BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig4833
         (242 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:CEF54D5_1364445 Caenorhabditis elegans cosmid F54D5, complete...    35   0.34    
pir|T22653|T22653 hypothetical protein F54D5.2 - Caenorhabditis ...    35   0.34    Caenorhabditis elegans [roundworm]
sp|P50817|VL1_HPV48|VL1_HPV48 Major capsid protein L1.>gb:HPU31789_2436174...    32   3.8     Human papillomavirus type 48


>gb:CEF54D5_1364445 Caenorhabditis elegans cosmid F54D5, complete
           sequence.
          Length = 426

 Score = 35.4 bits (80), Expect = 0.34
 Identities = 18/49 (36%), Positives = 31/49 (63%)
 Frame = +1

Query: 7   FPPIHSLLSDQRRMKKD*YSSPFASESQVRSSHLTSSVARYLTTTLQDV 153
           FPP++  L D+++  K  +S P + E  V ++HL  S ++++TT LQ V
Sbjct: 54  FPPLYKSLFDRQKCGKVRFSPPLSLEQNV-NAHLKGSSSQHMTTILQGV 101



>pir|T22653|T22653 hypothetical protein F54D5.2 - Caenorhabditis
           elegans
          Length = 321

 Score = 35.4 bits (80), Expect = 0.34
 Identities = 18/49 (36%), Positives = 31/49 (63%)
 Frame = +1

Query: 7   FPPIHSLLSDQRRMKKD*YSSPFASESQVRSSHLTSSVARYLTTTLQDV 153
           FPP++  L D+++  K  +S P + E  V ++HL  S ++++TT LQ V
Sbjct: 54  FPPLYKSLFDRQKCGKVRFSPPLSLEQNV-NAHLKGSSSQHMTTILQGV 101



>sp|P50817|VL1_HPV48 Major capsid protein L1.>gb:HPU31789_2436174
           Human papillomavirus type 48, complete genome.
          Length = 513

 Score = 32.0 bits (71), Expect = 3.8
 Identities = 23/58 (39%), Positives = 30/58 (51%), Gaps = 3/58 (5%)
 Frame = +1

Query: 61  YSSPFASESQVRSSHLTSSVARYLTTTLQDVVGNRSPL---PRSLSRHTGTDTIHCWG 225
           Y +P +++   RSSHL SSV  Y TT    +  + S L   P  L R  GT+   CWG
Sbjct: 276 YITPDSADQNNRSSHLGSSV--YFTTPSGSLNTSDSQLFNRPYWLRRAQGTNNGICWG 331


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 260,251,302
Number of Sequences: 1806583
Number of extensions: 4483227
Number of successful extensions: 13009
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 12660
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13001
length of database: 581,917,975
effective HSP length: 51
effective length of database: 489,782,242
effective search space used: 14203685018
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)