+R+  G
Sbjct: 1   MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K++T D +FEFE++RN P ++ + +   T+ A+K++++++  R+A    NR++ NK  ++
Sbjct: 61  KELTVDNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQK 120

Query: 420 KEAARELEQGIHLVKAP 470
            +  +E++Q IHL++AP
Sbjct: 121 VQDIKEVKQNIHLIRAP 137



>gb:CR857358_1181601 Pongo pygmaeus mRNA; cDNA DKFZp469K1632 (from
           clone DKFZp469K1632).
          Length = 163

 Score =  172 bits (436), Expect = 6e-42
 Identities = 76/166 (45%), Positives = 118/166 (71%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+EKC+FCS  IYPGHG+ FVRND K+FRFC+SKCHKNFK +RNPRKV+WTKA+R+  G
Sbjct: 1   MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKRRNPRKVRWTKAFRKAAG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K++T D +FEFE++RN P ++ + +   T+ A+K++++++  R+A    NR++ NK  ++
Sbjct: 61  KELTVDNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQK 120

Query: 420 KEAARELEQGIHLVKAPSVLQQDPSLTLPIKVKVSQQQSEEKRMEE 557
            +  +E++Q IHL++AP            ++ K+ QQ  E+  ME+
Sbjct: 121 VQDIKEVKQNIHLIRAPLA-----GKGKQLEEKMVQQLQEDVDMED 161



>gb:BC008499_1971422 Homo sapiens chromosome 15 open reading frame
           15, mRNA (cDNA clone MGC:14835 IMAGE:4286115), complete
           cds.
          Length = 163

 Score =  171 bits (433), Expect = 1e-41
 Identities = 76/166 (45%), Positives = 117/166 (70%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+EKC+FCS  IYPGHG+ FVRND K+ RFC+SKCHKNFK KRNPRKV+WTKA+R+  G
Sbjct: 1   MRIEKCYFCSGPIYPGHGMMFVRNDCKVIRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K++T D +FEFE++RN P ++ + +   T+ A+K++++++  R+A    NR++ NK  ++
Sbjct: 61  KELTVDNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQK 120

Query: 420 KEAARELEQGIHLVKAPSVLQQDPSLTLPIKVKVSQQQSEEKRMEE 557
            +  +E++Q IHL++AP            ++ K+ QQ  E+  ME+
Sbjct: 121 VQDIKEVKQNIHLIRAPLA-----GKGKQLEEKMVQQLQEDVDMED 161



>gb:BC042273_2548093 Xenopus laevis similar to chromosome 15 open
           reading frame 15, mRNA (cDNA clone MGC:53444
           IMAGE:5571948), complete cds.
          Length = 163

 Score =  171 bits (432), Expect = 2e-41
 Identities = 74/166 (44%), Positives = 120/166 (72%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+EKC+FCS+ IYPGHG+ FVRND+K+FRFCRSKCHKNFK KRNPRK++WTKA+R+  G
Sbjct: 1   MRVEKCYFCSAPIYPGHGMMFVRNDSKVFRFCRSKCHKNFKKKRNPRKIRWTKAFRKSAG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K++T D +FEFE++RN P ++ + +   +++A+K++++++  R+A    NR++  K  ++
Sbjct: 61  KELTVDNSFEFEKRRNEPVKYQRELWSKSVEAMKRVEEIKQKRQARFIMNRLKKGKELQK 120

Query: 420 KEAARELEQGIHLVKAPSVLQQDPSLTLPIKVKVSQQQSEEKRMEE 557
            +  +E++Q IHL++AP            ++ K+ Q+  E+  ME+
Sbjct: 121 AQDIKEVKQNIHLIRAPHA-----GKAKQLEDKMVQKLQEDVDMED 161



>gb:BC014576_1974700 Homo sapiens chromosome 15 open reading frame
           15, mRNA (cDNA clone MGC:22835 IMAGE:3930303), complete
           cds.
          Length = 163

 Score =  171 bits (432), Expect = 2e-41
 Identities = 76/166 (45%), Positives = 117/166 (70%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+EKC+FCS  IYPGHG+ FVRND K+F FC+SKCHKNFK KRNPRKV+WTKA+R+  G
Sbjct: 1   MRIEKCYFCSGPIYPGHGMMFVRNDCKVFGFCKSKCHKNFKKKRNPRKVRWTKAFRKAAG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K++T D +FEFE++RN P ++ + +   T+ A+K++++++  R+A    NR++ NK  ++
Sbjct: 61  KELTVDNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQK 120

Query: 420 KEAARELEQGIHLVKAPSVLQQDPSLTLPIKVKVSQQQSEEKRMEE 557
            +  +E++Q IHL++AP            ++ K+ QQ  E+  ME+
Sbjct: 121 VQDIKEVKQNIHLIRAPLA-----GKGKQLEEKMVQQLQEDVDMED 161



>gb:BC028672_1979304 Homo sapiens chromosome 15 open reading frame
           15, mRNA (cDNA clone MGC:23706 IMAGE:4092804), complete
           cds.
          Length = 163

 Score =  170 bits (431), Expect = 2e-41
 Identities = 70/137 (51%), Positives = 107/137 (78%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+EKC+FCS  IYPGHG+ FVRND K+FRFC+SKCHKNFK KR+PRKV+WTKA+R+  G
Sbjct: 1   MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRDPRKVRWTKAFRKAAG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K++T D +FEFE++RN P ++ + +   T+ A+K++++++  R+A    NR++ NK  ++
Sbjct: 61  KELTVDNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQK 120

Query: 420 KEAARELEQGIHLVKAP 470
            +  +E++Q IHL++AP
Sbjct: 121 VQDIKEVKQNIHLIRAP 137



>gb:BC073497_2557333 Xenopus laevis MGC81028 protein, mRNA (cDNA
           clone MGC:81028 IMAGE:5572253), complete cds.
          Length = 163

 Score =  170 bits (430), Expect = 3e-41
 Identities = 76/166 (45%), Positives = 118/166 (71%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+EKC+FCS+ IYPGHG+ FVRND K FRFCRSKCHKNFK KRNPRK++WTKA+R+  G
Sbjct: 1   MRVEKCYFCSAPIYPGHGMMFVRNDCKAFRFCRSKCHKNFKKKRNPRKLRWTKAFRKSAG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K++T D +FEFE++RN P ++ + +   T++A+K++++++  R+A    NR++  K  ++
Sbjct: 61  KELTVDNSFEFEKRRNEPFKYQRQLWSKTVEAMKRVEEIKQKRQARFIMNRLKKGKELQK 120

Query: 420 KEAARELEQGIHLVKAPSVLQQDPSLTLPIKVKVSQQQSEEKRMEE 557
            +  +E++Q IHL++AP            ++ K+ Q+  E+  MEE
Sbjct: 121 AQDIKEVKQNIHLIRAPHA-----GKAKQMEDKMVQKLQEDVDMEE 161



>gb:BC051780_2550447 Danio rerio zgc:56202, mRNA (cDNA clone
           MGC:56202 IMAGE:5600269), complete cds.
          Length = 161

 Score =  167 bits (424), Expect = 1e-40
 Identities = 74/166 (44%), Positives = 117/166 (70%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+EKC+FCS+ +YPGHG+ FVRND K+FRFCRSKCHKNFK KRNPRK +WTKA+R+  G
Sbjct: 1   MRIEKCYFCSAPVYPGHGMMFVRNDCKVFRFCRSKCHKNFKKKRNPRKTRWTKAFRKSAG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K++T D + EFE++RN P ++++ +   T++A++K++ ++  R+A    NR++  K  ++
Sbjct: 61  KELTVDNSLEFEKRRNTPVKYNRELWSKTVEAMRKVESIKHKRQARFIMNRLKKGKELEK 120

Query: 420 KEAARELEQGIHLVKAPSVLQQDPSLTLPIKVKVSQQQSEEKRMEE 557
                E+++ IHL+KAP   Q        ++ K+ Q+ +E+  M+E
Sbjct: 121 AADISEVKKNIHLIKAPHAGQ-----AKQLEDKMVQKLAEDVEMDE 161



>gb:AY292613_1316669 Oikopleura dioica 60S ribosomal protein L24
           (RL24) gene, complete cds.
          Length = 165

 Score =  164 bits (416), Expect = 1e-39
 Identities = 71/139 (51%), Positives = 107/139 (76%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+EKC+FCS+ +YPGHG  FVRND+K FRFC +KC+K FK K+NPRK+KWTKAYR+ HG
Sbjct: 1   MRVEKCYFCSAPVYPGHGTVFVRNDSKQFRFCTAKCNKMFKKKKNPRKIKWTKAYRKAHG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K++T DA+ EFE++RN P ++D+ + ++T+KA+KKI  +R  REA H  +R+  +K  ++
Sbjct: 61  KELTCDASLEFEKRRNEPVKYDRKLMQDTVKAVKKISAIRQKREAHHILSRLAVSKEVQK 120

Query: 420 KEAARELEQGIHLVKAPSV 476
           +    E++  + +V+AP+V
Sbjct: 121 RADLWEVDTNLKIVQAPAV 139



>gb:CR382128_1660734 Yarrowia lipolytica chromosome B of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 188

 Score =  162 bits (410), Expect = 6e-39
 Identities = 81/171 (47%), Positives = 115/171 (67%), Gaps = 8/171 (4%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+  C FCSS +YPG GI FVRND+K FRFCRSKCHKNFKMKRNPRK++WTKA+R+  G
Sbjct: 1   MRVYNCHFCSSPVYPGKGIMFVRNDSKEFRFCRSKCHKNFKMKRNPRKLRWTKAFRKAAG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKL--- 410
           K+M  D+T  F  +R+ P R+++++ E TL+A++K++++R+ RE A +KNRMR NK    
Sbjct: 61  KEMVVDSTLAFSARRDVPVRYNRDLVEKTLEAMEKVEEIRLKRERAFYKNRMRGNKAAQL 120

Query: 411 ---RKQKEAAREL--EQGIHLVKAPSVLQQDPSLTLPIKVKVSQQQSEEKR 548
              RK  EA  EL  E+ + L +     + D    +       +++SEE+R
Sbjct: 121 EEDRKLVEAHPELLREREVELRRMQEAGEDDDDEDMSEMEVSEEEESEEER 171



>pir|S64831|S64831 ribosomal protein L24 homolog YLR009w - yeast
           (Saccharomyces cerevisiae)>gb:AY558197_1614424
           Saccharomyces cerevisiae clone FLH111022.01X YLR009W
           gene, complete cds.>gb:SCYLR009W_1713410 S.cerevisiae
           chromosome XII reading frame ORF YLR009w.
          Length = 199

 Score =  158 bits (400), Expect = 9e-38
 Identities = 84/182 (46%), Positives = 117/182 (64%), Gaps = 16/182 (8%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+ +C FCSS  YPGHGI FVRNDAK FRFCRSKCHK FK +RNPRK+KWTKA+R+  G
Sbjct: 1   MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNK---- 407
           K++  D+T  F ++RN P R+++ +   TLKA+ +I+++R  RE A +KNRMR NK    
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIRQKRERAFYKNRMRGNKEKDF 120

Query: 408 LRKQKEA--------ARELEQGIHLVK----APSVLQQDPSLTLPIKVKVSQQQSEEKRM 551
           LR +K           RE+E    L K    A SV +Q+ S      +++   + EE+++
Sbjct: 121 LRDKKLVESNPELLRIREVEIARKLAKEQERAESVSEQEESEEEEEDMEIDSDEEEEEQL 180

Query: 552 EE 557
           E+
Sbjct: 181 EK 182



>gb:CR380956_1652027 Candida glabrata strain CBS138 chromosome J
           complete sequence.
          Length = 197

 Score =  157 bits (397), Expect = 2e-37
 Identities = 76/163 (46%), Positives = 110/163 (67%), Gaps = 1/163 (0%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+ +C FCSS +YPGHGI FVRNDAK FRFCRSKCHKNFK +RNPRK+KWTKA+R+  G
Sbjct: 1   MRIYQCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKNFKQRRNPRKLKWTKAFRKAAG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K++  D+T  F ++RN P R+++ +   TLKA+ +I+++R  RE A +KNRM+ N  R  
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQKRERAFYKNRMKGNSERDF 120

Query: 420 KEAARELEQGIHLVKAPSV-LQQDPSLTLPIKVKVSQQQSEEK 545
               + +E    L++   V +    +       +VS+++SEE+
Sbjct: 121 LRDKKLVETNPELLRLREVEIANRLAKEQAAAEEVSEEESEEE 163



>sp|Q10353|RL24_SCHPO 60S ribosomal protein L24
           (L30).>pir|T38170|T38170 60s ribosomal protein l24-3
           (L30) - fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC22E12_1717172 S.pombe chromosome I cosmid
           c22E12.
          Length = 192

 Score =  155 bits (393), Expect = 6e-37
 Identities = 75/166 (45%), Positives = 102/166 (61%), Gaps = 1/166 (0%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+  C+FCS  +YPGHGI FVRND+K+FRFCRSKCHKNFKMKRNPRKV WTKAYR+ HG
Sbjct: 1   MRVHTCYFCSGPVYPGHGIMFVRNDSKVFRFCRSKCHKNFKMKRNPRKVAWTKAYRKAHG 60

Query: 240 KDMTQDATFEF-ERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRK 416
           K+M  D        +RN P R+D+NV   TL A+K++ +V   RE   +K R+   + ++
Sbjct: 61  KEMVYDTALAVTAARRNVPVRYDRNVIATTLNAMKRVSQVHAKRERLFYKKRLAGKRAQE 120

Query: 417 QKEAARELEQGIHLVKAPSVLQQDPSLTLPIKVKVSQQQSEEKRME 554
            +EA + + Q +     P    +   +  P  V   +   EE+  E
Sbjct: 121 LQEAQKLIAQNVPQFTEPEGEVETAEVQEPQIVSDEEYTMEEEVAE 166



>gb:AE016817_1747730 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 197

 Score =  154 bits (388), Expect = 2e-36
 Identities = 71/139 (51%), Positives = 97/139 (69%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+  C FCSS +YPGHGI FVRNDAK FRFCRSKCHK FK +RNPRK+KWTKA+R+  G
Sbjct: 1   MRIYSCHFCSSPVYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K++  D+T  F ++RN P R+++ + E TLKA+ +I+++R  RE A +KNRM+ N  +  
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVETTLKAMTRIEEIRQKRERAFYKNRMKGNTEKDF 120

Query: 420 KEAARELEQGIHLVKAPSV 476
               + +E    L+K   V
Sbjct: 121 LRDKKLVESNPELLKMREV 139



>gb:PFA929351_1392964 Plasmodium falciparum strain 3D7, chromosome
           5, segment 1/4.
          Length = 204

 Score =  154 bits (388), Expect = 2e-36
 Identities = 64/112 (57%), Positives = 86/112 (76%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+EKCW+CS  IYPGHGI F+RND  +F+FCRSKCHK+FK K NPRKVKWTK YR+   
Sbjct: 1   MRIEKCWYCSGNIYPGHGIFFIRNDCNVFKFCRSKCHKHFKAKHNPRKVKWTKIYRKERN 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRM 395
           K+++ D TFEFE+ RN P ++D+++   T+ AIKKID ++  R+   +KNR+
Sbjct: 61  KELSYDKTFEFEKIRNEPIKYDRDIYIKTINAIKKIDTIKEKRKMRFYKNRI 112



>gb:CR382125_1657639 Kluyveromyces lactis strain NRRL Y-1140
           chromosome E of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 198

 Score =  152 bits (385), Expect = 5e-36
 Identities = 72/166 (43%), Positives = 111/166 (66%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+  C FCSS  YPGHGI FVRNDAK FRFCRSKCHK FK +RNPRK++WTKA+R+  G
Sbjct: 1   MRVYACHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLRWTKAFRKAAG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K++  D+T  F ++RN P R+++ +   TLKA+ +I+++R  RE A +KNRM+ N  R  
Sbjct: 61  KELAVDSTLTFAQRRNVPVRYNRELVATTLKAMSRIEEIRQRRERAFYKNRMKGNNER-- 118

Query: 420 KEAARELEQGIHLVKAPSVLQQDPSLTLPIKVKVSQQQSEEKRMEE 557
                        ++  ++++ +P L    +V++++Q ++E+ +E+
Sbjct: 119 -----------DFLRDKALVESNPELLRLREVELARQAAKEEAIEQ 153



>gb:CR382139_1672987 Debaryomyces hansenii chromosome G of strain
           CBS767 of Debaryomyces hansenii.
          Length = 203

 Score =  151 bits (381), Expect = 1e-35
 Identities = 74/166 (44%), Positives = 107/166 (64%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+  C FCSS +YP HGI FVRNDAK FRFCRSKCH  FK +RNPRK++WTKA+R+  G
Sbjct: 1   MRVYSCHFCSSPVYPLHGIMFVRNDAKEFRFCRSKCHHAFKQRRNPRKLRWTKAFRKAAG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K++  D+T  F  +RN P R+++++   TLK + +++++R  RE A +KNRMR NK +K 
Sbjct: 61  KELVVDSTLTFAARRNVPVRYNRDLVATTLKTMARVEEIRQKRERAFYKNRMRGNKDKKL 120

Query: 420 KEAARELEQGIHLVKAPSVLQQDPSLTLPIKVKVSQQQSEEKRMEE 557
               R +EQ   L+K   V          ++ K  ++ ++E  M+E
Sbjct: 121 ALDRRLVEQNPQLLKIRDV---------ELRRKAERKAAKENAMDE 157



>gb:AX887989_1483442 Sequence 3852 from Patent EP1033401.
          Length = 111

 Score =  150 bits (379), Expect = 2e-35
 Identities = 62/111 (55%), Positives = 87/111 (78%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+EKC+FCS  IYPGHG+ FVRND K+FRFC+SKCHKNFK KRNPRKV+WTKA+R+  G
Sbjct: 1   MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNR 392
           K++T D +FEFE++RN P ++ + +   T+ A+K++++++  R A    NR
Sbjct: 61  KELTVDNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRXAKFIMNR 111



>gb:AE014297_1138997 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003691_1220990 Drosophila melanogaster
           chromosome 3R, section 29 of 118 of the complete
           sequence.>gb:AY113325_1299273 Drosophila melanogaster
           AT28833 full insert cDNA.
          Length = 191

 Score =  148 bits (374), Expect = 9e-35
 Identities = 66/166 (39%), Positives = 110/166 (66%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR++ C+FCSS IYPGHG+QFVRND K+F+FCR KCHK FK K+NPRKV WTKAYR+  G
Sbjct: 1   MRIQTCYFCSSKIYPGHGVQFVRNDCKVFKFCRGKCHKAFKRKKNPRKVGWTKAYRKAAG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K++  D +FEFE++RN P ++ +   +  L+AIK++ +++  R +     R+R  +  + 
Sbjct: 61  KELAIDPSFEFEKRRNVPMKYSRETWQKGLEAIKRVTEIKEKRTSHFVMERLRKGRQVEI 120

Query: 420 KEAARELEQGIHLVKAPSVLQQDPSLTLPIKVKVSQQQSEEKRMEE 557
           +   +++++ + L+++P+           +K + +Q+ +EE  + E
Sbjct: 121 QMDVKDVQRNMSLIRSPAA---------GLKQRRAQEAAEEAALME 157



>sp|Q17606|RL24_CAEEL 60S ribosomal protein L24.>pir|T18884|T18884
           hypothetical protein C03D6.8 - Caenorhabditis
           elegans>gb:CEC03D6_1359968 Caenorhabditis elegans cosmid
           C03D6, complete sequence.
          Length = 162

 Score =  144 bits (362), Expect = 2e-33
 Identities = 62/137 (45%), Positives = 101/137 (73%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+EKC+FCSS IYPGHGIQFVRND+ +F+FCRS+C+K FK K+NPRK+++TKA RR  G
Sbjct: 1   MRIEKCYFCSSPIYPGHGIQFVRNDSTVFKFCRSRCNKLFKKKKNPRKLRFTKAARRARG 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K++  DAT   E++R+ P ++++ + + T++A K I  ++  R     + R++P K+ ++
Sbjct: 61  KELINDATQLLEQRRDEPVKYERAMFQKTIEAAKTISALKTKRYGNLIRKRLQPGKIVQK 120

Query: 420 KEAARELEQGIHLVKAP 470
           K    ++++ +HL++AP
Sbjct: 121 KGLLAKVDKKMHLIRAP 137



>gb:CNS07EG9_1372835 chromosome II of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 155

 Score =  129 bits (323), Expect = 7e-29
 Identities = 60/135 (44%), Positives = 86/135 (63%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+EKCWFCSS IY GHG  +VRNDAK+FRFCR KC K F  + NPRKVKWTK  R++  
Sbjct: 1   MRIEKCWFCSSNIYQGHGTIYVRNDAKVFRFCRPKCRKLFARRVNPRKVKWTKISRKMAN 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K++  DA   FE + N P  +D+   E TL +I +I ++R  RE    K+R+   +   +
Sbjct: 61  KELCNDAILTFEHRLNEPRMYDRAEAERTLSSIPRILEIRKRREDFFIKDRILTGQEMNK 120

Query: 420 KEAARELEQGIHLVK 464
           +   + +E+  +L++
Sbjct: 121 ESDLKYIERHANLLE 135



>gb:OSA417524_1692532 Oryza sativa partial mRNA for putative
           ribosomal protein L30 (xd12 gene).
          Length = 105

 Score =  107 bits (268), Expect = 2e-22
 Identities = 56/108 (51%), Positives = 73/108 (67%)
 Frame = +3

Query: 234 HGKDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLR 413
           HGKDMTQD+TFEFERKRNRPER+D+NVTE TLKAI  I K+R  R+  H   R +  K +
Sbjct: 1   HGKDMTQDSTFEFERKRNRPERYDRNVTEQTLKAIPLITKIRHERQKKHITERQKQGKTK 60

Query: 414 KQKEAARELEQGIHLVKAPSVLQQDPSLTLPIKVKVSQQQSEEKRMEE 557
           +++  A+ELEQ I ++     L    +    + VKVSQQQ+EE  M+E
Sbjct: 61  QRERDAKELEQDIQMLPKKVTLSTQKT---KVVVKVSQQQTEESLMKE 105



>gb:AF266175_2483228 Gillichthys mirabilis 60S ribosomal protein L24
           mRNA, complete cds.
          Length = 156

 Score = 88.2 bits (217), Expect = 1e-16
 Identities = 48/153 (31%), Positives = 80/153 (52%), Gaps = 1/153 (0%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++E C F    IYPGHG ++ R D K+F+F  +KC   F  KRNPR++ WT  YRR H 
Sbjct: 1   MKVELCSFSGYKIYPGHGRRYARIDGKVFQFLNAKCESAFLAKRNPRQINWTVLYRRKHK 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K  +++ T   +++  R  +F + +T  +L    +I   R  +       R RP++L + 
Sbjct: 61  KGQSEEVT---KKRTRRAVKFQRAITGASL---AEIMAKRNQKPEVRKAQRSRPSELLRS 114

Query: 420 KEAARELEQ-GIHLVKAPSVLQQDPSLTLPIKV 515
           K+A +  ++      K  +   Q P +  P+K+
Sbjct: 115 KKAKQATKKPAAASAKTSAKTAQKPKIAKPMKI 147



>gb:BC059530_2552507 Danio rerio ribosomal protein L24, mRNA (cDNA
           clone MGC:73180 IMAGE:4786444), complete cds.
          Length = 157

 Score = 86.7 bits (213), Expect = 4e-16
 Identities = 50/154 (32%), Positives = 82/154 (53%), Gaps = 2/154 (1%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++E C F    IYPGHG ++ R D K+F+F  +KC   F  KRNPR++ WT  YRR H 
Sbjct: 1   MKVELCSFSGYKIYPGHGRRYARIDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHK 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAI--KKIDKVRIAREAAHHKNRMRPNKLR 413
           K  +++ +   +++  R  +F + +T  +L  I  K+  K  + R+A   +      + +
Sbjct: 61  KGQSEEVS---KKRTRRAVKFQRAITGASLAEILAKRNQKPEV-RKAQREQAIRAAKEAK 116

Query: 414 KQKEAARELEQGIHLVKAPSVLQQDPSLTLPIKV 515
           K K+A +  +Q     KAP+   Q   +  P+KV
Sbjct: 117 KAKQATK--KQTTQSSKAPAKSAQKQKIAKPMKV 148



>gb:AY099532_2512368 Danio rerio 60S ribosomal protein L24 (rpl24)
           mRNA, complete cds.
          Length = 157

 Score = 86.7 bits (213), Expect = 4e-16
 Identities = 50/154 (32%), Positives = 82/154 (53%), Gaps = 2/154 (1%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++E C F    IYPGHG ++ R D K+F+F  +KC   F  KRNPR++ WT  YRR H 
Sbjct: 1   MKVELCSFSGYKIYPGHGRRYARVDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHK 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAI--KKIDKVRIAREAAHHKNRMRPNKLR 413
           K  +++ +   +++  R  +F + +T  +L  I  K+  K  + R+A   +      + +
Sbjct: 61  KGQSEEVS---KKRTRRAVKFQRAITGASLAEILAKRNQKPEV-RKAQREQAIRAAKEAK 116

Query: 414 KQKEAARELEQGIHLVKAPSVLQQDPSLTLPIKV 515
           K K+A +  +Q     KAP+   Q   +  P+KV
Sbjct: 117 KAKQATK--KQTTQSSKAPAKSAQKQKIAKPMKV 148



>gb:AY190673_2517992 Pagrus major 60S ribosomal protein L24 mRNA,
           complete cds.
          Length = 157

 Score = 86.3 bits (212), Expect = 5e-16
 Identities = 49/154 (31%), Positives = 81/154 (52%), Gaps = 2/154 (1%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++E C F    IYPGHG ++ R D K+F+F  +KC   F  KRNPR++ WT  YRR H 
Sbjct: 1   MKVELCSFSGYKIYPGHGRRYARIDGKVFQFLNAKCESAFLAKRNPRQINWTVLYRRKHK 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAI--KKIDKVRIAREAAHHKNRMRPNKLR 413
           K  +++     +++  R  +F + +T  +L  I  K+  K  + R+A   +      + +
Sbjct: 61  KGQSEEVA---KKRTRRAVKFQRAITGASLAEIMAKRNQKPEV-RKAQREQAIRAAKEAK 116

Query: 414 KQKEAARELEQGIHLVKAPSVLQQDPSLTLPIKV 515
           K K+AA+  +      KA +   Q P +  P+K+
Sbjct: 117 KAKQAAK--KPAAPSAKASTKTAQKPKIAKPMKI 148



>gb:AF298827_1784194 Prunus avium 60S ribosomal protein L24 (RL24)
           mRNA, complete cds.
          Length = 186

 Score = 86.3 bits (212), Expect = 5e-16
 Identities = 45/131 (34%), Positives = 78/131 (59%), Gaps = 5/131 (3%)
 Frame = +3

Query: 57  IMRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLH 236
           +++ E C F  + IYPG GI+F+R+D+++F F  SKC + F  +  P K+ WT  YR+ H
Sbjct: 2   VLKTELCRFSGAKIYPGKGIRFIRSDSQVFLFANSKCKRYFHNRLKPSKLTWTAMYRKQH 61

Query: 237 GKDMTQDATFEFERKRNRPERFDKNVTENTLKAIKK--IDKVRI---AREAAHHKNRMRP 401
            KD+ Q+A    +R+R   + + +++   TL+ I+K   +K  +   AREAA  + + R 
Sbjct: 62  KKDIAQEAV--KKRRRTTKKPYSRSIVGATLEVIQKRRTEKPEVRDAAREAALREIKERI 119

Query: 402 NKLRKQKEAAR 434
            K + +K+A +
Sbjct: 120 KKTKDEKKAKK 130



>sp|P38666|RL24_ARATH 60S ribosomal protein L24.>pir|T47559|T47559
           60S ribosomal protein-like - Arabidopsis
           thaliana>gb:ATF8J2_1551209 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F8J2.>gb:AY058129_1564267
           Arabidopsis thaliana AT3g53020/F8J2_190 mRNA, complete
           cds.>gb:AY093180_1575134 Arabidopsis thaliana 60S
           ribosomal protein-like (At3g53020) mRNA, complete
           cds.>gb:BT006545_1639432 Arabidopsis thaliana At3g53020
           gene, complete cds.
          Length = 163

 Score = 86.3 bits (212), Expect = 5e-16
 Identities = 46/131 (35%), Positives = 74/131 (56%), Gaps = 5/131 (3%)
 Frame = +3

Query: 57  IMRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLH 236
           +++ E C F    IYPG GI+F+R+D+++F F  SKC + F  K  P K+ WT  YR+ H
Sbjct: 2   VLKTELCRFSGQKIYPGRGIRFIRSDSQVFLFLNSKCKRYFHNKLKPSKLAWTAMYRKQH 61

Query: 237 GKDMTQDATFEFERKRNRPERFDKNVTENTLKAI--KKIDKVRI---AREAAHHKNRMRP 401
            KD  Q+A     R   +P  + +++   TL+ I  K+ +K  +   AREAA  + + R 
Sbjct: 62  KKDAAQEAVKRRRRATKKP--YSRSIVGATLEVIQKKRAEKPEVRDAAREAALREIKERI 119

Query: 402 NKLRKQKEAAR 434
            K + +K+A +
Sbjct: 120 KKTKDEKKAKK 130



>gb:BC002110_2088875 Mus musculus ribosomal protein L24, mRNA (cDNA
           clone IMAGE:3488279), partial cds.
          Length = 168

 Score = 85.9 bits (211), Expect = 7e-16
 Identities = 51/155 (32%), Positives = 82/155 (52%), Gaps = 3/155 (1%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++E C F    IYPGHG ++ R D K+F+F  +KC   F  KRNPR++ WT  YRR H 
Sbjct: 12  MKVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHK 71

Query: 240 KDMTQDATFEFERKR-NRPERFDKNVTENTLKAI--KKIDKVRIAREAAHHKNRMRPNKL 410
           K  ++    E ++KR  R  +F + +T  +L  I  K+  K  + R+A   +      + 
Sbjct: 72  KGQSE----EIQKKRTRRAVKFQRAITGASLADIMAKRNQKPEV-RKAQREQAIRAAKEA 126

Query: 411 RKQKEAARELEQGIHLVKAPSVLQQDPSLTLPIKV 515
           +K K+A++  +  +   KAP+       +  P+KV
Sbjct: 127 KKAKQASK--KTAMAAAKAPTKAAPKQKIVKPVKV 159



>gb:AB099007_1410330 Bos taurus mRNA for similar to ribosomal
           protein L30, partial cds, clone: ORCS11900.
          Length = 157

 Score = 85.9 bits (211), Expect = 7e-16
 Identities = 51/155 (32%), Positives = 82/155 (52%), Gaps = 3/155 (1%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++E C F    IYPGHG ++ R D K+F+F  +KC   F  KRNPR++ WT  YRR H 
Sbjct: 1   MKVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHK 60

Query: 240 KDMTQDATFEFERKR-NRPERFDKNVTENTLKAI--KKIDKVRIAREAAHHKNRMRPNKL 410
           K  ++    E ++KR  R  +F + +T  +L  I  K+  K  + R+A   +      + 
Sbjct: 61  KGQSE----EIQKKRTRRAVKFQRAITGASLADIMAKRNQKPEV-RKAQREQAIRAAKEA 115

Query: 411 RKQKEAARELEQGIHLVKAPSVLQQDPSLTLPIKV 515
           +K K+A++  +  +   KAP+       +  P+KV
Sbjct: 116 KKAKQASK--KTAMAAAKAPTKAAPKQKIVKPVKV 148



>sp|Q862I1|RL24_BOVIN 60S ribosomal protein L24
           (L30).>sp|P83731|RL24_HUMAN 60S ribosomal protein L24
           (L30).>sp|P61122|RL24_MACFA 60S ribosomal protein L24
           (L30).>sp|Q8BP67|RL24_MOUSE 60S ribosomal protein L24
           (L30).>sp|P83732|RL24_RAT 60S ribosomal protein L24
           (L30).>pir|JC2444|JC2444 ribosomal protein L24,
           cytosolic [validated] - rat>pir|JN0549|JN0549 ribosomal
           protein L24 - human>gb:AK018731_1159721 Mus musculus
           adult male kidney cDNA, RIKEN full-length enriched
           library, clone:0610008L05 product:ribosomal protein L24,
           full insert sequence.>gb:AF063243_1413378 Bos taurus
           ribosomal protein L30 mRNA, complete
           cds.>gb:AY700577_1432955 Felis catus ribosomal protein
           L30 mRNA, complete cds.>gb:AB061828_1868804 Homo sapiens
           RPL24 gene for ribosomal protein L24, complete cds and
           sequence.>gb:AB093678_1872244 Macaca fascicularis RPL24
           mRNA for ribosomal protein L24, complete cds,
           clone:QccE-19346.>gb:BC000690_1966946 Homo sapiens
           ribosomal protein L24, mRNA (cDNA clone MGC:2240
           IMAGE:3349215), complete cds.>gb:BC070193_1988492 Homo
           sapiens ribosomal protein L24, mRNA (cDNA clone
           MGC:88174 IMAGE:6733162), complete
           cds.>gb:CR456729_1992936 Homo sapiens full open reading
           frame cDNA clone RZPDo834E036D for gene RPL24, ribosomal
           protein L24; complete cds, incl.
           stopcodon.>gb:HUMRPL30A_2036348 Homo sapiens ribosomal
           protein L30 mRNA, complete cds.>gb:BC053377_2101469 Mus
           musculus ribosomal protein L24, mRNA (cDNA clone
           MGC:62664 IMAGE:4216355), complete
           cds.>gb:BC058114_2103044 Mus musculus ribosomal protein
           L24, mRNA (cDNA clone MGC:69589 IMAGE:6817726), complete
           cds.>gb:BC058473_2103255 Rattus norvegicus ribosomal
           protein L24, mRNA (cDNA clone MGC:72831 IMAGE:6918141),
           complete cds.>gb:RNRPL24_2136367 R.norvegicus (Sprague
           Dawley) mRNA for ribosomal protein L24.
          Length = 157

 Score = 85.9 bits (211), Expect = 7e-16
 Identities = 51/155 (32%), Positives = 82/155 (52%), Gaps = 3/155 (1%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++E C F    IYPGHG ++ R D K+F+F  +KC   F  KRNPR++ WT  YRR H 
Sbjct: 1   MKVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHK 60

Query: 240 KDMTQDATFEFERKR-NRPERFDKNVTENTLKAI--KKIDKVRIAREAAHHKNRMRPNKL 410
           K  ++    E ++KR  R  +F + +T  +L  I  K+  K  + R+A   +      + 
Sbjct: 61  KGQSE----EIQKKRTRRAVKFQRAITGASLADIMAKRNQKPEV-RKAQREQAIRAAKEA 115

Query: 411 RKQKEAARELEQGIHLVKAPSVLQQDPSLTLPIKV 515
           +K K+A++  +  +   KAP+       +  P+KV
Sbjct: 116 KKAKQASK--KTAMAAAKAPTKAAPKQKIVKPVKV 148



>gb:AC006282_1533948 Arabidopsis thaliana chromosome 2 clone F13K3
           map g6825, complete sequence.>gb:AC006919_1534729
           Arabidopsis thaliana chromosome 2 clone F1O11 map g6825,
           complete sequence.>gb:ATH293729_1552335 Arabidopsis
           thaliana partial mRNA for 60S ribosomal protein L24
           (RL24 gene).>gb:AY058086_1564225 Arabidopsis thaliana
           At2g36620/F1O11.25 mRNA, complete
           cds.>gb:AY072350_1567167 Arabidopsis thaliana 60S
           ribosomal protein L24 (At2g36620) mRNA, complete
           cds.>gb:AY085323_1570395 Arabidopsis thaliana clone
           14564 mRNA, complete sequence.>gb:AY114728_1578770
           Arabidopsis thaliana 60S ribosomal protein L24
           (At2g36620) mRNA, complete cds.
          Length = 164

 Score = 85.5 bits (210), Expect = 9e-16
 Identities = 46/131 (35%), Positives = 74/131 (56%), Gaps = 5/131 (3%)
 Frame = +3

Query: 57  IMRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLH 236
           +++ E C F    IYPG GI+F+R+D+++F F  SKC + F  K  P K+ WT  YR+ H
Sbjct: 2   VLKTELCRFSGQKIYPGRGIRFIRSDSQVFLFLNSKCKRYFHNKLKPSKLCWTAMYRKQH 61

Query: 237 GKDMTQDATFEFERKRNRPERFDKNVTENTLKAI--KKIDKVRI---AREAAHHKNRMRP 401
            KD  Q+A     R   +P  + +++   TL+ I  K+ +K  +   AREAA  + + R 
Sbjct: 62  KKDAAQEAVKRRRRATKKP--YSRSIVGATLEVIQKKRAEKPEVRDAAREAALREIKERI 119

Query: 402 NKLRKQKEAAR 434
            K + +K+A +
Sbjct: 120 KKTKDEKKAKK 130



>gb:AF401579_2492006 Ictalurus punctatus ribosomal protein L24 mRNA,
           complete cds.
          Length = 157

 Score = 85.1 bits (209), Expect = 1e-15
 Identities = 49/154 (31%), Positives = 80/154 (51%), Gaps = 2/154 (1%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++E C F    IYPGHG  + R D K+F+F  +KC   F  KRNPR++ WT  YRR H 
Sbjct: 1   MKVELCSFSGYKIYPGHGPVYARIDGKVFQFLNAKCESAFLTKRNPRQINWTVLYRRKHK 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAI--KKIDKVRIAREAAHHKNRMRPNKLR 413
           K  +++ T   +++  R  +F + +T  +L  I  K+  K  + R+A   +      + +
Sbjct: 61  KGQSEEVT---KKRTRRAVKFQRAITGASLAEILAKRNQKPEV-RKAQREQAIRAAKEAK 116

Query: 414 KQKEAARELEQGIHLVKAPSVLQQDPSLTLPIKV 515
           K K+A +++       KAP+       +  P+KV
Sbjct: 117 KAKQATKKV--STQSTKAPAKAAPKQKIAKPMKV 148



>gb:AB099001_1410324 Bos taurus mRNA for similar to ribosomal
           protein L30, partial cds, clone: ORCS11820.
          Length = 156

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 50/154 (32%), Positives = 81/154 (52%), Gaps = 3/154 (1%)
 Frame = +3

Query: 63  RLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHGK 242
           ++E C F    IYPGHG ++ R D K+F+F  +KC   F  KRNPR++ WT  YRR H K
Sbjct: 1   KVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHKK 60

Query: 243 DMTQDATFEFERKR-NRPERFDKNVTENTLKAI--KKIDKVRIAREAAHHKNRMRPNKLR 413
             ++    E ++KR  R  +F + +T  +L  I  K+  K  + R+A   +      + +
Sbjct: 61  GQSE----EIQKKRTRRAVKFQRAITGASLADIMAKRNQKPEV-RKAQREQAIRAAKEAK 115

Query: 414 KQKEAARELEQGIHLVKAPSVLQQDPSLTLPIKV 515
           K K+A++  +  +   KAP+       +  P+KV
Sbjct: 116 KAKQASK--KTAMAAAKAPTKAAPKQKIVKPVKV 147



>sp|O65743|RL24_CICAR 60S ribosomal protein
           L24.>gb:CAR225027_1645158 Cicer arietinum mRNA for
           ribosomal protein L24.
          Length = 164

 Score = 84.0 bits (206), Expect = 3e-15
 Identities = 44/131 (33%), Positives = 75/131 (57%), Gaps = 5/131 (3%)
 Frame = +3

Query: 57  IMRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLH 236
           +++ E C F  + IYPG GI+F+R D+++F F  SKC + F  +  P K+ WT  +R+ H
Sbjct: 2   VLKTELCRFSGAKIYPGRGIRFIRGDSQVFLFVNSKCKRYFHNRLKPSKLTWTAMFRKQH 61

Query: 237 GKDMTQDATFEFERKRNRPERFDKNVTENTLKAI--KKIDKVRI---AREAAHHKNRMRP 401
            KD  Q+A  +  R   +P  + +++   TL+ I  K+ +K  +   AREAA  + + R 
Sbjct: 62  KKDAAQEAVKKRRRATKKP--YSRSIVGATLEVIQKKRTEKPEVRDAAREAALREIKERI 119

Query: 402 NKLRKQKEAAR 434
            K + +K+A +
Sbjct: 120 KKTKDEKKAKK 130



>gb:BC078474_2561015 Xenopus laevis MGC85232 protein, mRNA (cDNA
           clone MGC:85232 IMAGE:6872633), complete cds.
          Length = 139

 Score = 83.2 bits (204), Expect = 5e-15
 Identities = 50/143 (34%), Positives = 77/143 (53%), Gaps = 3/143 (2%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++E C F    IYPGHG ++ R D K+F+F  +KC   F  KRNPR++ WT  YRR H 
Sbjct: 1   MKVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHK 60

Query: 240 KDMTQDATFEFERKR-NRPERFDKNVTENTLKAI--KKIDKVRIAREAAHHKNRMRPNKL 410
           K  ++    E ++KR  R  +F + +T  +L  I  K+  K  + R+A   +      ++
Sbjct: 61  KGQSE----EIQKKRTRRAVKFQRAITGASLAEIMAKRNQKPEV-RKAQREQAIRAAKEV 115

Query: 411 RKQKEAARELEQGIHLVKAPSVL 479
           +K K+A ++        KAPS L
Sbjct: 116 KKAKQATKKAAP----AKAPSSL 134



>gb:AB099003_1410326 Bos taurus mRNA for similar to ribosomal
           protein L30, partial cds, clone: ORCS11869.
          Length = 156

 Score = 83.2 bits (204), Expect = 5e-15
 Identities = 50/153 (32%), Positives = 80/153 (52%), Gaps = 3/153 (1%)
 Frame = +3

Query: 66  LEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHGKD 245
           +E C F    IYPGHG ++ R D K+F+F  +KC   F  KRNPR++ WT  YRR H K 
Sbjct: 2   VELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHKKG 61

Query: 246 MTQDATFEFERKR-NRPERFDKNVTENTLKAI--KKIDKVRIAREAAHHKNRMRPNKLRK 416
            ++    E ++KR  R  +F + +T  +L  I  K+  K  + R+A   +      + +K
Sbjct: 62  QSE----EIQKKRTRRAVKFQRAITGASLADIMAKRNQKPEV-RKAQREQAIRAAKEAKK 116

Query: 417 QKEAARELEQGIHLVKAPSVLQQDPSLTLPIKV 515
            K+A++  +  +   KAP+       +  P+KV
Sbjct: 117 AKQASK--KTAMAAAKAPTKAAPKQKIVKPVKV 147



>pir|F84782|F84782 60S ribosomal protein L24 [imported] -
           Arabidopsis thaliana
          Length = 177

 Score = 83.2 bits (204), Expect = 5e-15
 Identities = 46/127 (36%), Positives = 71/127 (55%), Gaps = 5/127 (3%)
 Frame = +3

Query: 69  EKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHGKDM 248
           E C F    IYPG GI+F+R+D+++F F  SKC + F  K  P K+ WT  YR+ H KD 
Sbjct: 19  ELCRFSGQKIYPGRGIRFIRSDSQVFLFLNSKCKRYFHNKLKPSKLCWTAMYRKQHKKDA 78

Query: 249 TQDATFEFERKRNRPERFDKNVTENTLKAI--KKIDKVRI---AREAAHHKNRMRPNKLR 413
            Q+A     R   +P  + +++   TL+ I  K+ +K  +   AREAA  + + R  K +
Sbjct: 79  AQEAVKRRRRATKKP--YSRSIVGATLEVIQKKRAEKPEVRDAAREAALREIKERIKKTK 136

Query: 414 KQKEAAR 434
            +K+A +
Sbjct: 137 DEKKAKK 143



>gb:AK077617_1171954 Mus musculus 8 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:5730471L21
           product:ribosomal protein L24, full insert sequence.
          Length = 157

 Score = 82.4 bits (202), Expect = 8e-15
 Identities = 50/155 (32%), Positives = 81/155 (52%), Gaps = 3/155 (1%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++E C F    I PGHG ++ R D K+F+F  +KC   F  KRNPR++ WT  YRR H 
Sbjct: 1   MKVELCSFSGYKINPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHK 60

Query: 240 KDMTQDATFEFERKR-NRPERFDKNVTENTLKAI--KKIDKVRIAREAAHHKNRMRPNKL 410
           K  ++    E ++KR  R  +F + +T  +L  I  K+  K  + R+A   +      + 
Sbjct: 61  KGQSE----EIQKKRTRRAVKFQRAITGASLADIMAKRNQKPEV-RKAQREQAIRAAKEA 115

Query: 411 RKQKEAARELEQGIHLVKAPSVLQQDPSLTLPIKV 515
           +K K+A++  +  +   KAP+       +  P+KV
Sbjct: 116 KKAKQASK--KTAMAAAKAPTKAAPKQKIVKPVKV 148



>sp|P50888|RL24_HORVU 60S ribosomal protein L24.>pir|T06178|T06178
           ribosomal protein L24 - barley>gb:HVRL24E_1682518
           H.vulgare mRNA for L24 ribosomal protein.
          Length = 162

 Score = 82.4 bits (202), Expect = 8e-15
 Identities = 44/131 (33%), Positives = 76/131 (58%), Gaps = 5/131 (3%)
 Frame = +3

Query: 57  IMRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLH 236
           +++ E C F    IYPG GI+F+R+D+++F F  SKC + F  +  P K+ WT  YR+ H
Sbjct: 2   VLKTELCRFSGQKIYPGKGIRFIRSDSQVFLFANSKCKRYFHNRLKPAKLCWTAMYRKQH 61

Query: 237 GKDMTQDATFEFERKRNRPERFDKNVTENTLKAI--KKIDKVRI---AREAAHHKNRMRP 401
            KD+  +A    +R+R   + + +++   TL+ I  K+ +K  +   AREAA  + + R 
Sbjct: 62  KKDIHAEAA--KKRRRTTKKPYSRSIVGATLEVIQKKRAEKPEVRDAAREAALREIKERI 119

Query: 402 NKLRKQKEAAR 434
            K + +K+A +
Sbjct: 120 KKTKDEKKAKK 130



>gb:AB098812_1410181 Bos taurus mRNA for similar to ribosomal
           protein L30, partial cds, clone: ORCS13182.
          Length = 152

 Score = 82.0 bits (201), Expect = 1e-14
 Identities = 49/150 (32%), Positives = 78/150 (52%), Gaps = 3/150 (2%)
 Frame = +3

Query: 75  CWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHGKDMTQ 254
           C F    IYPGHG ++ R D K+F+F  +KC   F  KRNPR++ WT  YRR H K  ++
Sbjct: 1   CSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHXKGQSE 60

Query: 255 DATFEFERKR-NRPERFDKNVTENTLKAI--KKIDKVRIAREAAHHKNRMRPNKLRKQKE 425
               E ++KR  R  +F + +T  +L  I  K+  K  + R+A   +      + +K K+
Sbjct: 61  ----EIQKKRTRRAVKFQRAITGASLADIMAKRNQKPEV-RKAQREQAIRAAKEAKKAKQ 115

Query: 426 AARELEQGIHLVKAPSVLQQDPSLTLPIKV 515
           A++  +  +   KAP+       +  P+KV
Sbjct: 116 ASK--KTAMAAAKAPTKAAPKQKIVKPVKV 143



>gb:AP004331_1840321 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:OSJNBa0085D07.
          Length = 162

 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 44/131 (33%), Positives = 75/131 (57%), Gaps = 5/131 (3%)
 Frame = +3

Query: 57  IMRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLH 236
           +++ E C F    IYPG GI+F+R D+++F F  SKC + F  +  P K+ WT  YR+ H
Sbjct: 2   VLKTELCRFSGQKIYPGKGIRFIRADSQVFLFANSKCKRYFHNRLKPAKLTWTAMYRKQH 61

Query: 237 GKDMTQDATFEFERKRNRPERFDKNVTENTLKAI--KKIDKVRI---AREAAHHKNRMRP 401
            KD+  +A    +R+R   + + +++   TL+ I  K+ +K  +   AREAA  + + R 
Sbjct: 62  KKDIHAEAV--KKRRRTTKKPYSRSIVGATLEVIQKKRSEKPEVRDAAREAALREIKERI 119

Query: 402 NKLRKQKEAAR 434
            K + +K+A +
Sbjct: 120 KKTKDEKKAKK 130



>sp|P24000|R24B_YEAST 60S ribosomal protein L24-B (L30B) (RP29)
           (YL21).>pir|A35925|R6BYY0 ribosomal protein L24.e.B,
           cytosolic - yeast (Saccharomyces
           cerevisiae)>gb:AY557819_1614046 Saccharomyces cerevisiae
           clone FLH003039.01X YGR148C gene, complete
           cds.>gb:SCCVIIRA_1707394 S.cerevisiae chromosome VII
           27kbp right arm segment.>gb:SCYGR148C_1712379
           S.cerevisiae chromosome VII reading frame ORF
           YGR148c.>gb:YSCL30RP_1729435 S.cerevisiae ribosomal
           protein L30 (RPL30B) gene, exon 1.
          Length = 155

 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 46/130 (35%), Positives = 76/130 (58%), Gaps = 1/130 (0%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++E   F  + IYPG G  FVR D+KIFRF  SK    FK ++NPR++ WT  +R+ H 
Sbjct: 1   MKVEVDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIAWTVLFRKHHK 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K +T++   +  RK  + +R    +T  +L  IK+   ++     A+ + +++ NK +K+
Sbjct: 61  KGITEEVAKKRSRKTVKAQR---PITGASLDLIKERRSLKPEVRKANREEKLKANKEKKR 117

Query: 420 KE-AARELEQ 446
            E AAR+ E+
Sbjct: 118 AEKAARKAEK 127



>sp|P04449|R24A_YEAST 60S ribosomal protein L24-A (L30A) (RP29)
           (YL21).>pir|A02783|R6BYT9 ribosomal protein L24.e.A,
           cytosolic - yeast (Saccharomyces
           cerevisiae)>gb:SCYGL031C_1711948 S.cerevisiae chromosome
           VII reading frame ORF YGL031c.>gb:YSCRPL30A_1730503
           Yeast (S. cerevisiae) ribosomal protein L30A complete
           cds.
          Length = 155

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 46/130 (35%), Positives = 76/130 (58%), Gaps = 1/130 (0%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++E   F  + IYPG G  FVR D+KIFRF  SK    FK ++NPR++ WT  +R+ H 
Sbjct: 1   MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIAWTVLFRKHHK 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K +T++   +  RK  + +R    +T  +L  IK+   ++     A+ + +++ NK +K+
Sbjct: 61  KGITEEVAKKRSRKTVKAQR---PITGASLDLIKERRSLKPEVRKANREEKLKANKEKKK 117

Query: 420 KE-AARELEQ 446
            E AAR+ E+
Sbjct: 118 AEKAARKAEK 127



>gb:CR382131_1664433 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 155

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 47/125 (37%), Positives = 65/125 (52%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++E   F  + IYPG G  FVR D+KIFRF  SK    FK ++NPR++ WT  YRR H 
Sbjct: 1   MKIELDSFSGNKIYPGRGTLFVRGDSKIFRFYSSKTASLFKQRKNPRRIAWTVLYRRKHK 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K +T++ + +  RK  +  R    +   +L  IK+    R     A         K RK+
Sbjct: 61  KGITEEVSKKRSRKSVKAVR---GIVGASLDVIKEKRNARPETRNATRAKHAEAAKERKE 117

Query: 420 KEAAR 434
           KEA R
Sbjct: 118 KEAER 122



>gb:AC093952_1736173 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1004_E02, complete sequence.
          Length = 161

 Score = 80.5 bits (197), Expect = 3e-14
 Identities = 43/131 (32%), Positives = 75/131 (57%), Gaps = 5/131 (3%)
 Frame = +3

Query: 57  IMRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLH 236
           +++ E C F    IYPG GI+F+R D+++F F  SKC + F  +  P K+ WT  YR+ H
Sbjct: 2   VLKTELCRFSGQKIYPGKGIRFIRADSQVFLFANSKCKRYFHNRLKPAKLTWTAMYRKQH 61

Query: 237 GKDMTQDATFEFERKRNRPERFDKNVTENTLKAI--KKIDKVRI---AREAAHHKNRMRP 401
            KD+  +A    +R+R   + + +++   +L+ I  K+ +K  +   AREAA  + + R 
Sbjct: 62  KKDIHAEAV--KKRRRTTKKPYSRSIVGASLEVIQKKRAEKPEVRDAAREAALREIKERI 119

Query: 402 NKLRKQKEAAR 434
            K + +K+A +
Sbjct: 120 KKTKDEKKAKK 130



>gb:AP003740_1832710 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC
           clone:OJ1118_B03.>gb:AP004572_1841792 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0668C05.
          Length = 160

 Score = 80.1 bits (196), Expect = 4e-14
 Identities = 44/129 (34%), Positives = 74/129 (57%), Gaps = 5/129 (3%)
 Frame = +3

Query: 63  RLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHGK 242
           R E C F  + IYPG GI+F+R D+++F F  SKC + F  +  P K+ WT  YR+ H K
Sbjct: 3   RTELCRFSGAKIYPGKGIRFIRADSQVFLFSNSKCKRYFHNRLKPAKLTWTAMYRKQHKK 62

Query: 243 DMTQDATFEFERKRNRPERFDKNVTENTLKAI--KKIDKVRI---AREAAHHKNRMRPNK 407
           D+  +A    +R+R   + + +++   TL+ I  K+ +K  +   ARE+A  + + R  K
Sbjct: 63  DIHAEAV--KKRRRTTKKPYSRSIVGATLEVIQKKRAEKPEVRDAARESALREIKERIKK 120

Query: 408 LRKQKEAAR 434
            + +K+A +
Sbjct: 121 TKDEKKAKK 129



>gb:AY826149_1180109 Aedes albopictus clone AL_305 ribosomal protein
           L24 mRNA, complete cds.
          Length = 153

 Score = 79.7 bits (195), Expect = 5e-14
 Identities = 48/142 (33%), Positives = 72/142 (50%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++  C F    IYP  G   V+ D K F F   KC ++F MKRNPRKVKWT  YRR H 
Sbjct: 1   MKIGLCAFSGFKIYPASGKTLVKADGKTFTFINKKCERSFLMKRNPRKVKWTVLYRRKHK 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K M ++A    +++  R  +F + +   +L  I      R  +       R +  K+ K+
Sbjct: 61  KGMVEEAA---KKRTRRTMKFQRAIVGASLTDIM---AKRNMKPEVRKAQRDQAIKVAKE 114

Query: 420 KEAARELEQGIHLVKAPSVLQQ 485
            + A++ E+ +   KAP+  QQ
Sbjct: 115 AKKAKQAEKKV--TKAPASKQQ 134



>gb:AX887970_1483423 Sequence 3833 from Patent EP1033401.
          Length = 121

 Score = 79.3 bits (194), Expect = 7e-14
 Identities = 46/136 (33%), Positives = 66/136 (48%), Gaps = 1/136 (0%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++E C F    IYPGHG ++ R D K+F+F  +KC   F  KRNPR++ WT  YRR H 
Sbjct: 1   MKVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHK 60

Query: 240 KDMTQDATFEFERKR-NRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRK 416
           K  ++    E ++KR  R  +F + +T  +L  I               K   +P   + 
Sbjct: 61  KGQSE----EIQKKRTRRAVKFQRAITGASLADIMA-------------KRNQKPEVRKA 103

Query: 417 QKEAARELEQGIHLVK 464
           Q+E A       HL K
Sbjct: 104 QREQAIRXLXRXHLSK 119



>gb:AF548322_1281125 Branchiostoma belcheri ribosomal protein L24
           mRNA, complete cds.
          Length = 154

 Score = 79.0 bits (193), Expect = 9e-14
 Identities = 51/165 (30%), Positives = 83/165 (50%), Gaps = 2/165 (1%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++E C +    IYPGHG ++ R D +++ F  +KC  +F MKRNPR++ WT  YRR H 
Sbjct: 1   MKIELCLYSGYKIYPGHGKRYARTDGRVYTFLNAKCEASFLMKRNPREITWTVLYRRKHK 60

Query: 240 KDMTQDATFEFERKRN-RPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRK 416
           K   +    E ++KR+ R  +F + +T  +L    +I   R  +       R +  K  K
Sbjct: 61  KGQQE----EIQKKRSRRTAKFQRAITGASL---TEIMAKRNQKPEVRKAQREQAVKAAK 113

Query: 417 QKEAARELEQGIHLVKAPSVLQQD-PSLTLPIKVKVSQQQSEEKR 548
           +K+ A ++ +     KAP+  +   P    P  VK +  +   KR
Sbjct: 114 EKKKADQVGKR----KAPAKARATAPKTKAPKTVKAAAPRVGGKR 154



>gb:AL158815_1921485 Human DNA sequence from clone RP1-125M3 on
           chromosome 6 Contains a gene for 60S ribosomal protein,
           the GNMT gene for glycine N-methyltransferase, the PEX6
           gene for peroxisomal biogenesis factor 6 and CpG
           islands, complete sequence.
          Length = 128

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 44/129 (34%), Positives = 71/129 (55%), Gaps = 3/129 (2%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++E C F    IYPGHG ++ R D K+F+F  +KC   F  KRNPR++ WT  YRR H 
Sbjct: 1   MKVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCELAFLSKRNPRQINWTVLYRRKHK 60

Query: 240 KDMTQDATFEFERKR-NRPERFDKNVTENTLKAI--KKIDKVRIAREAAHHKNRMRPNKL 410
           K  ++    E ++KR  R  +F + +T  +L  I  K+  K  + R+    +      + 
Sbjct: 61  KGQSE----EIQKKRTRRAVKFQRAITGASLADITAKRNQKPEV-RKTRREQAIRAAKEA 115

Query: 411 RKQKEAARE 437
           +K K+A+++
Sbjct: 116 KKAKQASKK 124



>gb:CR380947_1649052 Candida glabrata strain CBS138 chromosome A
           complete sequence.
          Length = 155

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 46/130 (35%), Positives = 74/130 (56%), Gaps = 1/130 (0%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++E   F  + IYPG G  FVR D+KIFRF  SK    FK ++NPR+V WT  YRR H 
Sbjct: 1   MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRVAWTVLYRRHHK 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K +T++   +  RK  + +R    +   +L+ IK+   ++     A   ++ + +K +K+
Sbjct: 61  KGITEEVAKKRSRKTVKAQR---AIVGASLELIKERRSLKPEVRKAKRDDKAKADKEKKK 117

Query: 420 KE-AARELEQ 446
            + AAR+ E+
Sbjct: 118 ADKAARKAEK 127



>pir|T39071|T39071 60S ribosomal protein L24 - fission yeast
           (Schizosaccharomyces pombe)>gb:SPAC6G9_1718310 S.pombe
           chromosome I cosmid c6G9.
          Length = 149

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 44/129 (34%), Positives = 66/129 (51%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++E C F  S +YPG G  FVR D K+FRF   K    F  ++NPR++ WT  YRR+H 
Sbjct: 1   MKVEVCSFSGSKVYPGAGRLFVRGDNKVFRFVNKKSESLFLQRKNPRRLSWTVLYRRMHK 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K ++++     +++  R  +  + +    L  IK   + R  R       R    K RK 
Sbjct: 61  KGISEE---HAKKRTRRTVKHQRGIVGANLDVIK---EKRNQRPEVRAAARAAALKQRKD 114

Query: 420 KEAARELEQ 446
           K+AA E E+
Sbjct: 115 KKAASESEK 123



>gb:CGI563459_1372110 Crassostrea gigas partial mRNA for ribosomal
           protein L24 (rpl24 gene).
          Length = 158

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 40/129 (31%), Positives = 69/129 (53%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++E C +    IYPGHG + V+ D ++F+F   KC  + KMKRNPR++ WT  YRR H 
Sbjct: 3   MKIELCSYSGYKIYPGHGKRIVKVDGRVFQFLNGKCEASHKMKRNPREINWTVLYRRKHK 62

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K   ++     +++  R  +F + VT  +L  I+     +     A  +  +R  K +++
Sbjct: 63  KGNLEEIA---KKRTRRTTKFTRAVTGLSLAEIQAKRNQKPEVRKAQREQAIRAAKEKQK 119

Query: 420 KEAARELEQ 446
            + A + +Q
Sbjct: 120 AKDALKKQQ 128



>pir|T41324|T41324 60s ribosomal protein L24 - fission yeast
           (Schizosaccharomyces pombe)>gb:AB032714_1518721
           Schizosaccharomyces pombe rpl24 mRNA, complete
           cds.>gb:SPCC330_1721283 S.pombe chromosome III cosmid
           c330.
          Length = 149

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 44/129 (34%), Positives = 65/129 (50%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++E C F  S +YPG G  FVR D K+FRF   K    F  ++NPR++ WT  YRR+H 
Sbjct: 1   MKVEVCSFSGSKVYPGAGRLFVRGDNKVFRFVNKKSESLFLQRKNPRRLSWTVLYRRMHK 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K ++++     +++  R  +  + +    L  IK   + R  R       R    K RK 
Sbjct: 61  KGISEE---HAKKRTRRTVKHQRGIVGANLDVIK---EKRNQRPEVRAAARAAALKQRKD 114

Query: 420 KEAARELEQ 446
           K AA E E+
Sbjct: 115 KRAASESEK 123



>gb:AE017347_1757932 Cryptococcus neoformans var. neoformans JEC21
           chromosome 7, complete sequence.
          Length = 150

 Score = 76.3 bits (186), Expect = 6e-13
 Identities = 42/141 (29%), Positives = 70/141 (49%), Gaps = 2/141 (1%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR+++C F    +YP  G  +VR D+K FRF  +K    F  ++NPRK+ WT+ YRR+H 
Sbjct: 1   MRVDRCDFTGYKVYPSRGKVYVRGDSKTFRFLSAKAESLFLQRKNPRKIAWTQVYRRMHK 60

Query: 240 KDMTQDATFEFERKRNRPER--FDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLR 413
           K +T++   +  RK  + +R     ++     K   K +    AR+AA  K +       
Sbjct: 61  KGITEEVAKKRSRKNVKVQRGIVGADLASILAKRTAKPEVRAAARQAAITKAKTEKRDKE 120

Query: 414 KQKEAARELEQGIHLVKAPSV 476
            +K A +  +  +  V   S+
Sbjct: 121 ARKAANKPAQANVPKVSKQSM 141



>gb:AE014134_1129045 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003640_1219152 Drosophila melanogaster
           chromosome 2L, section 49 of 83 of the complete
           sequence.>gb:AY071277_1295361 Drosophila melanogaster
           RE30690 full length cDNA.
          Length = 155

 Score = 75.9 bits (185), Expect = 7e-13
 Identities = 46/149 (30%), Positives = 73/149 (48%), Gaps = 7/149 (4%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++  C F    IYPGHG   V+ D K F F   KC +++ MKRNPRKV WT  YRR H 
Sbjct: 1   MKIGLCAFSGYKIYPGHGKTMVKIDGKSFTFLDKKCERSYLMKRNPRKVTWTVLYRRKHR 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAI-------KKIDKVRIAREAAHHKNRMR 398
           K + ++A+   +++  R ++F + +   +L  I        ++ K +  +     K + R
Sbjct: 61  KGIEEEAS---KKRTRRTQKFQRAIVGASLAEILAKRNMKPEVRKAQRDQAIKVAKEQKR 117

Query: 399 PNKLRKQKEAARELEQGIHLVKAPSVLQQ 485
             K  K+  A    ++     KA  V Q+
Sbjct: 118 AVKAAKKAAAPAPAKKSAPKQKAAKVTQK 146



>gb:CR382137_1670572 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 156

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 52/160 (32%), Positives = 84/160 (52%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++E   F  + IYPG G  FVR D+KIFRF  SK    F  ++NPR++ WT  YRR H 
Sbjct: 1   MKVELDSFSGTKIYPGRGTLFVRGDSKIFRFQSSKSASLFHQRKNPRRISWTVLYRRQHK 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K +++++    +R+  +  +  + +   +L+ IK+    R +++ +  K   R  KL K 
Sbjct: 61  KGISEESA---KRRTRKTVKNQRAIVGASLELIKE----RRSQKPSDRK-AARDVKLAKD 112

Query: 420 KEAARELEQGIHLVKAPSVLQQDPSLTLPIKVKVSQQQSE 539
           KEA +         KA    ++  S     + KVS+QQS+
Sbjct: 113 KEAKK-------ADKAARKAEKAKSAAAGAQSKVSKQQSK 145



>sp|P38665|RL24_KLULA 60S ribosomal protein L24
           (L30).>gb:CR382125_1657703 Kluyveromyces lactis strain
           NRRL Y-1140 chromosome E of strain NRRL Y-1140 of
           Kluyveromyces lactis.>gb:YSKRPL30A_1730986 Kluyveromyces
           lactis ribosomal protein L30 (RPL30) gene, complete cds.
          Length = 155

 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 47/131 (35%), Positives = 72/131 (54%), Gaps = 2/131 (1%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++E   F  + IYPG G  FVR D+KIFRF  SK    F  ++NPR++ WT  YRR H 
Sbjct: 1   MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQSSKSASLFHQRKNPRRIAWTVLYRRHHK 60

Query: 240 KDMTQDATFEFERKRNRPE-RFDKNVTENTLKAIKKIDKVR-IAREAAHHKNRMRPNKLR 413
           K +T+    E  RKR R   +  + V   +L+ IK+   ++   R+A   + +    + +
Sbjct: 61  KGITE----EVARKRTRKSVKAQRAVVGASLELIKERRSLKPEVRKAQRDEKKKADKEKK 116

Query: 414 KQKEAARELEQ 446
           K  +AAR+ E+
Sbjct: 117 KADKAARKSEK 127



>gb:AK019214_1159954 Mus musculus 11 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2700066B07
           product:ribosomal protein L24, full insert sequence.
          Length = 67

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 30/66 (45%), Positives = 42/66 (63%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++E C F    IYPGHG ++ R D K+F+F  +KC   F  KRNPR++ WT  YRR H 
Sbjct: 1   MKVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHK 60

Query: 240 KDMTQD 257
           K  +++
Sbjct: 61  KGQSEE 66



>gb:AE016819_1749312 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome VI, complete sequence.
          Length = 155

 Score = 73.2 bits (178), Expect = 5e-12
 Identities = 43/130 (33%), Positives = 72/130 (55%), Gaps = 1/130 (0%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++E   F  + IYPG G  FVR D+K+FRF  SK    F  ++NPR++ WT  YRR H 
Sbjct: 1   MKVEIDSFSGAKIYPGRGTLFVRGDSKVFRFHSSKSASLFHQRKNPRRIAWTVLYRRHHK 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K +T++   +  RK  + +R    V   +L+ IK+   ++     A    + + +K +K+
Sbjct: 61  KGITEEVAKKRSRKTVKAQR---AVVGASLELIKERRSLKPEIRKAKRDEKAKADKEKKK 117

Query: 420 KE-AARELEQ 446
            + AAR+ ++
Sbjct: 118 ADKAARKADK 127



>gb:AY307168_1317868 Schistosoma japonicum 60S ribosomal protein L24
           mRNA, complete cds.
          Length = 156

 Score = 73.2 bits (178), Expect = 5e-12
 Identities = 41/142 (28%), Positives = 66/142 (46%), Gaps = 19/142 (13%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M+LE C +    +YPGHG + +R D + F F   K  ++  +KRNPR++ WT  YRR + 
Sbjct: 1   MKLEVCSYSGFKVYPGHGKRVIRVDGRSFYFINKKSERSHYLKRNPREISWTVLYRRKYK 60

Query: 240 KDMTQDAT-------------------FEFERKRNRPERFDKNVTENTLKAIKKIDKVRI 362
           K M+++ T                    E   KRN+     K + +  ++A K+  K + 
Sbjct: 61  KGMSEEQTKNELSVLTKTARGIAGASLAEIMAKRNQKPEVRKAMRDQAIRAAKEKQKQKE 120

Query: 363 AREAAHHKNRMRPNKLRKQKEA 428
             + A    + +P    KQK A
Sbjct: 121 LEKKAKKVEKKKPTLAPKQKAA 142



>gb:AK028209_1160859 Mus musculus 11 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2700096N07
           product:ribosomal protein L24, full insert sequence.
          Length = 64

 Score = 72.4 bits (176), Expect = 8e-12
 Identities = 30/61 (49%), Positives = 39/61 (63%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++E C F    IYPGHG ++ R D K+F+F  +KC   F  KRNPR++ WT  YRR H 
Sbjct: 1   MKVELCSFSGYKIYPGHGRRYARTDGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHK 60

Query: 240 K 242
           K
Sbjct: 61  K 61



>gb:BX842637_1644129 Neurospora crassa DNA linkage group I cosmid
           contig 5C2.
          Length = 156

 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 44/154 (28%), Positives = 79/154 (51%), Gaps = 2/154 (1%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           MR     F    IYPG G  +VR D+KIFRF   K    F  ++NPR++ WT  YRR H 
Sbjct: 1   MRTYDDTFSGQRIYPGKGKLYVRGDSKIFRFQNGKSESLFLQRKNPRRIAWTVLYRRQHK 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K ++++     +++  R  +  + +   +L+ IK+   +R    +A     ++ +K +KQ
Sbjct: 61  KGISEEVA---KKRSRRTVKAQRAIVGASLEVIKERRSMRPEARSAARLAAIKESKAKKQ 117

Query: 420 K-EAARELEQGIHLVKAPS-VLQQDPSLTLPIKV 515
           + +AA++ E+  +     + V  +  +   P+KV
Sbjct: 118 ETQAAKKAEKAKNAANPKARVTSKQGAKGAPVKV 151



>gb:AY769294_1350445 Bombyx mori ribosomal protein L24 (RpL24) mRNA,
           complete cds.
          Length = 155

 Score = 67.8 bits (164), Expect = 2e-10
 Identities = 39/124 (31%), Positives = 58/124 (46%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++  C +    IYPGHG   V+ D K F F  SKC     M+RNPRKV WT  YRR   
Sbjct: 1   MKIGLCAYSGYKIYPGHGKTMVKVDGKTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFK 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K   ++   + +++  R ++F + +   +L  I               K  M+P   + Q
Sbjct: 61  KGQEEE---QAKKRTRRTQKFQRAIVGASLSDIMA-------------KRNMKPEVRKAQ 104

Query: 420 KEAA 431
           +E A
Sbjct: 105 REQA 108



>gb:AF400189_1268288 Spodoptera frugiperda ribosomal protein L24
           mRNA, complete cds.
          Length = 155

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 42/142 (29%), Positives = 65/142 (45%), Gaps = 4/142 (2%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++  C +    IYPGHG   V+ D K F F  SKC     M+RNPRKV WT  YRR   
Sbjct: 1   MKIGLCAYSGYKIYPGHGKTMVKVDGKTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFK 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K   ++ T   +++  R +++ + +   +L  I               K  M+P   + Q
Sbjct: 61  KGQEEEQT---KKRTRRTQKYQRAIVGASLSDIMA-------------KRNMKPEVRKAQ 104

Query: 420 KE----AARELEQGIHLVKAPS 473
           ++    AA+E ++     K  S
Sbjct: 105 RDQAIKAAKEQKKSTKAAKKAS 126



>sp|P61123|R24E_METMP 50S ribosomal protein L24e.>gb:BX957220_843892
           Methanococcus maripaludis S2 complete genome; segment
           2/5.
          Length = 62

 Score = 67.0 bits (162), Expect = 3e-10
 Identities = 27/59 (45%), Positives = 38/59 (64%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLH 236
           M  + C FC  TI PG G ++V+ D  +  FC SKC KNFK+ R  RK+KWT  ++R++
Sbjct: 1   MEWKTCSFCEGTIEPGCGKKYVKKDGSVMHFCSSKCEKNFKLGRVGRKLKWTNTFKRIN 59



>gb:AB180446_1202464 Plutella xylostella mRNA for Ribosomal protein
           L24, complete cds.
          Length = 155

 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 38/124 (30%), Positives = 58/124 (46%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHG 239
           M++  C +    IYPGHG   V+ D K F F  SKC     M+RNPRKV WT  YRR   
Sbjct: 1   MKIGLCAYSGYKIYPGHGKTMVKVDGKNFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFK 60

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQ 419
           K   ++   + +++  R +++ + +   +L  I               K  M+P   + Q
Sbjct: 61  KGQEEE---QAKKRTRRTQKYQRAIVGASLSDIMA-------------KRNMKPEVRKAQ 104

Query: 420 KEAA 431
           +E A
Sbjct: 105 REQA 108



>gb:AP006878_576461 Thermococcus kodakaraensis strain KOD1 DNA,
           complete genome.
          Length = 67

 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 28/55 (50%), Positives = 35/55 (63%)
 Frame = +3

Query: 63  RLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYR 227
           R   C +C     PG G  FVRND ++  FC SKC K + M RNPRK+KWTKA++
Sbjct: 3   RWNVCSYCGREFEPGTGKMFVRNDGRVLFFCSSKCEKYYFMGRNPRKLKWTKAFQ 57



>sp|O29492|R24E_ARCFU 50S ribosomal protein L24e.>pir|F69345|F69345
           LSU ribosomal protein L24E (rpl24E) homolog -
           Archaeoglobus fulgidus>gb:AE001051_31124 Archaeoglobus
           fulgidus DSM 4304 section 56 of 172 of the complete
           genome.>gb:AE000782_974656 Archaeoglobus fulgidus DSM
           4304 complete genome.
          Length = 58

 Score = 65.9 bits (159), Expect = 8e-10
 Identities = 30/58 (51%), Positives = 35/58 (60%), Gaps = 1/58 (1%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKN-FKMKRNPRKVKWTKAYRR 230
           M    C FC   I PG G  +VR D ++F FC  KC KN  K+KR PRK+KWTK Y R
Sbjct: 1   MEKRVCSFCGYDIEPGTGKMYVRRDGRVFYFCSGKCEKNMLKLKRKPRKLKWTKHYSR 58



>pir|T30926|T30926 hypothetical protein D1007.12 - Caenorhabditis
           elegans>gb:AF003151_1230913 Caenorhabditis elegans
           cosmid D1007, complete sequence.
          Length = 159

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 44/145 (30%), Positives = 67/145 (46%), Gaps = 22/145 (15%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYR---- 227
           M++E C +    I+PGHG + VR D K+  F   K  K  K++RNPR ++WT  YR    
Sbjct: 1   MKVETCVYSGYKIHPGHGKRLVRTDGKVQIFLSGKALKGAKLRRNPRDIRWTVLYRIKNK 60

Query: 228 -RLHGKD-MTQDATFEFER----------------KRNRPERFDKNVTENTLKAIKKIDK 353
              HG++ +T+  T +  +                KRN+ E F +   E   K  K  +K
Sbjct: 61  KGTHGQEQVTRKKTKKSVQVVNRAVAGLSLDAILAKRNQTEDFRRQQREQAAKIAKDANK 120

Query: 354 VRIAREAAHHKNRMRPNKLRKQKEA 428
              A +AA +K +       +QK A
Sbjct: 121 AVRAAKAAANKEKKASQPKTQQKTA 145



>sp|Q9V0W3|R24E_PYRAB 50S ribosomal protein L24e.>pir|E75109|E75109
           lsu ribosomal protein l24e (rpl24e) PAB8165 - Pyrococcus
           abyssi (strain Orsay)>gb:CNSPAX03_849431 Pyrococcus
           abyssi complete genome; segment 3/6.
          Length = 67

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 27/55 (49%), Positives = 34/55 (61%)
 Frame = +3

Query: 63  RLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYR 227
           R   C +C     PG G  FVRND ++  FC  KC + + M RNPRK+KWTKAY+
Sbjct: 3   RWNVCSYCGKPFEPGTGKMFVRNDGRVLFFCSRKCERYYFMGRNPRKLKWTKAYQ 57



>gb:AY829771_1180170 Lonomia obliqua ribosomal protein 14 mRNA,
           complete cds.
          Length = 148

 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 37/112 (33%), Positives = 53/112 (47%)
 Frame = +3

Query: 96  IYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHGKDMTQDATFEFE 275
           IYPGHG   V+ D K F F  SKC     M+RNPRKV WT  YRR   K   ++   + +
Sbjct: 6   IYPGHGKTMVKVDGKTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFKKGQEEE---QAK 62

Query: 276 RKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQKEAA 431
           ++  R ++F + +   +L  I               K  M+P   + Q+E A
Sbjct: 63  KRTRRTQKFQRAIVGASLSDIMA-------------KRNMKPEVRKAQREQA 101



>gb:AE017261_420299 Picrophilus torridus DSM 9790, complete genome.
          Length = 66

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 31/68 (45%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNF-KMKRNPRKVKWTKAYRRLH 236
           M +  C FC  +I P  G  +VR D  +  FC  KC +N  K+KR PRKVKWT  Y R+ 
Sbjct: 1   MDVRNCSFCGKSIEPASGFLYVRKDGSVLNFCSRKCKENMVKLKRVPRKVKWTNEYHRI- 59

Query: 237 GKDMTQDA 260
            K MT+ A
Sbjct: 60  -KAMTKKA 66



>sp|Q8U158|R24E_PYRFU 50S ribosomal protein L24e.>gb:AE010241_260936
           Pyrococcus furiosus DSM 3638, section 116 of 173 of the
           complete genome.>gb:AE009950_901717 Pyrococcus furiosus
           DSM 3638, complete genome.
          Length = 66

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 26/55 (47%), Positives = 34/55 (61%)
 Frame = +3

Query: 63  RLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYR 227
           R   C +C     PG G  +VRND ++  FC  KC + + M RNPRK+KWTKAY+
Sbjct: 3   RWNVCSYCGKPFEPGTGKMYVRNDGRVLFFCSRKCERYYFMGRNPRKLKWTKAYQ 57



>sp|P54064|R24E_METJA 50S ribosomal protein L24e.>pir|H64449|H64449
           ribosomal protein L24E - Methanococcus
           jannaschii>gb:U67562_207309 Methanocaldococcus
           jannaschii DSM 2661 section 104 of 150 of the complete
           genome.>gb:L77117_1100067 Methanocaldococcus jannaschii
           DSM 2661, complete genome.
          Length = 70

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 26/51 (50%), Positives = 32/51 (62%)
 Frame = +3

Query: 75  CWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYR 227
           C FC   I PG G   V  D  +  FC SKC K+++M RNPRK+KWTK Y+
Sbjct: 7   CSFCGYEIEPGKGKMVVEKDGTVLYFCSSKCEKSYRMGRNPRKLKWTKVYQ 57



>sp|P61124|R24E_PYRHO 50S ribosomal protein L24e.
          Length = 66

 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 25/51 (49%), Positives = 33/51 (64%)
 Frame = +3

Query: 75  CWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYR 227
           C +C     PG G  +VRND ++  FC  KC + + M RNPRK+KWTKAY+
Sbjct: 7   CSYCGKPFEPGTGKMYVRNDGRVLFFCSRKCERYYFMGRNPRKLKWTKAYQ 57



>gb:AB099064_1410387 Bos taurus mRNA for similar to ribosomal
           protein L30, partial cds, clone: ORCS13195.
          Length = 133

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 40/131 (30%), Positives = 67/131 (51%), Gaps = 3/131 (2%)
 Frame = +3

Query: 132 DAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHGKDMTQDATFEFERKR-NRPERFDK 308
           D K+F+F  +KC   F  KRNPR++ WT  YRR H K  ++    E ++KR  R  +F +
Sbjct: 1   DGKVFQFLNAKCESAFLSKRNPRQINWTVLYRRKHKKGQSE----EIQKKRTRRAVKFQR 56

Query: 309 NVTENTLKAI--KKIDKVRIAREAAHHKNRMRPNKLRKQKEAARELEQGIHLVKAPSVLQ 482
            +T  +L  I  K+  K  + R+A   +      + +K K+A++  +  +   KAP+   
Sbjct: 57  AITGASLADIMAKRNQKPEV-RKAQREQAIRAAKEAKKAKQASK--KTAMAAAKAPTKAA 113

Query: 483 QDPSLTLPIKV 515
               +  P+KV
Sbjct: 114 PKQKIVKPVKV 124



>sp|Q975Z9|R24E_SULTO 50S ribosomal protein L24e.>gb:BA000023_690832
           Sulfolobus tokodaii str. 7 DNA, complete genome.
          Length = 61

 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 24/54 (44%), Positives = 37/54 (68%), Gaps = 1/54 (1%)
 Frame = +3

Query: 66  LEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKN-FKMKRNPRKVKWTKAY 224
           +++C FC   I P  G+ ++RND  I  FC +KC K+  K+ R+P+K+KWTK+Y
Sbjct: 4   IKQCSFCGKEIPPATGLMYIRNDGSILWFCSNKCKKSMLKLHRDPKKLKWTKSY 57



>sp|Q8TVE8|R24E_METKA 50S ribosomal protein L24e.>gb:AE010437_263076
           Methanopyrus kandleri AV19 section 136 of 157 of the
           complete genome.>gb:AE009439_903857 Methanopyrus
           kandleri AV19, complete genome.
          Length = 68

 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 1/55 (1%)
 Frame = +3

Query: 66  LEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKN-FKMKRNPRKVKWTKAYR 227
           + +C FC   I PG G  FV+ND  I  FC SKC +N  K+ R+P+KV+WT+ +R
Sbjct: 4   VRRCDFCGRIIEPGTGKMFVKNDGTILWFCSSKCERNMLKLGRDPKKVRWTEKHR 58



>sp|Q9HJ58|R24E_THEAC 50S ribosomal protein L24e.>gb:TACID4_196871
           Thermoplasma acidophilum complete genome; segment 4/5.
          Length = 67

 Score = 59.3 bits (142), Expect = 7e-08
 Identities = 27/56 (48%), Positives = 32/56 (57%), Gaps = 1/56 (1%)
 Frame = +3

Query: 69  EKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKN-FKMKRNPRKVKWTKAYRRL 233
           + C FC   I PG GI +VR D  I  FC +KC KN  ++ R PR VKWT  Y  L
Sbjct: 5   KNCSFCGKAIEPGTGIMYVRKDGAILYFCSNKCRKNMIELNRVPRYVKWTNEYHEL 60



>sp|Q8ZTA6|R24E_PYRAE 50S ribosomal protein L24e.>gb:AE009925_257482
           Pyrobaculum aerophilum strain IM2 section 180 of 201 of
           the complete genome.>gb:AE009441_900108 Pyrobaculum
           aerophilum strain IM2 complete genome.
          Length = 58

 Score = 58.9 bits (141), Expect = 9e-08
 Identities = 24/54 (44%), Positives = 35/54 (64%), Gaps = 1/54 (1%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKN-FKMKRNPRKVKWTK 218
           M++ KC FC + I PG+GI +V++D  + RFC  KC  +  K  RNPRK+ W +
Sbjct: 1   MKIHKCAFCGADILPGYGIMYVKSDGTVLRFCSRKCFVSAVKYGRNPRKLAWVR 54



>sp|Q97BK6|R24E_THEVO 50S ribosomal protein L24e.>gb:BA000011_664891
           Thermoplasma volcanium GSS1 DNA, complete genome.
          Length = 66

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 28/59 (47%), Positives = 32/59 (54%), Gaps = 1/59 (1%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKN-FKMKRNPRKVKWTKAYRRL 233
           M    C FC  TI PG GI +VR D  I  FC +KC KN   + R PR V+WT  Y  L
Sbjct: 1   MLARTCSFCGKTIEPGTGIMYVRKDGAILYFCSNKCKKNMIGLNRVPRYVRWTNEYHEL 59



>sp|Q980Q6|R24E_SULSO 50S ribosomal protein L24e.>pir|E90164|E90164
           lSU ribosomal protein L24E (rpl24E) [imported] -
           Sulfolobus solfataricus>gb:AE006660_221170 Sulfolobus
           solfataricus P2 section 19 of 272 of the complete
           genome.>gb:AE006641_1107018 Sulfolobus solfataricus P2,
           complete genome.
          Length = 61

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 26/55 (47%), Positives = 34/55 (61%), Gaps = 1/55 (1%)
 Frame = +3

Query: 72  KCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKN-FKMKRNPRKVKWTKAYRRL 233
           +C FC   I PG G+ +VRND  I  FC SKC K+  K  R+P+K KWT  Y ++
Sbjct: 6   QCSFCGHEIPPGTGLMYVRNDGTILWFCSSKCRKSMLKYHRDPKKYKWTTRYMKV 60



>gb:AF011787_1231670 Trypanosoma brucei ribosomal protein L24 mRNA,
           complete cds.
          Length = 125

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 37/130 (28%), Positives = 60/130 (46%), Gaps = 4/130 (3%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVR----NDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYR 227
           MR   C F    ++PGHG ++V     +   +  F R KC   +  K+NPR + WT+ YR
Sbjct: 1   MRTIDCEFSHFAVHPGHGRRYVPFAFLSTKPVLTFARPKCFAMYMRKKNPRFIAWTRTYR 60

Query: 228 RLHGKDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNK 407
           R+H K  T        R+  R  R ++ +    L  I+++      R  A   +R    K
Sbjct: 61  RIHRKTTTDRVG---RRRAARTVRAERAIVGAELSYIQEV------RAKAKKVDRTAKGK 111

Query: 408 LRKQKEAARE 437
             +++ AAR+
Sbjct: 112 AVREEMAARK 121



>pir|G90116|G90116 60S ribosomal protein L24 [imported] - Guillardia
           theta nucleomorph>gb:GTAJ10592_1681186 Guillardia theta
           DNA for complete sequence of nucleomorph chromosome 2.
          Length = 106

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 3/109 (2%)
 Frame = +3

Query: 66  LEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHGKD 245
           +E C FC   IYPGHG  FV N    F FC +KC K  K+ +  + +KWT  + +L+  +
Sbjct: 1   MEICNFCGIGIYPGHGSMFVTNKFDKFYFCSTKCKKLKKIGKTNKGLKWTIKFSKLNKFN 60

Query: 246 MTQDATFEFERKRNRPERFDKNVTE---NTLKAIKKIDKVRIAREAAHH 383
              +     + K+ +  + +KN+T    +T+   KKID+ +  +    H
Sbjct: 61  EISN-----QIKKIKLNKTEKNITYAYFSTILFKKKIDRYKSIKTKKLH 104



>sp|O26357|R24E_METTH 50S ribosomal protein L24e.>pir|C69132|C69132
           ribosomal protein L24 - Methanobacterium
           thermoautotrophicum (strain Delta H)>gb:AE000812_27959
           Methanobacterium thermoautotrophicum from bases 193159
           to 207048 (section 18 of 148) of the complete
           genome.>gb:AE000666_925041 Methanobacterium
           thermoautotrophicum str. Delta H complete genome.
          Length = 53

 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 26/49 (53%), Positives = 30/49 (61%), Gaps = 1/49 (2%)
 Frame = +3

Query: 75  CWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKN-FKMKRNPRKVKWTK 218
           C FC   I PG G  +V+ D  I+ FC SKC KN  K+ R PRKVKW K
Sbjct: 4   CSFCHEEIEPGTGKMYVKRDGTIYFFCSSKCEKNMIKLGRVPRKVKWVK 52



>sp|Q9Y9A7|R24E_AERPE 50S ribosomal protein L24e.>pir|A72467|A72467
           probable ribosomal protein L24 APES070 - Aeropyrum
           pernix  (strain K1)>gb:BA000002_653137 Aeropyrum pernix
           K1 DNA, complete genome.
          Length = 63

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 22/53 (41%), Positives = 35/53 (66%), Gaps = 1/53 (1%)
 Frame = +3

Query: 75  CWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNF-KMKRNPRKVKWTKAYRR 230
           C FC  +I PG G+ +V  + +I  FC SKC+KNF K++R P K++W +  ++
Sbjct: 7   CSFCGGSIEPGTGLMYVLRNGQILWFCSSKCYKNFVKLRRKPDKLEWVRKVKK 59



>sp|P61120|R24E_HALN1 50S ribosomal protein
           L24e.>sp|P61121|R24E_HALSA 50S ribosomal protein
           L24e.>pir|G84271|G84271 50S ribosomal protein L24E
           [imported] - Halobacterium sp. NRC-1>gb:AB036344_5679
           Halobacterium cutirubrum rpl7AE, rps28E, rpl24E, ndk
           genes for LSU ribosomal protein L7AE, SSU ribosomal
           protein S28E, LSU ribosomal protein L24E, nucleoside
           diphosphate kinase, partial and complete
           cds.>gb:AE005044_62699 Halobacterium sp. NRC-1 section
           75 of 170 of the complete genome.>gb:AE004437_887618
           Halobacterium sp. NRC-1 complete genome.
          Length = 62

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 22/53 (41%), Positives = 29/53 (54%)
 Frame = +3

Query: 57  IMRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWT 215
           +++   C +C   I PG G  FV ND     FC +KC KN  + R PR V+WT
Sbjct: 1   MVQTRSCDYCGDDIEPGTGTMFVHNDGSTVHFCSAKCEKNADLGREPRDVEWT 53



>sp|Q8TQL7|R24E_METAC 50S ribosomal protein L24e.>gb:AE010822_266873
           Methanosarcina acetivorans str. C2A, section 167 of 534
           of the complete genome.>gb:AE010299_907432
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 62

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 21/53 (39%), Positives = 30/53 (56%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTK 218
           M   KC+FC   + PG G  +V+ D   +  C SKC  NF + R PR+ +WT+
Sbjct: 1   MEQRKCYFCGKMLEPGTGKLYVKKDGSTYFMCSSKCMSNFALGRLPRRTEWTE 53



>sp|Q8PU76|R24E_METMA 50S ribosomal protein L24e.>gb:AE013490_292795
           Methanosarcina mazei strain Goe1, section 272 of 379 of
           the complete genome.>gb:AE008384_966904 Methanosarcina
           mazei strain Goe1, complete genome.
          Length = 62

 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 20/53 (37%), Positives = 30/53 (56%)
 Frame = +3

Query: 60  MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTK 218
           M   KC+FC   + PG G  +++ D   +  C SKC  NF + R PR+ +WT+
Sbjct: 1   MEQRKCYFCGQMLEPGTGKLYIKKDGSTYFMCSSKCMSNFALGRLPRRTEWTE 53



>gb:AY496460_1330703 Marsupenaeus japonicus ribosomal protein L24
           (GD13) mRNA, complete cds.
          Length = 164

 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 32/120 (26%), Positives = 56/120 (46%), Gaps = 1/120 (0%)
 Frame = +3

Query: 138 KIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHGKDMTQDATFEFERKRNRPERFDKNVT 317
           ++  F  ++C   + MK+NPR+VKWT  YRRLH K + ++     +R+  R ++F + + 
Sbjct: 29  RVMVFLNARCEAAYLMKKNPREVKWTVLYRRLHKKGVEEEVA---KRRTRRTQKFQRAIV 85

Query: 318 ENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQKE-AARELEQGIHLVKAPSVLQQDPS 494
             +L  I               K  M+P   + Q+E A R  ++     KA     + P+
Sbjct: 86  GASLTDIMA-------------KRNMKPEVRKAQREQAIRAAKEKAKAAKAAKAAAKKPA 132



>gb:AY596297_631644 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 116

 Score = 49.3 bits (116), Expect = 7e-05
 Identities = 21/55 (38%), Positives = 27/55 (49%)
 Frame = +3

Query: 63  RLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYR 227
           R  +C +C + I PG G  FV  D     FC SKC  N  + R  R ++WT   R
Sbjct: 3   RTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR 57



>sp|P14116|R24E_HALMA 50S ribosomal protein L24e
           (Hl21/Hl22).>pir|S06846|R6HS21 ribosomal protein L24.eR
           [validated] - Haloarcula marismortui
          Length = 66

 Score = 49.3 bits (116), Expect = 7e-05
 Identities = 21/55 (38%), Positives = 27/55 (49%)
 Frame = +3

Query: 63  RLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYR 227
           R  +C +C + I PG G  FV  D     FC SKC  N  + R  R ++WT   R
Sbjct: 2   RTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTAR 56



>gb:AJ698398_1283783 Euplotes vannus macronuclear gene for ribosomal
           protein L24, clone 96(1).D7.
          Length = 155

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 33/131 (25%), Positives = 59/131 (45%), Gaps = 1/131 (0%)
 Frame = +3

Query: 57  IMRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLH 236
           + + E C F    +YPG G +FVR D + F F   K       K     + WT  +RR +
Sbjct: 2   VTKTELCHFSEYKVYPGRGHRFVRKDGRTFFFLSRKTRSLHFQKVKTSDLTWTPMWRRKN 61

Query: 237 GKDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPN-KLR 413
            K     A       R R +R  + +      ++ +I+++R   +    ++ MR   K  
Sbjct: 62  RKGAYAKAA------RVRTKRTTRKMKAVVGMSLAEINRIR--NQGTKERDEMRTKIKEE 113

Query: 414 KQKEAARELEQ 446
           ++K+ A+++EQ
Sbjct: 114 QKKKKAKQIEQ 124



>gb:PFMAL13_1191154 Plasmodium falciparum 3D7 chromosome 13, ***
           SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 162

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 19/65 (29%), Positives = 35/65 (53%)
 Frame = +3

Query: 48  VEDIMRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYR 227
           ++  ++ E C F    IYPG G +++  D K++ +  SK       K+   K++WT+ +R
Sbjct: 4   IKTTVKTEACSFSEYRIYPGRGQKYIARDGKVYFYLSSKFASLALQKKKAAKLRWTQTWR 63

Query: 228 RLHGK 242
           R + K
Sbjct: 64  RNNKK 68



>gb:AY071693_1295777 Drosophila melanogaster RH14088 full insert
           cDNA.
          Length = 123

 Score = 42.7 bits (99), Expect = 0.007
 Identities = 25/83 (30%), Positives = 41/83 (49%)
 Frame = +3

Query: 183 MKRNPRKVKWTKAYRRLHGKDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRI 362
           MKRNPRKV WT  YRR H K + ++A+   +++  R ++F + +   +L  I        
Sbjct: 1   MKRNPRKVTWTVLYRRKHRKGIEEEAS---KKRTRRTQKFQRAIVGASLAEILA------ 51

Query: 363 AREAAHHKNRMRPNKLRKQKEAA 431
                  K  M+P   + Q++ A
Sbjct: 52  -------KRNMKPEVRKAQRDQA 67



>sp|O67124|RA50_AQUAE Probable DNA double-strand break repair rad50
           ATPase.>pir|A70387|A70387 conserved hypothetical protein
           aq_1006 - Aquifex aeolicus>gb:AE000718_26476 Aquifex
           aeolicus VF5 section 50 of 109 of the complete
           genome.>gb:AE000657_977007 Aquifex aeolicus VF5 complete
           genome.
          Length = 978

 Score = 40.4 bits (93), Expect = 0.035
 Identities = 24/97 (24%), Positives = 45/97 (46%)
 Frame = +3

Query: 267 EFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQKEAARELEQ 446
           E E+ RN  E   K + EN  + IKK++++RI +E   HK       L  +++   E + 
Sbjct: 540 EMEKLRNEVEELRKEIPENLKERIKKLEELRIEKEKLEHKLNKYRKALEDRQKQKEEAQA 599

Query: 447 GIHLVKAPSVLQQDPSLTLPIKVKVSQQQSEEKRMEE 557
            +H  +    L ++        VK  ++    +R+E+
Sbjct: 600 KLHKAQTELELLKEKIREKSRLVKEFKELYRVERLED 636



>gb:CR548612_1375607 Paramecium tetraurelia macronuclear largest
           chromosome, complete sequence.
          Length = 705

 Score = 37.0 bits (84), Expect = 0.38
 Identities = 29/114 (25%), Positives = 50/114 (43%), Gaps = 4/114 (3%)
 Frame = +3

Query: 216 KAYRRLHGKD---MTQDATFEFERKRNRPERFDKNVT-ENTLKAIKKIDKVRIAREAAHH 383
           + YR+L+G D   + +D   E+  K  +P  F+   T  N L  + K+  +        H
Sbjct: 422 QVYRKLYGVDKQSIPEDEEVEYHTKLLKPHAFNNRATLSNKLVIVVKVPIL--------H 473

Query: 384 KNRMRPNKLRKQKEAARELEQGIHLVKAPSVLQQDPSLTLPIKVKVSQQQSEEK 545
           K+   P+K+ +Q  A         + K    L     +  P K  V+QQ++E+K
Sbjct: 474 KSTQDPHKMPQQTNAT--------ITKLQQTLTAKKQILYPQKHSVTQQEAEKK 519



>gb:AJ720788_2502975 Gallus gallus mRNA for hypothetical protein,
           clone 25k20.
          Length = 612

 Score = 36.2 bits (82), Expect = 0.65
 Identities = 32/131 (24%), Positives = 62/131 (47%), Gaps = 19/131 (14%)
 Frame = +3

Query: 216 KAYRRLHGKDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKI-DKVRIAREAAHHKNR 392
           K  + L G    + +  + + +  + +   ++V    +   KK+ D++ IA++ AH    
Sbjct: 169 KMMKDLEGLHRAEQSLHDLQERLQKAQEEHRSVEVEKVHLEKKLQDEISIAKQEAHRLRE 228

Query: 393 MRP---NKLRKQKEAARELEQGIHLVK-------------APSVLQQDPSLTLPIKVKV- 521
           +R    N+L +QK A +ELEQ    +K             AP  LQ+   LT  ++V+  
Sbjct: 229 LREGTENELSRQKYAEQELEQVRMALKNAEKELESHCSWAAPEALQKWLQLTHEVEVQYY 288

Query: 522 -SQQQSEEKRM 551
             ++Q+ EK++
Sbjct: 289 NIKKQNAEKQL 299



>gb:AK051450_1169693 Mus musculus 12 days embryo spinal ganglion
           cDNA, RIKEN full-length enriched library,
           clone:D130049J17 product:hypothetical protein, full
           insert sequence.
          Length = 155

 Score = 36.2 bits (82), Expect = 0.65
 Identities = 26/105 (24%), Positives = 48/105 (45%), Gaps = 2/105 (1%)
 Frame = +3

Query: 147 RFC--RSKCHKNFKMKRNPRKVKWTKAYRRLHGKDMTQDATFEFERKRNRPERFDKNVTE 320
           RFC   +K H+N K K+  +K +  K  R+  G+   +    + E K+ R +  ++   +
Sbjct: 47  RFCLLANKRHQNLKRKKERKKER--KKERKKEGRKEGRKEGRKEEGKKERKKERERERKK 104

Query: 321 NTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQKEAARELEQGIH 455
              K  K+ ++    R+    K + R  K RK+K+   +   G H
Sbjct: 105 RKEKKRKEQNRTEKKRKEKKRKEKKRKEKKRKEKKRKNQNTDGHH 149



>gb:AF488563_1804426 Arabidopsis thaliana clone bHLH019 putative
           bHLH transcription factor mRNA, complete cds.
          Length = 295

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 26/91 (28%), Positives = 48/91 (52%), Gaps = 3/91 (3%)
 Frame = +3

Query: 273 ERKRNRPERFDKNVTENTL-KAIKKIDKVRIAREAAHHKNRMRPN--KLRKQKEAARELE 443
           ERKR R +  +K +  + L   +KK DKV I  +A     +++     L+++KEA R++E
Sbjct: 124 ERKR-REKLSEKFIALSALLPGLKKADKVTILDDAISRMKQLQEQLRTLKEEKEATRQME 182

Query: 444 QGIHLVKAPSVLQQDPSLTLPIKVKVSQQQS 536
             I + K+     ++P+L+    V +   Q+
Sbjct: 183 SMILVKKSKVFFDEEPNLSCSPSVHIEFDQA 213



>pir|E84616|E84616 probable bHLH transcription factor [imported] -
           Arabidopsis thaliana>gb:AC005617_1532835 Arabidopsis
           thaliana chromosome 2 clone T30L20 map CIC06C07,
           complete sequence.>gb:AC006340_1534080 Arabidopsis
           thaliana chromosome 2 clone T9I22 map CIC06C07, complete
           sequence.
          Length = 284

 Score = 35.4 bits (80), Expect = 1.1
 Identities = 26/91 (28%), Positives = 48/91 (52%), Gaps = 3/91 (3%)
 Frame = +3

Query: 273 ERKRNRPERFDKNVTENTL-KAIKKIDKVRIAREAAHHKNRMRPN--KLRKQKEAARELE 443
           ERKR R +  +K +  + L   +KK DKV I  +A     +++     L+++KEA R++E
Sbjct: 124 ERKR-REKLSEKFIALSALLPGLKKADKVTILDDAISRMKQLQEQLRTLKEEKEATRQME 182

Query: 444 QGIHLVKAPSVLQQDPSLTLPIKVKVSQQQS 536
             I + K+     ++P+L+    V +   Q+
Sbjct: 183 SMILVKKSKVFFDEEPNLSCSPSVHIEFDQA 213



>gb:PFMAL3P4_1394489 Plasmodium falciparum MAL3P4.
          Length = 2515

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 30/141 (21%), Positives = 57/141 (40%), Gaps = 2/141 (1%)
 Frame = +3

Query: 120  FVRNDA-KIFRFCRSKCHKNFKMKR-NPRKVKWTKAYRRLHGKDMTQDATFEFERKRNRP 293
            + RND  K  R  R   H + K+   N + V      R + G+D  +D  F+F  K N  
Sbjct: 1238 YKRNDTHKKLRPIRFVRHVDVKLDNLNDKTVMLKNEIRDVKGEDKGEDVYFDFLNKDNNM 1297

Query: 294  ERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQKEAARELEQGIHLVKAPS 473
               +       +K +K ++ V+  +   + KN    N +   K+         +  K   
Sbjct: 1298 GNMENKKNVKNVKNVKNVNNVKDVKNVNNVKNVNNVNNVNNVKDVKNMEHIDKYNKKEVM 1357

Query: 474  VLQQDPSLTLPIKVKVSQQQS 536
            + ++  S  +P K K + +++
Sbjct: 1358 IKKKGESNNVPHKEKHNNKKN 1378



>gb:AY069357_1294087 Drosophila melanogaster LD06138 full length
           cDNA.
          Length = 290

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 28/138 (20%), Positives = 56/138 (40%), Gaps = 1/138 (0%)
 Frame = +3

Query: 147 RFCRSKCHKNFKMKRNPRKVKWTKAYRRLHGKDMTQ-DATFEFERKRNRPERFDKNVTEN 323
           R   S     +  + + R  +    +++L  ++  Q +   E ER+R   E   K + E 
Sbjct: 86  RSSSSSSDSQYSEQESQRSKQKRSRFKKLDEQNQMQVERLAEMERQRRAKELEQKTIEEE 145

Query: 324 TLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQKEAARELEQGIHLVKAPSVLQQDPSLTL 503
             K I+ + K R+  E    ++ +     R+ + A  E+E+                + L
Sbjct: 146 AAKRIEMLVKKRVEEELEKRRDEIEQEVNRRVETAKAEMER---------------EMML 190

Query: 504 PIKVKVSQQQSEEKRMEE 557
            ++ +  Q + EE+R EE
Sbjct: 191 ELERRREQIREEERRREE 208



>gb:BA000037_723102 Vibrio vulnificus YJ016 DNA, chromosome I,
           complete sequence.
          Length = 355

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 31/108 (28%), Positives = 51/108 (47%), Gaps = 2/108 (1%)
 Frame = +3

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLK--AIKKIDKVRIAREAAHHKNRMRPNKLR 413
           K   Q+     E+ R   ER  K   E   K  AIKK ++ R+A+EAA  K      ++ 
Sbjct: 122 KQKEQEKKVAEEKARKEKERVAKLEAERKTKEEAIKKAEQERLAKEAAIAK--AEQERIA 179

Query: 414 KQKEAARELEQGIHLVKAPSVLQQDPSLTLPIKVKVSQQQSEEKRMEE 557
           K+K AA+E E+     K  +   +   +    K K +++ +E+ R E+
Sbjct: 180 KEK-AAKEAEEKARREKEAAAKAEQERIA---KEKAAKEAAEKARKEK 223



>gb:AE016804_336807 Vibrio vulnificus CMCP6 chromosome I section 8
           of 11 of the complete sequence.>gb:AE016795_1046531
           Vibrio vulnificus CMCP6 chromosome I complete sequence.
          Length = 319

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 31/108 (28%), Positives = 51/108 (47%), Gaps = 2/108 (1%)
 Frame = +3

Query: 240 KDMTQDATFEFERKRNRPERFDKNVTENTLK--AIKKIDKVRIAREAAHHKNRMRPNKLR 413
           K   Q+     E+ R   ER  K   E   K  AIKK ++ R+A+EAA  K      ++ 
Sbjct: 86  KQKEQEKKVAEEKARKEKERVAKLEAERKTKEEAIKKAEQERLAKEAAIAK--AEQERIA 143

Query: 414 KQKEAARELEQGIHLVKAPSVLQQDPSLTLPIKVKVSQQQSEEKRMEE 557
           K+K AA+E E+     K  +   +   +    K K +++ +E+ R E+
Sbjct: 144 KEK-AAKEAEEKARREKEAAAKAEQERIA---KEKAAKEAAEKARKEK 187



>pir|T18477|T18477 hypothetical protein C0485w - malaria parasite
            (Plasmodium falciparum)
          Length = 2523

 Score = 34.3 bits (77), Expect = 2.5
 Identities = 30/141 (21%), Positives = 57/141 (40%), Gaps = 2/141 (1%)
 Frame = +3

Query: 120  FVRNDA-KIFRFCRSKCHKNFKMKR-NPRKVKWTKAYRRLHGKDMTQDATFEFERKRNRP 293
            + RND  K  R  R   H + K+   N + V      R + G+D  +D  F+F  K N  
Sbjct: 1246 YKRNDTHKKLRPIRFVRHVDVKLDNLNDKTVMLKNEIRDVKGEDKGEDVYFDFLNKDNNM 1305

Query: 294  ERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQKEAARELEQGIHLVKAPS 473
               +       +K +K ++ V+  +   + KN    N +   K+         +  K   
Sbjct: 1306 GNMENKKNVKNVKNVKNVNNVKDVKNVNNVKNVNNVNNVNNVKDVKNMEHIDKYNKKEVM 1365

Query: 474  VLQQDPSLTLPIKVKVSQQQS 536
            + ++  S  +P K K + +++
Sbjct: 1366 IKKKGESNNVPHKEKHNNKKN 1386



>gb:CR382127_1660141 Yarrowia lipolytica chromosome A of strain CLIB99
            of Yarrowia lipolytica.
          Length = 1602

 Score = 33.9 bits (76), Expect = 3.2
 Identities = 22/93 (23%), Positives = 37/93 (39%), Gaps = 5/93 (5%)
 Frame = +3

Query: 183  MKRNPRKVKWTKAYRRLHGK-----DMTQDATFEFERKRNRPERFDKNVTENTLKAIKKI 347
            MK   RKV+  KA +R+  +     D  + A  + ER+        K    +  +  + +
Sbjct: 1167 MKEEDRKVEMAKANKRVMARKKAIEDAKEKAALDVERREKESRESAKPEARDAQRDSRDL 1226

Query: 348  DKVRIAREAAHHKNRMRPNKLRKQKEAARELEQ 446
            DK R            R    R+++E  RE E+
Sbjct: 1227 DKARDVESRVSSARSSRATSPRRERERERERER 1259



>gb:AE005172_891057 Arabidopsis thaliana chromosome 1, top arm
            complete sequence.>gb:AC007369_1535804 Arabidopsis
            thaliana chromosome I BAC F9H16 genomic sequence,
            complete sequence.
          Length = 1498

 Score = 33.9 bits (76), Expect = 3.2
 Identities = 35/135 (25%), Positives = 56/135 (41%), Gaps = 8/135 (5%)
 Frame = +3

Query: 138  KIFRFCRSKCHKNFKMKRNP--RKVKWTKAYRRLHGKDMTQDATF------EFERKRNRP 293
            K+ +F  SK   N K    P  +K + TK+ + +         T       E E+     
Sbjct: 1145 KVVKFEGSKVENNGKEVAKPTEQKSQTTKSKKAVKPDQPPSIVTELVSGKEEIEKSATPE 1204

Query: 294  ERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQKEAARELEQGIHLVKAPS 473
            E     +T+   + IKK ++ R  +EAA  K + R  ++ K KEA    ++     KA +
Sbjct: 1205 EEEPPKLTKEEEELIKKEEEKRKQKEAAKMKEQHRLEEIAKAKEAMERKKKREEKAKARA 1264

Query: 474  VLQQDPSLTLPIKVK 518
            VL+         KVK
Sbjct: 1265 VLKAQKEAEEREKVK 1279



>pir|F86342|F86342 F9H16.4 protein - Arabidopsis thaliana
          Length = 1551

 Score = 33.9 bits (76), Expect = 3.2
 Identities = 35/135 (25%), Positives = 56/135 (41%), Gaps = 8/135 (5%)
 Frame = +3

Query: 138  KIFRFCRSKCHKNFKMKRNP--RKVKWTKAYRRLHGKDMTQDATF------EFERKRNRP 293
            K+ +F  SK   N K    P  +K + TK+ + +         T       E E+     
Sbjct: 1198 KVVKFEGSKVENNGKEVAKPTEQKSQTTKSKKAVKPDQPPSIVTELVSGKEEIEKSATPE 1257

Query: 294  ERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQKEAARELEQGIHLVKAPS 473
            E     +T+   + IKK ++ R  +EAA  K + R  ++ K KEA    ++     KA +
Sbjct: 1258 EEEPPKLTKEEEELIKKEEEKRKQKEAAKMKEQHRLEEIAKAKEAMERKKKREEKAKARA 1317

Query: 474  VLQQDPSLTLPIKVK 518
            VL+         KVK
Sbjct: 1318 VLKAQKEAEEREKVK 1332



>gb:BC078484_2561025 Xenopus laevis MGC85251 protein, mRNA (cDNA
           clone MGC:85251 IMAGE:6873367), complete cds.
          Length = 250

 Score = 33.5 bits (75), Expect = 4.2
 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 2/82 (2%)
 Frame = +3

Query: 204 VKWTKAYRRLHGKDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKIDKVRIAREA--A 377
           VK  K   +  GK +T +         + PE F + V + T+K   +++  R  REA   
Sbjct: 131 VKEKKKQLKKEGKSLTVE--------EDDPEVFKQAVYKQTMKLFAELEIKRKEREAKDM 182

Query: 378 HHKNRMRPNKLRKQKEAARELE 443
           H + R R  ++  Q++A RE E
Sbjct: 183 HERKRQREEEIETQEKAKRERE 204



>gb:AF425077_2065495 Mus musculus ABCG4 (Abcg4) mRNA, complete
           cds.>gb:AF425078S3_2065496 Mus musculus ABCG4 (Abcg4)
           gene, exons 13, 14, and 15 and complete cds.
          Length = 646

 Score = 33.5 bits (75), Expect = 4.2
 Identities = 22/65 (33%), Positives = 33/65 (50%)
 Frame = -1

Query: 586 HMTTQQKDIYSSMRFSSDCCCETLTLMGKVRDGSCWRTEGALTKWIPCSSSLAASFCFRS 407
           H+T  Q+  +   R + D   E + L   VR+G CWR  G  T  + C   L+  FC R 
Sbjct: 43  HITEAQRFSHLPKRSAVDI--EFVELSYSVREGPCWRKRGYKT-LLKC---LSGKFCRRE 96

Query: 406 LLGLI 392
           L+G++
Sbjct: 97  LIGIM 101



>gb:AF378330_2064533 Mus musculus ATP-binding cassette transporter
           White2 mRNA, complete cds.>gb:AF411084_2065235 Mus
           musculus ATP-binding cassette transporter sub-family G
           member 4 (Abcg4) mRNA, complete cds.>gb:AY040865_2074403
           Mus musculus ATP-binding cassette transporter ABCG4
           (Abcg4) mRNA, complete cds.>gb:BC016200_2092220 Mus
           musculus ATP-binding cassette, sub-family G (WHITE),
           member 4, mRNA (cDNA clone MGC:27647 IMAGE:4511456),
           complete cds.>gb:MMU426047_2121395 Mus musculus mRNA for
           putative white family ABC-transporter (ABCG4 gene).
          Length = 646

 Score = 33.5 bits (75), Expect = 4.2
 Identities = 22/65 (33%), Positives = 33/65 (50%)
 Frame = -1

Query: 586 HMTTQQKDIYSSMRFSSDCCCETLTLMGKVRDGSCWRTEGALTKWIPCSSSLAASFCFRS 407
           H+T  Q+  +   R + D   E + L   VR+G CWR  G  T  + C   L+  FC R 
Sbjct: 43  HITEAQRFSHLPKRSAVDI--EFVELSYSVREGPCWRKRGYKT-LLKC---LSGKFCRRE 96

Query: 406 LLGLI 392
           L+G++
Sbjct: 97  LIGIM 101



>gb:HSA300465_2003165 Homo sapiens mRNA for putative white family
           ATP-binding cassette transporter (ABCG4 gene).
          Length = 627

 Score = 33.5 bits (75), Expect = 4.2
 Identities = 22/65 (33%), Positives = 33/65 (50%)
 Frame = -1

Query: 586 HMTTQQKDIYSSMRFSSDCCCETLTLMGKVRDGSCWRTEGALTKWIPCSSSLAASFCFRS 407
           H+T  Q+  +   R + D   E + L   VR+G CWR  G  T  + C   L+  FC R 
Sbjct: 24  HITEAQRFSHLPKRSAVDI--EFVELSYSVREGPCWRKRGYKT-LLKC---LSGKFCRRE 77

Query: 406 LLGLI 392
           L+G++
Sbjct: 78  LIGIM 82



>gb:AL596114_1930608 Human DNA sequence from clone RP11-274A8 on
           chromosome 13 Containd the 3' end of a novel gene
           (KIAA0774), a novel gene, the SLC7A1 gene for solute
           carrier family 7 (cationic amino acid transporter, y+
           system), member 1, and a CpG island, complete
           sequence.>gb:AL607144_1930988 Human DNA sequence from
           clone RP11-398A16 on chromosome 13 Contains part of a
           novel gene (KIAA0774) and a CpG island, complete
           sequence.
          Length = 348

 Score = 33.5 bits (75), Expect = 4.2
 Identities = 27/109 (24%), Positives = 54/109 (49%), Gaps = 4/109 (3%)
 Frame = +3

Query: 228 RLHGKDMTQDATFEFERKRNRPERFDKNVTENTLK----AIKKIDKVRIAREAAHHKNRM 395
           RL  +D     TF+ +  R+R  RF++ + +NT +    A+     +    ++      M
Sbjct: 168 RLSLQDQVDTLTFQSQSLRDRARRFEEALRKNTEEQLEIALAPYQHLEEDMKSLKQVLEM 227

Query: 396 RPNKLRKQKEAARELEQGIHLVKAPSVLQQDPSLTLPIKVKVSQQQSEE 542
           +  ++ +Q++   ELE+   LVK   +L++        K++V QQQ+E+
Sbjct: 228 KNQQIHEQEKKILELEK---LVKKNIILEE--------KIQVLQQQNED 265



>gb:AK043147_1166521 Mus musculus 7 days neonate cerebellum cDNA,
           RIKEN full-length enriched library, clone:A730060B05
           product:ATP-BINDING CASSETTE TRANSPORTER SUB-FAMILY G
           MEMBER 4 homolog [Mus musculus], full insert sequence.
          Length = 646

 Score = 33.5 bits (75), Expect = 4.2
 Identities = 22/65 (33%), Positives = 33/65 (50%)
 Frame = -1

Query: 586 HMTTQQKDIYSSMRFSSDCCCETLTLMGKVRDGSCWRTEGALTKWIPCSSSLAASFCFRS 407
           H+T  Q+  +   R + D   E + L   VR+G CWR  G  T  + C   L+  FC R 
Sbjct: 43  HITEAQRFSHLPKRSAVDI--EFVELSYSVREGPCWRKRGYKT-LLKC---LSGKFCRRE 96

Query: 406 LLGLI 392
           L+G++
Sbjct: 97  LIGIM 101



>gb:CP000001_852564 Bacillus cereus ZK, complete genome.
          Length = 287

 Score = 33.5 bits (75), Expect = 4.2
 Identities = 21/84 (25%), Positives = 43/84 (51%)
 Frame = +3

Query: 306 KNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQKEAARELEQGIHLVKAPSVLQQ 485
           K V  NT +  K  DK  + ++ A+ K + + ++ R+ +E AR+ E    L +  +  QQ
Sbjct: 125 KKVASNTTEQ-KDSDKKELEKKEANEKTQKQEDEKRQAEEQARKQEDEKRLAEEQARKQQ 183

Query: 486 DPSLTLPIKVKVSQQQSEEKRMEE 557
           +    L  +    QQ+ ++++ +E
Sbjct: 184 EEQKRLADEQARQQQEEQKRQADE 207



>sp|Q9H172|ABG4_HUMAN ATP-binding cassette, sub-family G, member
           4.>pir|JC7777|JC7777 ATP binding cassette transporter,
           subclass G4 - human>gb:BC041091_1982966 Homo sapiens
           ATP-binding cassette, sub-family G (WHITE), member 4,
           mRNA (cDNA clone MGC:46042 IMAGE:5763981), complete
           cds.>gb:HSA308237_2003715 Homo sapiens mRNA for ABC
           transporter (ABCG4 gene).
          Length = 646

 Score = 33.5 bits (75), Expect = 4.2
 Identities = 22/65 (33%), Positives = 33/65 (50%)
 Frame = -1

Query: 586 HMTTQQKDIYSSMRFSSDCCCETLTLMGKVRDGSCWRTEGALTKWIPCSSSLAASFCFRS 407
           H+T  Q+  +   R + D   E + L   VR+G CWR  G  T  + C   L+  FC R 
Sbjct: 43  HITEAQRFSHLPKRSAVDI--EFVELSYSVREGPCWRKRGYKT-LLKC---LSGKFCRRE 96

Query: 406 LLGLI 392
           L+G++
Sbjct: 97  LIGIM 101



>gb:BC066133_2554254 Xenopus tropicalis hypothetical protein
           MGC76045, mRNA (cDNA clone MGC:76045 IMAGE:5385053),
           complete cds.
          Length = 664

 Score = 33.1 bits (74), Expect = 5.5
 Identities = 30/131 (22%), Positives = 61/131 (46%), Gaps = 19/131 (14%)
 Frame = +3

Query: 216 KAYRRLHGKDMTQDATFEFERKRNRPERFDKNVTENTLKAIKKI-DKVRIAREAAHHKNR 392
           K  + L G    + +  + + +  + +   + V    +   KK+ +++ +A++ AH    
Sbjct: 232 KMMKDLEGLHRAEQSLHDLQERLQKAQEEHRTVEVEKVHLEKKLQNEISLAKQEAHRLRE 291

Query: 393 MRP---NKLRKQKEAARELEQGIHLVK-------------APSVLQQDPSLTLPIKVKV- 521
           +R    N+L +QK A +ELEQ    +K             AP  LQ+   LT  ++V+  
Sbjct: 292 LREGTENELSRQKYAEQELEQVRMALKNAEKELESHSNWSAPEALQKWLQLTHEVEVQYY 351

Query: 522 -SQQQSEEKRM 551
             ++Q+ EK++
Sbjct: 352 NIKKQNAEKQL 362



>gb:CNS07EGE_1373680 chromosome VII of strain GB-M1 of
           Encephalitozoon cuniculi (Microspora).
          Length = 113

 Score = 33.1 bits (74), Expect = 5.5
 Identities = 17/55 (30%), Positives = 25/55 (45%)
 Frame = +3

Query: 81  FCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHGKD 245
           F    I  G GI  V +D +      +K  +    K NPR ++WT + R   GK+
Sbjct: 21  FSGRNIPKGSGIYEVMSDGRAVLTASNKERRLIARKINPRDIRWTTSSREFFGKE 75



>gb:PFMAL13_1191256 Plasmodium falciparum 3D7 chromosome 13, ***
           SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 1218

 Score = 33.1 bits (74), Expect = 5.5
 Identities = 24/103 (23%), Positives = 52/103 (50%), Gaps = 11/103 (10%)
 Frame = +3

Query: 282 RNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRP--NKLRKQKEAARELEQGI- 452
           +   E ++K V+ N  + I+K +KV IA +    K  M     K+   K   + LE+GI 
Sbjct: 212 KKEKEEYNKFVSNN--EEIEKYEKVEIAYKYYVAKKMMTKCEEKIEDAKSEEKILEKGIK 269

Query: 453 --------HLVKAPSVLQQDPSLTLPIKVKVSQQQSEEKRMEE 557
                   + ++   ++++  + + P+K+ +SQ++  EK++ +
Sbjct: 270 EIDKDIEKYKIEKEKIVKETNTASEPMKILISQKEELEKKISQ 312



>sp|Q10251|IF2P_SCHPO Eukaryotic translation initiation factor 5B
           (eIF-5B) (Translation initiation factor
           IF-2).>pir|T38913|T38913 translation initiation factor
           if-2 - fission yeast  (Schizosaccharomyces
           pombe)>gb:SPAC56F8_1718049 S.pombe chromosome I cosmid
           c56F8.
          Length = 1079

 Score = 33.1 bits (74), Expect = 5.5
 Identities = 18/94 (19%), Positives = 45/94 (47%)
 Frame = +3

Query: 156 RSKCHKNFKMKRNPRKVKWTKAYRRLHGKDMTQDATFEFERKRNRPERFDKNVTENTLKA 335
           + K  K  +    P++++  +  + L       D  F+++ K+ +  +  +N  E+   A
Sbjct: 109 KGKKSKKVEEDDEPQEIESPQGPKELTAVTELDDDEFDYKPKKGKKGKKAQNNNESEAAA 168

Query: 336 IKKIDKVRIAREAAHHKNRMRPNKLRKQKEAARE 437
             +I +VR+  +    + +    KLRK+++ A++
Sbjct: 169 PPEIPEVRVKTKKEKEREKKEREKLRKKQQQAKK 202



>gb:AK041719_1166085 Mus musculus 3 days neonate thymus cDNA, RIKEN
           full-length enriched library, clone:A630032B19
           product:hypothetical protein, full insert sequence.
          Length = 126

 Score = 32.7 bits (73), Expect = 7.2
 Identities = 18/53 (33%), Positives = 24/53 (45%)
 Frame = +2

Query: 572 LCCHVIYFVPKSNASLSPRRTFHLCSSKVLFYFIFLVMFFTSSYFLPLSFLLC 730
           L  H+IY   + N S   ++   L S   LFYF+  + FF  S    L   LC
Sbjct: 53  LSSHLIYRFQEPNLSFKQKQEVLLISEYFLFYFLKKICFFLCSLMFCLHVCLC 105



>gb:CP000025_879553 Campylobacter jejuni RM1221, complete genome.
          Length = 696

 Score = 32.7 bits (73), Expect = 7.2
 Identities = 16/52 (30%), Positives = 29/52 (55%)
 Frame = +2

Query: 524 TTTIRRKAHGGVNVFLLCCHVIYFVPKSNASLSPRRTFHLCSSKVLFYFIFL 679
           T+T      GG+ + +L   V+YF+ K+ A   P + F   +S ++FY +F+
Sbjct: 579 TSTDFGAVFGGLGLGILILIVLYFLLKAGAIRIPVKQFFYITSYIIFYMVFV 630



>pir|G81262|G81262 probable integral membrane protein Cj1658
           [imported] - Campylobacter jejuni (strain NCTC
           11168)>gb:CJ11168X6_848015 Campylobacter jejuni subsp.
           jejuni NCTC 11168 complete genome; segment 6/6.
          Length = 696

 Score = 32.7 bits (73), Expect = 7.2
 Identities = 16/52 (30%), Positives = 29/52 (55%)
 Frame = +2

Query: 524 TTTIRRKAHGGVNVFLLCCHVIYFVPKSNASLSPRRTFHLCSSKVLFYFIFL 679
           T+T      GG+ + +L   V+YF+ K+ A   P + F   +S ++FY +F+
Sbjct: 579 TSTDFGAVFGGLGLGILILIVLYFLLKAGAIRIPVKQFFYITSYIIFYMVFV 630



>pir|T32372|T32372 hypothetical protein C01B12.8 - Caenorhabditis
           elegans>gb:AF025458_1234005 Caenorhabditis elegans
           cosmid C01B12, complete sequence.
          Length = 153

 Score = 32.7 bits (73), Expect = 7.2
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 7/62 (11%)
 Frame = +3

Query: 273 ERKRNRPERFDKN-----VTENTLKAIKK--IDKVRIAREAAHHKNRMRPNKLRKQKEAA 431
           +RK + P    K+     +TE+ L+  KK   D ++  REA   K + +  KL K+KEAA
Sbjct: 81  KRKTSTPRSLKKSSRCREMTESDLELAKKRNADAMKHLREAKKKKEKEQEEKLAKKKEAA 140

Query: 432 RE 437
           R+
Sbjct: 141 RK 142



>gb:CR380957_1652979 Candida glabrata strain CBS138 chromosome K
           complete sequence.
          Length = 267

 Score = 27.3 bits (59), Expect(2) = 9.0
 Identities = 13/51 (25%), Positives = 29/51 (56%)
 Frame = +3

Query: 309 NVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQKEAARELEQGIHLV 461
           +VT N ++  K ++  R+A++  +    +RPN + K+++   + + G  LV
Sbjct: 24  SVTANAMRRWKLVECRRVAKQPEYKVGDVRPNYVPKERKEFPDYKYGEALV 74



 Score = 23.9 bits (50), Expect(2) = 9.0
 Identities = 11/26 (42%), Positives = 14/26 (53%)
 Frame = +1

Query: 475 FSNKIHPSPCPSRSRFHNNNQKKSAW 552
           + NKI  S   +R  +H N  KKS W
Sbjct: 90  YGNKISESKHKTRRTWHPNVIKKSLW 115



>gb:BC065430_2553988 Danio rerio annexin A5, mRNA (cDNA clone
           MGC:77626 IMAGE:6996728), complete cds.
          Length = 317

 Score = 32.3 bits (72), Expect = 9.4
 Identities = 23/97 (23%), Positives = 41/97 (42%), Gaps = 8/97 (8%)
 Frame = +3

Query: 186 KRNPRKVKWTKAYRRLHGKDMTQDATFEFERK--------RNRPERFDKNVTENTLKAIK 341
           + N ++ +   AY+ LHGKD+  D   E   K           P  ++     N +K   
Sbjct: 43  RSNGQRQEIKAAYKTLHGKDLVNDLKSELGGKFEDLIVALMTPPIIYEVTCLRNAIKGAG 102

Query: 342 KIDKVRIAREAAHHKNRMRPNKLRKQKEAARELEQGI 452
             +KV I   A+   N +   K   ++E  ++LE+ +
Sbjct: 103 TDEKVLIEILASRSPNEVNEIKSSYKREHDKDLEEDV 139



>gb:BC046873_2549772 Danio rerio annexin A5, mRNA (cDNA clone
           MGC:55312 IMAGE:2600562), complete cds.
          Length = 317

 Score = 32.3 bits (72), Expect = 9.4
 Identities = 23/97 (23%), Positives = 41/97 (42%), Gaps = 8/97 (8%)
 Frame = +3

Query: 186 KRNPRKVKWTKAYRRLHGKDMTQDATFEFERK--------RNRPERFDKNVTENTLKAIK 341
           + N ++ +   AY+ LHGKD+  D   E   K           P  ++     N +K   
Sbjct: 43  RSNGQRQEIKAAYKTLHGKDLVNDLKSELGGKFEDLIVALMTPPIIYEVTCLRNAIKGAG 102

Query: 342 KIDKVRIAREAAHHKNRMRPNKLRKQKEAARELEQGI 452
             +KV I   A+   N +   K   ++E  ++LE+ +
Sbjct: 103 TDEKVLIEILASRSPNEVNEIKSSYKREHDKDLEEDV 139



>gb:AY178799_2516972 Danio rerio annexin 5 mRNA, complete cds.
          Length = 317

 Score = 32.3 bits (72), Expect = 9.4
 Identities = 23/97 (23%), Positives = 41/97 (42%), Gaps = 8/97 (8%)
 Frame = +3

Query: 186 KRNPRKVKWTKAYRRLHGKDMTQDATFEFERK--------RNRPERFDKNVTENTLKAIK 341
           + N ++ +   AY+ LHGKD+  D   E   K           P  ++     N +K   
Sbjct: 43  RSNGQRPEIKAAYKTLHGKDLVNDLKSELGGKFEDLIVALMTPPIIYEVTCLRNAIKGAG 102

Query: 342 KIDKVRIAREAAHHKNRMRPNKLRKQKEAARELEQGI 452
             +KV I   A+   N +   K   ++E  ++LE+ +
Sbjct: 103 TDEKVLIEILASRSPNEVNEIKSSYKREHDKDLEEDV 139



>gb:BC081863_2108110 Rattus norvegicus cDNA clone MGC:93685
           IMAGE:7191298, complete cds.
          Length = 253

 Score = 32.3 bits (72), Expect = 9.4
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
 Frame = +3

Query: 291 PERFDKNVTENTLKAIKKIDKVRIAREA--AHHKNRMRPNKLRKQKEAARELE 443
           PE F + V + T+K   +++  R  REA   H + R R  ++  Q++A RE E
Sbjct: 155 PELFKQAVYKQTMKLFAELEIKRKEREAKEMHERKRQREEEIEAQEKAKRERE 207



>gb:BC066222_2105804 Mus musculus cDNA clone IMAGE:30459247, partial
           cds.
          Length = 255

 Score = 32.3 bits (72), Expect = 9.4
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
 Frame = +3

Query: 291 PERFDKNVTENTLKAIKKIDKVRIAREA--AHHKNRMRPNKLRKQKEAARELE 443
           PE F + V + T+K   +++  R  REA   H + R R  ++  Q++A RE E
Sbjct: 157 PELFKQAVYKQTMKLFAELEIKRKEREAKEMHERKRQREEEIEAQEKAKRERE 209



>gb:BC057191_2102666 Mus musculus DnaJ (Hsp40) homolog, subfamily C,
           member 8, mRNA (cDNA clone IMAGE:5148567), partial cds.
          Length = 252

 Score = 32.3 bits (72), Expect = 9.4
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
 Frame = +3

Query: 291 PERFDKNVTENTLKAIKKIDKVRIAREA--AHHKNRMRPNKLRKQKEAARELE 443
           PE F + V + T+K   +++  R  REA   H + R R  ++  Q++A RE E
Sbjct: 154 PELFKQAVYKQTMKLFAELEIKRKEREAKEMHERKRQREEEIEAQEKAKRERE 206



>gb:AB029919_2044578 Mus musculus STAP mRNA for sperm tail
           associated protein, complete cds.
          Length = 1022

 Score = 32.3 bits (72), Expect = 9.4
 Identities = 25/137 (18%), Positives = 72/137 (52%), Gaps = 1/137 (0%)
 Frame = +3

Query: 138 KIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHGKDMTQDATFEFERKRNRPERFDKNVT 317
           ++ +  +S+ HK   +++   K++  + + R   ++++ + + E +R+ +  E+ +K++ 
Sbjct: 532 EVIKDLQSQLHK---LQKESSKIEEERKHNRQRLQELSSELS-EGQRRLSNAEK-EKSLL 586

Query: 318 ENTL-KAIKKIDKVRIAREAAHHKNRMRPNKLRKQKEAARELEQGIHLVKAPSVLQQDPS 494
           + TL +  KKID++  + + +  K R   N +RK +E   E++  +   +      ++  
Sbjct: 587 QKTLDEDEKKIDELFHSTQVSEQKQRELTNSIRKLEEELLEIKGLLEEKREQLKKSKEQE 646

Query: 495 LTLPIKVKVSQQQSEEK 545
             L  +++  +Q+++ K
Sbjct: 647 KALEEEIEALRQEAKRK 663



>gb:CR456900_1993107 Homo sapiens full open reading frame cDNA clone
           RZPDo834B047D for gene DNAJC8, DnaJ (Hsp40) homolog,
           subfamily C, member 8; complete cds, incl. stopcodon.
          Length = 264

 Score = 32.3 bits (72), Expect = 9.4
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
 Frame = +3

Query: 291 PERFDKNVTENTLKAIKKIDKVRIAREA--AHHKNRMRPNKLRKQKEAARELE 443
           PE F + V + T+K   +++  R  REA   H + R R  ++  Q++A RE E
Sbjct: 166 PELFKQAVYKQTMKLFAELEIKRKEREAKEMHERKRQREEEIEAQEKAKRERE 218



>gb:AL353354_1922722 Human DNA sequence from clone RP3-429K2 on
           chromosome 1p35.3-36.12 Contains the 5' end of the PTAFR
           gene for platelet-activating factor receptor and the 3'
           end of the DNAJC8 gene for DnaJ (Hsp40) homolog,
           subfamily C, member 8, complete
           sequence.>gb:AL353622_1922832 Human DNA sequence from
           clone RP5-1092A3 on chromosome 1 Contains the 5' end of
           the DNAJC8 gene for DnaJ (Hsp40) homolog subfamily C
           member 8, the ATPIF1 gene for ATPase inhibitory factor
           1, the SESN2 gene for sestrin 2, the gene for a novel
           protein (FLJ20045) and a CpG island, complete
           sequence.>gb:BC033159_1980831 Homo sapiens DnaJ (Hsp40)
           homolog, subfamily C, member 8, mRNA (cDNA clone
           MGC:45787 IMAGE:4330676), complete cds.
          Length = 253

 Score = 32.3 bits (72), Expect = 9.4
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
 Frame = +3

Query: 291 PERFDKNVTENTLKAIKKIDKVRIAREA--AHHKNRMRPNKLRKQKEAARELE 443
           PE F + V + T+K   +++  R  REA   H + R R  ++  Q++A RE E
Sbjct: 155 PELFKQAVYKQTMKLFAELEIKRKEREAKEMHERKRQREEEIEAQEKAKRERE 207



>gb:NPL18351_1691074 Nicotiana plumbaginifolia mRNA for U2 snRNP
           auxiliary factor, large subunit 65a.
          Length = 555

 Score = 32.3 bits (72), Expect = 9.4
 Identities = 26/116 (22%), Positives = 49/116 (42%)
 Frame = +3

Query: 99  YPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAYRRLHGKDMTQDATFEFER 278
           Y G+G+    N A  +    S+ H+N +     R  +  K       KD  +D   + +R
Sbjct: 4   YEGNGVDIDNNGASPYSQHISRDHENERDSSRSRDKERDKG----RDKDRDRDRNRDRDR 59

Query: 279 KRNRPERFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQKEAARELEQ 446
            R+R +  DK+         +  D+        HH++R R    R+++E  R+ ++
Sbjct: 60  DRDRVKERDKD---------RHRDRDGEKDRDRHHRDRHRDRSDRRERERTRDRDE 106



>gb:CR548612_1375395 Paramecium tetraurelia macronuclear largest
           chromosome, complete sequence.
          Length = 553

 Score = 32.3 bits (72), Expect = 9.4
 Identities = 37/167 (22%), Positives = 70/167 (41%), Gaps = 28/167 (16%)
 Frame = +3

Query: 138 KIFRFCRSKCHKNFKMKRNPRKV--------KWTKAYRRLHGKDMTQDATFE---FERKR 284
           K F+F +S+     + ++  +K+        K     ++L   D+ Q+  F+    + K+
Sbjct: 326 KSFKFPKSQAQIRVEEEQKMQKLIREQEMEQKKLARLKQLKYADVAQEIYFKEHPVKPKQ 385

Query: 285 NRPERFDKN-------VTENTLKAIKKI----------DKVRIAREAAHHKNRMRPNKLR 413
           + P + D++       VTE  L+ IKK            K  I   + H +NR    +++
Sbjct: 386 SPPPKEDQSKQIKEIQVTEQNLRKIKKFVPQQRHFSHDSKDSITDLSNHQENRPPKPQIK 445

Query: 414 KQKEAARELEQGIHLVKAPSVLQQDPSLTLPIKVKVSQQQSEEKRME 554
           KQ++   + E+   L   P        L    KV+V+ +   EK +E
Sbjct: 446 KQQKVLEKAEKPSELPPKPKTTDYLQQLRQQRKVQVNMEDQWEKIIE 492



>gb:AK088325_1175334 Mus musculus 2 days neonate thymus thymic cells
           cDNA, RIKEN full-length enriched library,
           clone:E430012M21 product:DnaJ (Hsp40) homolog, subfamily
           C, member 8, full insert sequence.
          Length = 293

 Score = 32.3 bits (72), Expect = 9.4
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
 Frame = +3

Query: 291 PERFDKNVTENTLKAIKKIDKVRIAREA--AHHKNRMRPNKLRKQKEAARELE 443
           PE F + V + T+K   +++  R  REA   H + R R  ++  Q++A RE E
Sbjct: 155 PELFKQAVYKQTMKLFAELEIKRKEREAKEMHERKRQREEEIEAQEKAKRERE 207



>gb:AF161449_1150342 Homo sapiens HSPC331 mRNA, partial cds.
          Length = 125

 Score = 32.3 bits (72), Expect = 9.4
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
 Frame = +3

Query: 291 PERFDKNVTENTLKAIKKIDKVRIAREA--AHHKNRMRPNKLRKQKEAARELE 443
           PE F + V + T+K   +++  R  REA   H + R R  ++  Q++A RE E
Sbjct: 27  PELFKQAVYKQTMKLFAELEIKRKEREAKEMHERKRQREEEIEAQEKAKRERE 79



>gb:AF161433_1150326 Homo sapiens HSPC315 mRNA, partial cds.
          Length = 158

 Score = 32.3 bits (72), Expect = 9.4
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
 Frame = +3

Query: 291 PERFDKNVTENTLKAIKKIDKVRIAREA--AHHKNRMRPNKLRKQKEAARELE 443
           PE F + V + T+K   +++  R  REA   H + R R  ++  Q++A RE E
Sbjct: 60  PELFKQAVYKQTMKLFAELEIKRKEREAKEMHERKRQREEEIEAQEKAKRERE 112



>gb:AE014297_1138638 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003682_1220631 Drosophila melanogaster
           chromosome 3R, section 20 of 118 of the complete
           sequence.
          Length = 804

 Score = 32.3 bits (72), Expect = 9.4
 Identities = 34/140 (24%), Positives = 61/140 (43%), Gaps = 17/140 (12%)
 Frame = +3

Query: 129 NDAKIFRFCRSK----CHKNFKMKRNPRKVKWTKAYRRLHGKDMTQ--DATFEFERKRNR 290
           + AK F+F   +    C K   + ++ RK +  KAY+  H K   +    T E  RK++ 
Sbjct: 82  HQAKQFKFNAEQLEVVCDKLTHLSQDKRKAR--KAYQEEHAKIAARLNHLTDEVVRKKSE 139

Query: 291 PE-----------RFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQKEAARE 437
            +           RF++N  +   ++ +K+D VR   + A  K  +  N+       A E
Sbjct: 140 YQKHLEGYKALRTRFEENYIKAPSRSGRKLDDVRDKYQKACRKLHLTHNEYVLSITEAIE 199

Query: 438 LEQGIHLVKAPSVLQQDPSL 497
           +E+    V  P +L+   S+
Sbjct: 200 VEKDFRNVLLPGLLEHQQSV 219



>pir|A39670|OKFFPS protein-tyrosine kinase (EC 2.7.1.112), fps/fes
           homolog - fruit fly (Drosophila
           melanogaster)>gb:DMFPS85D_1379534 Drosophila
           melanogaster dfps 85D mRNA.
          Length = 803

 Score = 32.3 bits (72), Expect = 9.4
 Identities = 34/140 (24%), Positives = 61/140 (43%), Gaps = 17/140 (12%)
 Frame = +3

Query: 129 NDAKIFRFCRSK----CHKNFKMKRNPRKVKWTKAYRRLHGKDMTQ--DATFEFERKRNR 290
           + AK F+F   +    C K   + ++ RK +  KAY+  H K   +    T E  RK++ 
Sbjct: 82  HQAKQFKFNAEQLEVVCDKLTHLSQDKRKAR--KAYQEEHAKIAARLNHLTDEVVRKKSE 139

Query: 291 PE-----------RFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQKEAARE 437
            +           RF++N  +   ++ +K+D VR   + A  K  +  N+       A E
Sbjct: 140 YQKHLEGYKALRTRFEENYIKAPSRSGRKLDDVRDKYQKACRKLHLTHNEYVLSITEAIE 199

Query: 438 LEQGIHLVKAPSVLQQDPSL 497
           +E+    V  P +L+   S+
Sbjct: 200 VEKDFRNVLLPGLLEHQQSV 219



>sp|P18106|FPS_DROME Tyrosine-protein kinase Fps85D (EC 2.7.1.112)
           (dFer).>gb:AE014297_1138639 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE003682_1220632
           Drosophila melanogaster chromosome 3R, section 20 of 118
           of the complete sequence.>gb:BT003462_1356864 Drosophila
           melanogaster RH14840 full insert cDNA.
          Length = 1325

 Score = 32.3 bits (72), Expect = 9.4
 Identities = 34/140 (24%), Positives = 61/140 (43%), Gaps = 17/140 (12%)
 Frame = +3

Query: 129 NDAKIFRFCRSK----CHKNFKMKRNPRKVKWTKAYRRLHGKDMTQ--DATFEFERKRNR 290
           + AK F+F   +    C K   + ++ RK +  KAY+  H K   +    T E  RK++ 
Sbjct: 82  HQAKQFKFNAEQLEVVCDKLTHLSQDKRKAR--KAYQEEHAKIAARLNHLTDEVVRKKSE 139

Query: 291 PE-----------RFDKNVTENTLKAIKKIDKVRIAREAAHHKNRMRPNKLRKQKEAARE 437
            +           RF++N  +   ++ +K+D VR   + A  K  +  N+       A E
Sbjct: 140 YQKHLEGYKALRTRFEENYIKAPSRSGRKLDDVRDKYQKACRKLHLTHNEYVLSITEAIE 199

Query: 438 LEQGIHLVKAPSVLQQDPSL 497
           +E+    V  P +L+   S+
Sbjct: 200 VEKDFRNVLLPGLLEHQQSV 219



>sp|O75937|DJC8_HUMAN DnaJ homolog subfamily C member 8 (Splicing
           protein spf31) (HSPC315).>gb:AF083190_1881607 Homo
           sapiens SPF31 (SPF31) mRNA, complete cds.
          Length = 264

 Score = 32.3 bits (72), Expect = 9.4
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)
 Frame = +3

Query: 291 PERFDKNVTENTLKAIKKIDKVRIAREA--AHHKNRMRPNKLRKQKEAARELE 443
           PE F + V + T+K   +++  R  REA   H + R R  ++  Q++A RE E
Sbjct: 166 PELFKQAVYKQTMKLFAELEIKRKEREAKEMHERKRQREEEIEAQEKAKRERE 218


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 798,125,785
Number of Sequences: 1806583
Number of extensions: 16834993
Number of successful extensions: 55072
Number of sequences better than 10.0: 156
Number of HSP's better than 10.0 without gapping: 52998
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 54976
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 46141821864
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)