BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig4808
         (1020 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:CBL458993_1645670 Coleus blumei mRNA for tyrosine aminotransf...   290   4e-77   
gb:AX575733_1470707 Sequence 11 from Patent WO02072848.>gb:AB007...   282   7e-75   
gb:BT000782_1635053 Arabidopsis thaliana clone RAFL07-10-M07 (R1...   279   7e-74   
gb:AP005310_1850345 Oryza sativa (japonica cultivar-group) genom...   212   8e-54   
gb:AP005743_1857002 Oryza sativa (japonica cultivar-group) genom...   209   9e-53   
gb:AB018112_1513780 Arabidopsis thaliana genomic DNA, chromosome...   202   9e-51   
gb:AY054204_1563026 Arabidopsis thaliana At2g20610/F23N11.7 mRNA...   201   2e-50   
pir|C84591|C84591 probable tyrosine aminotransferase [imported] ...   201   2e-50   Arabidopsis thaliana [mouse-ear cress]
gb:AX575731_1470706 Sequence 9 from Patent WO02072848.                199   6e-50   
gb:AF301900_1784278 Arabidopsis thaliana Wassilewskija Ws-2 ROOT...   199   1e-49   
gb:AF301899_1784277 Arabidopsis thaliana Landsberg errecta ROOTY...   199   1e-49   
gb:AK176613_1818601 Arabidopsis thaliana mRNA for tyrosine trans...   189   6e-47   
pir|T04612|T04612 tyrosine transaminase homolog F20O9.100 - Arab...   189   6e-47   Arabidopsis thaliana [mouse-ear cress]
gb:AP004679_1843244 Oryza sativa (japonica cultivar-group) genom...   186   8e-46   
gb:AP004679_1843243 Oryza sativa (japonica cultivar-group) genom...   186   8e-46   
gb:AP005310_1850343 Oryza sativa (japonica cultivar-group) genom...   182   7e-45   
gb:D88273_1675104 Hordeum vulgare naat-A mRNA for nicotianamine ...   182   7e-45   
gb:AB024006_1515688 Hordeum vulgare naat-B and naat-A genes for ...   182   7e-45   
gb:AB024006_1515687 Hordeum vulgare naat-B and naat-A genes for ...   181   2e-44   
gb:AB005788_1509700 Hordeum vulgare mRNA for nicotianamine amino...   180   4e-44   
gb:AY085324_1570396 Arabidopsis thaliana clone 14570 mRNA, compl...   174   2e-42   
gb:AX575729_1470705 Sequence 7 from Patent WO02072848.                174   3e-42   
pir|C84641|C84641 probable tyrosine aminotransferase [imported] ...   171   2e-41   Arabidopsis thaliana [mouse-ear cress]
gb:AK090244_1176197 Mus musculus cDNA, RIKEN full-length enriche...   159   8e-38   
sp|Q8QZR1|ATTY_MOUSE|ATTY_MOUSE Tyrosine aminotransferase (EC 2.6.1.5) (L-t...   159   8e-38   Mus musculus [mouse]
gb:RNO010709_2135343 Rattus norvegicus gene encoding tyrosine am...   158   1e-37   
gb:AX575725_1470703 Sequence 3 from Patent WO02072848.                158   1e-37   
gb:AX575723_1470702 Sequence 1 from Patent WO02072848.                158   1e-37   
sp|P04694|ATTY_RAT|ATTY_RAT Tyrosine aminotransferase (EC 2.6.1.5) (L-tyr...   158   1e-37   Rattus norvegicus [brown rat]
gb:AF163863_1415364 Mustela vison tyrosine aminotransferase gene...   158   2e-37   
gb:AY070389_1566788 Arabidopsis thaliana putative tyrosine trans...   157   3e-37   
pir|T05591|T05591 tyrosine transaminase homolog F9D16.60 - Arabi...   157   3e-37   Arabidopsis thaliana [mouse-ear cress]
gb:RATTATRA_2133964 Rat tyrosine aminotransferase mRNA, complete...   155   1e-36   
gb:BC074414_2557919 Xenopus laevis hypothetical protein LOC44370...   155   2e-36   
gb:BC075603_2558699 Xenopus tropicalis tyrosine aminotransferase...   154   2e-36   
sp|P17735|ATTY_HUMAN|ATTY_HUMAN Tyrosine aminotransferase (EC 2.6.1.5) (L-t...   154   2e-36   Homo sapiens [man]
gb:AY187682_1588170 Brassica oleracea cystine lyase BOCL-3 mRNA,...   151   2e-35   
pir|T05592|T05592 tyrosine transaminase homolog F9D16.70 - Arabi...   146   7e-34   Arabidopsis thaliana [mouse-ear cress]
gb:AE014298_1125623 Drosophila melanogaster chromosome X, comple...   140   4e-32   
gb:AY752843_1179986 Culicoides sonorensis clone CsTAT1 tyrosine ...   135   1e-30   
pir|T22087|T22087 hypothetical protein F42D1.2 - Caenorhabditis ...   119   1e-25   Caenorhabditis elegans [roundworm]
sp|P33447|ATTY_TRYCR|ATTY_TRYCR Tyrosine aminotransferase (EC 2.6.1.5) (L-t...   103   7e-21   Trypanosoma cruzi
gb:AF165323_1246718 Trypanosoma rangeli tyrosine aminotransferas...   100   4e-20   
gb:AE012558_284806 Xylella fastidiosa Temecula1, section 6 of 9 ...    93   1e-17   
gb:AP006878_576246 Thermococcus kodakaraensis strain KOD1 DNA, c...    92   2e-17   
pir|C82564|C82564 aminotransferase XF2396 [imported] - Xylella f...    92   2e-17   Xylella fastidiosa
gb:AE011997_278408 Xanthomonas axonopodis pv. citri str. 306, se...    90   6e-17   
gb:AE012455_282590 Xanthomonas campestris pv. campestris str. AT...    89   1e-16   
gb:AF266241_2483293 Gillichthys seta clone Eh24 tyrosine aminotr...    89   2e-16   
gb:AE010251_261064 Pyrococcus furiosus DSM 3638, section 126 of ...    89   2e-16   
gb:AE014295_311106 Bifidobacterium longum NCC2705, complete genome.    87   4e-16   
gb:AE013598_294795 Xanthomonas oryzae pv. oryzae KACC10331, comp...    85   2e-15   
pir|G81078|G81078 probable transaminase (EC 2.6.1.-) NMB1473 [si...    84   3e-15   Neisseria meningitidis serogroup B
pir|G81863|G81863 probable transaminase (EC 2.6.1.-) NMA1684 [si...    84   5e-15   Neisseria meningitidis serogroup A
gb:BX321864_774697 Nitrosomonas europaea ATCC 19718, complete ge...    83   8e-15   
gb:AE004969_60748 Neisseria gonorrhoeae FA 1090, complete genome.      83   8e-15   
pir|A75128|A75128 probable transaminase (EC 2.6.1.-) aspB-like2 ...    83   1e-14   Pyrococcus abyssi
gb:L78665_139837 Methylobacillus flagellatum aspartate aminotran...    81   4e-14   
pir|D71003|D71003 probable transaminase (EC 2.6.1.-) PH1322 [sim...    81   4e-14   Pyrococcus horikoshii
gb:SAG766852_171248 Streptococcus agalactiae NEM316 complete gen...    80   5e-14   
pir|D72450|D72450 probable aspartate transaminase (EC 2.6.1.1) A...    80   5e-14   Aeropyrum pernix
gb:CP000023_875487 Streptococcus thermophilus LMG 18311, complet...    80   8e-14   
gb:CR543861_103992 Acinetobacter sp. ADP1 complete genome.             80   8e-14   
gb:CP000003_861431 Streptococcus pyogenes MGAS10394, complete ge...    79   1e-13   
gb:BA000034_713245 Streptococcus pyogenes SSI-1 DNA, complete ge...    79   1e-13   
gb:AE016862_351211 Pseudomonas syringae pv. tomato str. DC3000 s...    79   1e-13   
gb:AE010090_259248 Streptococcus pyogenes strain MGAS8232, secti...    79   1e-13   
gb:AE006605_220639 Streptococcus pyogenes M1 GAS, section 134 of...    79   1e-13   
pir|B83293|B83293 transaminase (EC 2.6.1.-) [similarity] - Pseud...    79   1e-13   Pseudomonas aeruginosa
gb:AE016913_355956 Chromobacterium violaceum ATCC 12472 section ...    79   2e-13   
gb:AE016780_331305 Pseudomonas putida KT2440 section 7 of 21 of ...    78   2e-13   
gb:AE006039_214940 Pasteurella multocida subsp. multocida str. P...    78   2e-13   
gb:AF289216_496156 Thermococcus sp. TK1 isolate TK1 alanine amin...    78   3e-13   
gb:AE015009_314123 Streptococcus mutans UA159 section 157 of 185...    77   4e-13   
gb:BX950851_841769 Erwinia carotovora subsp. atroseptica SCRI104...    77   6e-13   
gb:BA000030_702794 Streptomyces avermitilis MA-4680 genomic DNA,...    77   6e-13   
gb:AY596298_634853 Haloarcula marismortui ATCC 43049 chromosome ...    77   6e-13   
pir|H82131|H82131 transaminase (EC 2.6.1.-) [similarity] - Vibri...    76   9e-13   Vibrio cholerae
gb:AE016827_343426 Mannheimia succiniciproducens MBEL55E, comple...    76   1e-12   
sp|P71348|YFBQ_HAEIN|YFBQ_HAEIN Probable aminotransferase HI0286 (EC 2.6.1....    75   2e-12   Haemophilus influenzae
gb:BX571869_787948 Photorhabdus luminescens subsp. laumondii TTO...    75   3e-12   
sp|Q9V0L2|AAT_PYRAB|AAT_PYRAB Aspartate aminotransferase (EC 2.6.1.1) (Tra...    75   3e-12   Pyrococcus abyssi
gb:AE015690_316853 Shewanella oneidensis MR-1 section 239 of 457...    74   4e-12   
gb:AE013096_289015 Thermoanaerobacter tengcongensis MB4, section...    74   4e-12   
gb:BX936398_837232 Yersinia pseudotuberculosis IP32953 genome, c...    74   5e-12   
gb:AL646064_546254 Ralstonia solanacearum GMI1000 chromosome, co...    74   5e-12   
gb:CR555306_108222 Azoarcus sp. EbN1 complete genome.                  74   5e-12   
gb:AY137386_591575 Photorhabdus temperata K122 NADH dehydrogenas...    73   8e-12   
gb:AE014295_312185 Bifidobacterium longum NCC2705, complete genome.    73   8e-12   
gb:AE010232_260820 Pyrococcus furiosus DSM 3638, section 107 of ...    73   8e-12   
pir|D95233|D95233 aminotransferase, class I [imported] - Strepto...    73   8e-12   Streptococcus pneumoniae
sp|Q60317|AAT1_METJA|AAT1_METJA Probable aspartate aminotransferase 1 (EC 2...    73   8e-12   Methanocaldococcus jannaschii
pir|F98097|F98097 aspartate transaminase (EC 2.6.1.1) [imported]...    73   1e-11   Streptococcus pneumoniae R6
pir|AI0797|AI0797 probable aminotransferase STY2561 [imported] -...    73   1e-11   Salmonella enterica subsp. enterica serovar Typhi
gb:AE017333_449115 Bacillus licheniformis DSM 13, complete genom...    72   1e-11   
gb:AE013765_299939 Yersinia pestis KIM section 165 of 415 of the...    72   1e-11   
pir|AD0312|AD0312 aspartate transaminase (EC 2.6.1.1) [imported]...    72   1e-11   Yersinia pestis Nepal516
pir|F91025|F91025 probable aminotransferase [imported] - Escheri...    72   1e-11   Escherichia coli O157:H7
sp|P77727|YFBQ_ECOLI|YFBQ_ECOLI Probable aminotransferase yfbQ (EC 2.6.1.-)...    72   1e-11   Escherichia coli [E. coli]
gb:CR382126_1659204 Kluyveromyces lactis strain NRRL Y-1140 chro...    72   2e-11   
gb:BX572097_798121 Prochlorococcus marinus MIT9313 complete geno...    72   2e-11   
gb:BX571965_791265 Burkholderia pseudomallei strain K96243, chro...    72   2e-11   
gb:BA000031_706387 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    72   2e-11   
gb:BX569692_776073 Synechococcus sp. WH8102 complete genome; seg...    71   3e-11   
gb:AE016951_365367 Enterococcus faecalis V583, section 5 of 11 o...    71   3e-11   
gb:AE016807_337743 Vibrio vulnificus CMCP6 chromosome I section ...    71   3e-11   
pir|C87222|C87222 probable aspartate aminotransferase [imported]...    71   3e-11   Mycobacterium leprae
gb:AY723777_1624183 Saccharomyces cerevisiae clone FLH001648.01X...    71   4e-11   
pir|T37220|T37220 probable transaminase (EC 2.6.1.-) SC2H4.04c [...    71   4e-11   Streptomyces coelicolor
sp|P52892|ALAT_YEAST|ALAT_YEAST Putative alanine aminotransferase (EC 2.6.1...    71   4e-11   Saccharomyces cerevisiae [brewer's yeast]
gb:AE010175_260089 Pyrococcus furiosus DSM 3638, section 50 of 1...    70   5e-11   
pir|E71009|E71009 probable aromatic-amino-acid transaminase (EC ...    70   5e-11   Pyrococcus horikoshii
gb:BA000035_717442 Corynebacterium efficiens YS-314 DNA, complet...    70   7e-11   
gb:AE017241_414535 Mycobacterium avium subsp. paratuberculosis s...    70   7e-11   
gb:AE013003_288022 Thermoanaerobacter tengcongensis MB4, section...    70   7e-11   
pir|H86644|H86644 aspartate aminotransferase [imported] - Lactoc...    70   7e-11   Lactococcus lactis subsp. lactis
gb:CR382134_1667315 Debaryomyces hansenii chromosome B of strain...    70   9e-11   
gb:CR382131_1664643 Yarrowia lipolytica chromosome E of strain C...    70   9e-11   
gb:CP000020_871849 Vibrio fischeri ES114 chromosome I, complete ...    70   9e-11   
gb:BSUB0017_755105 Bacillus subtilis complete genome (section 17...    70   9e-11   
gb:BA000016_673751 Clostridium perfringens str. 13 DNA, complete...    70   9e-11   
gb:CR378671_95982 Photobacterium profundum SS9; segment 9/12.          70   9e-11   
pir|G70010|G70010 probable aspartate transaminase (EC 2.6.1.1) y...    70   9e-11   Bacillus subtilis
sp|Q60013|AAT_STRVG|AAT_STRVG Aspartate aminotransferase (EC 2.6.1.1) (Tra...    69   1e-10   Streptomyces virginiae
gb:AP005393_1851004 Oryza sativa (japonica cultivar-group) genom...    69   2e-10   
gb:BX248360_763393 Corynebacterium diphtheriae gravis NCTC13129,...    69   2e-10   
gb:BA000030_699895 Streptomyces avermitilis MA-4680 genomic DNA,...    68   3e-10   
gb:AP006618_561828 Nocardia farcinica IFM 10152 DNA, complete ge...    68   3e-10   
sp|O33267|AAT_MYCTU|AAT_MYCTU Probable aspartate aminotransferase (EC 2.6....    68   3e-10   Mycobacterium tuberculosis
gb:BA000030_701171 Streptomyces avermitilis MA-4680 genomic DNA,...    68   3e-10   
gb:AP006878_575700 Thermococcus kodakaraensis strain KOD1 DNA, c...    68   3e-10   
gb:CR382133_1666476 Debaryomyces hansenii chromosome A of strain...    67   4e-10   
gb:BX640414_805489 Bordetella pertussis strain Tohama I, complet...    67   4e-10   
gb:AP006878_577420 Thermococcus kodakaraensis strain KOD1 DNA, c...    67   4e-10   
gb:CR382126_1658416 Kluyveromyces lactis strain NRRL Y-1140 chro...    67   6e-10   
gb:BA000039_728141 Thermosynechococcus elongatus BP-1 DNA, compl...    67   7e-10   
gb:BA000028_695778 Oceanobacillus iheyensis HTE831 DNA, complete...    67   7e-10   
gb:AY534910_626190 Uncultured marine group II euryarchaeote Deep...    67   7e-10   
pir|G69119|G69119 probable aspartate transaminase (EC 2.6.1.1) M...    67   7e-10   Methanothermobacter thermautotrophicus str. Delta H
gb:CR380956_1652204 Candida glabrata strain CBS138 chromosome J ...    66   1e-09   
gb:AE016954_366355 Enterococcus faecalis V583, section 8 of 11 o...    66   1e-09   
sp|P52893|ALAM_YEAST|ALAM_YEAST Putative alanine aminotransferase, mitochon...    66   1e-09   Saccharomyces cerevisiae [brewer's yeast]
sp|P23034|AAT_BACY2|AAT_BACY2 Aspartate aminotransferase (EC 2.6.1.1) (Tra...    66   1e-09   Bacillus sp. (in: Bacteria)
sp|O67781|AAT_AQUAE|AAT_AQUAE Aspartate aminotransferase (EC 2.6.1.1) (Tra...    66   1e-09   Aquifex aeolicus
gb:BX640426_809411 Bordetella parapertussis strain 12822, comple...    65   2e-09   
gb:AE017013_379731 Bacillus cereus ATCC 14579 section 16 of 18 o...    65   2e-09   
gb:CR380958_1653601 Candida glabrata strain CBS138 chromosome L ...    65   2e-09   
gb:BX251412_764919 Tropheryma whipplei TW08/27, complete genome;...    65   2e-09   
gb:AE016852_349241 Tropheryma whipplei str. Twist, section 3 of ...    65   2e-09   
gb:SCO939122_178656 Streptomyces coelicolor A3(2) complete genom...    65   2e-09   
gb:SCO939120_178317 Streptomyces coelicolor A3(2) complete genom...    65   2e-09   
gb:AY069814_1294544 Drosophila melanogaster SD05601 full length ...    65   3e-09   
gb:AE014298_1125498 Drosophila melanogaster chromosome X, comple...    65   3e-09   
gb:AE014298_1125497 Drosophila melanogaster chromosome X, comple...    65   3e-09   
gb:AE013248_290573 Methanosarcina mazei strain Goe1, section 30 ...    65   3e-09   
gb:AE013083_288861 Thermoanaerobacter tengcongensis MB4, section...    65   3e-09   
sp|O58489|AAT_PYRHO|AAT_PYRHO Aspartate aminotransferase (EC 2.6.1.1) (Tra...    65   3e-09   Pyrococcus horikoshii
gb:AY087416_1572447 Arabidopsis thaliana clone 35179 mRNA, compl...    64   4e-09   
gb:AY074320_1567477 Arabidopsis thaliana putative aminotransfera...    64   4e-09   
gb:AE017333_447471 Bacillus licheniformis DSM 13, complete genom...    64   4e-09   
gb:AE017310_438648 Desulfovibrio vulgaris subsp. vulgaris str. H...    64   4e-09   
gb:AE016942_363301 Bacteroides thetaiotaomicron VPI-5482, sectio...    64   4e-09   
gb:AE010862_267161 Methanosarcina acetivorans str. C2A, section ...    64   4e-09   
pir|D96806|D96806 probable aminotransferase, 101422-99564 [impor...    64   4e-09   Arabidopsis thaliana [mouse-ear cress]
gb:AE017280_426240 Bacillus cereus ATCC 10987, section 17 of 18 ...    64   5e-09   
gb:AY714840_1189319 Uncultured archaeon GZfos26D6 clone GZfos26D...    64   6e-09   
gb:BX957222_844325 Methanococcus maripaludis S2 complete genome;...    64   6e-09   
gb:AY596297_634631 Haloarcula marismortui ATCC 43049 chromosome ...    64   6e-09   
gb:CP000009_863504 Gluconobacter oxydans 621H, complete genome.        63   8e-09   
gb:CP000001_855226 Bacillus cereus ZK, complete genome.                63   8e-09   
gb:BA000036_720571 Corynebacterium glutamicum ATCC 13032 DNA, co...    63   8e-09   
gb:AY238317_601446 Corynebacterium glutamicum aminotransferase-l...    63   8e-09   
gb:AE017039_385047 Bacillus anthracis str. Ames section 16 of 18...    63   8e-09   
pir|T36548|T36548 probable transaminase (EC 2.6.1.-) SCH10.36 [s...    63   8e-09   Streptomyces coelicolor
pir|D75496|D75496 aspartate transaminase (EC 2.6.1.1) DR0623 [si...    63   8e-09   Deinococcus radiodurans
gb:AP006841_574462 Bacteroides fragilis YCH46 DNA, complete genome.    63   1e-08   
gb:AE016936_361783 Bacteroides thetaiotaomicron VPI-5482, sectio...    63   1e-08   
pir|D97193|D97193 PLP-dependent aminotransferase [imported] - Cl...    63   1e-08   Clostridium acetobutylicum
sp|Q10334|ALAT_SCHPO|ALAT_SCHPO Putative alanine aminotransferase (EC 2.6.1...    63   1e-08   Schizosaccharomyces pombe
gb:AY113694_2512772 Oncorhynchus mykiss tyrosine aminotransferas...    62   1e-08   
gb:CP000001_854367 Bacillus cereus ZK, complete genome.                62   1e-08   
gb:AY288521_606405 Methanococcus voltae aspartate aminotransfera...    62   1e-08   
gb:AE017355_465045 Bacillus thuringiensis serovar konkukian str....    62   1e-08   
gb:AE017307_437594 Thermus thermophilus HB27 section 7 of 7 of t...    62   1e-08   
sp|Q56232|AAT_THETH|AAT_THETH Aspartate aminotransferase (EC 2.6.1.1) (Tra...    62   1e-08   Thermus thermophilus
gb:AE016818_1747979 Ashbya gossypii (= Eremothecium gossypii) AT...    62   2e-08   
gb:AY084890_1569972 Arabidopsis thaliana clone 120310 mRNA, comp...    62   2e-08   
gb:AY714814_1188355 Uncultured archaeon GZfos10C7 clone GZfos10C...    62   2e-08   
gb:AL935255_551126 Lactobacillus plantarum strain WCFS1 complete...    62   2e-08   
gb:AB121092_14964 Thermus thermophilus gene for aminotransferase...    62   2e-08   
pir|G75037|G75037 probable aromatic-amino-acid transaminase (EC ...    62   2e-08   Pyrococcus abyssi
gb:AY058868_1564404 Arabidopsis thaliana At1g23310/F26F24_4 mRNA...    62   2e-08   
gb:BA000016_674710 Clostridium perfringens str. 13 DNA, complete...    62   2e-08   
gb:LILIVR_140513 Listeria ivanovii i-amA, lyrA, i-dapD & i-hipA ...    62   2e-08   
pir|T35706|T35706 probable aspartate transaminase (EC 2.6.1.1) S...    62   2e-08   Streptomyces coelicolor
gb:AF360195_1791149 Arabidopsis thaliana putative alanine aminot...    61   3e-08   
gb:AX481975_1469522 Sequence 1 from Patent WO02055712.>gb:AY0291...    61   3e-08   
gb:AX370365_1466386 Sequence 1 from Patent WO0208400.>gb:AX37036...    61   3e-08   
gb:BA000013_672805 Mesorhizobium loti MAFF303099 pMLa DNA, cpmpl...    61   3e-08   
pir|F95179|F95179 aspartate aminotransferase [imported] - Strept...    61   3e-08   Streptococcus pneumoniae
pir|B86367|B86367 protein F26F24.16 [imported] - Arabidopsis tha...    61   3e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AY206503_2518587 Sparus aurata mitochondrial alanine aminotra...    61   4e-08   
gb:BA000012_668270 Mesorhizobium loti MAFF303099 DNA, complete g...    61   4e-08   
gb:AP006841_571121 Bacteroides fragilis YCH46 DNA, complete genome.    61   4e-08   
gb:AP006618_557020 Nocardia farcinica IFM 10152 DNA, complete ge...    61   4e-08   
gb:AE010808_266737 Methanosarcina acetivorans str. C2A, section ...    61   4e-08   
sp|O14209|YDT4_SCHPO|YDT4_SCHPO Hypothetical aminotransferase C6B12.04c (EC...    61   4e-08   Schizosaccharomyces pombe
gb:BA000030_702404 Streptomyces avermitilis MA-4680 genomic DNA,...    60   5e-08   
gb:AE017229_411493 Mycobacterium avium subsp. paratuberculosis s...    60   5e-08   
gb:AE017037_384188 Bacillus anthracis str. Ames section 14 of 18...    60   5e-08   
gb:CP000027_79735 Dehalococcoides ethenogenes 195, complete genome.    60   5e-08   
pir|G72655|G72655 aspartate transaminase (EC 2.6.1.1) APE0674 [s...    60   5e-08   Aeropyrum pernix
pir|C84268|C84268 aspartate aminotransferase [imported] - Haloba...    60   5e-08   Halobacterium salinarum
pir|H96729|H96729 probable alanine aminotransferase F5A18.24 - A...    60   5e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AK094971_1914277 Homo sapiens cDNA FLJ37652 fis, clone BRHIP2...    60   7e-08   
gb:BA000043_737612 Geobacillus kaustophilus HTA426 DNA, complete...    60   7e-08   
gb:AE017333_448214 Bacillus licheniformis DSM 13, complete genom...    60   7e-08   
gb:AE017277_425261 Bacillus cereus ATCC 10987, section 14 of 18 ...    60   7e-08   
gb:AE016941_363086 Bacteroides thetaiotaomicron VPI-5482, sectio...    60   7e-08   
gb:AE016859_350416 Pseudomonas syringae pv. tomato str. DC3000 s...    60   7e-08   
pir|AD1558|AD1558 aminotransferases (to B. subtilis PatA protein...    60   7e-08   Listeria innocua
gb:SAG766846_170098 Streptococcus agalactiae NEM316 complete gen...    60   9e-08   
pir|F98046|F98046 aspartate transaminase (EC 2.6.1.1) [imported]...    60   9e-08   Streptococcus pneumoniae R6
gb:AE013479_292698 Methanosarcina mazei strain Goe1, section 261...    59   1e-07   
gb:RSTAT5_2138368 Rat TAT gene for tyrosine aminotransferase (EC...    59   2e-07   
gb:CR382130_1662559 Yarrowia lipolytica chromosome D of strain C...    59   2e-07   
gb:BA000016_674947 Clostridium perfringens str. 13 DNA, complete...    59   2e-07   
gb:BA000012_670543 Mesorhizobium loti MAFF303099 DNA, complete g...    59   2e-07   
gb:AL935254_550794 Lactobacillus plantarum strain WCFS1 complete...    59   2e-07   
gb:SAAJ5198_169319 Streptomyces alboniger stgA, stgU and stgR ge...    59   2e-07   
gb:BT007934_2150866 Synthetic construct Homo sapiens glutamic-py...    59   2e-07   
gb:HUMAAT_2028934 Human mRNA for alanine aminotransferase.             59   2e-07   
gb:BC018207_1976467 Homo sapiens glutamic-pyruvate transaminase ...    59   2e-07   
gb:AE016820_1750038 Ashbya gossypii (= Eremothecium gossypii) AT...    59   2e-07   
gb:BA000045_743191 Gloeobacter violaceus PCC 7421 DNA, complete ...    59   2e-07   
gb:BA000043_739505 Geobacillus kaustophilus HTA426 DNA, complete...    59   2e-07   
gb:AY596297_632657 Haloarcula marismortui ATCC 43049 chromosome ...    59   2e-07   
gb:AE017320_441465 Desulfovibrio vulgaris subsp. vulgaris str. H...    59   2e-07   
gb:AE016932_360844 Bacteroides thetaiotaomicron VPI-5482, sectio...    59   2e-07   
gb:AE014295_311995 Bifidobacterium longum NCC2705, complete genome.    59   2e-07   
pir|E97124|E97124 aspartate Aminotransferase [imported] - Clostr...    59   2e-07   Clostridium acetobutylicum
pir|C69672|C69672 probable aspartate transaminase (EC 2.6.1.-) p...    59   2e-07   Bacillus subtilis
sp|P16524|PATA_BACSU|PATA_BACSU Putative aminotransferase A (EC 2.6.1.-).>g...    59   2e-07   Bacillus subtilis
sp|P24298|ALAT_HUMAN|ALAT_HUMAN Alanine aminotransferase (EC 2.6.1.2) (Glut...    59   2e-07   Homo sapiens [man]
gb:AL935257_551506 Lactobacillus plantarum strain WCFS1 complete...    58   3e-07   
gb:AE017002_376481 Bacillus cereus ATCC 14579 section 5 of 18 of...    58   3e-07   
gb:AE014145_303937 Streptococcus pyogenes MGAS315, section 10 of...    58   3e-07   
gb:AE010004_258268 Streptococcus pyogenes strain MGAS8232, secti...    58   3e-07   
gb:AE006519_219738 Streptococcus pyogenes M1 GAS, section 48 of ...    58   3e-07   
gb:CR522870_100292 Desulfotalea psychrophila LSv54 chromosome.         58   3e-07   
pir|F84208|F84208 aspartate aminotransferase [imported] - Haloba...    58   3e-07   Halobacterium salinarum
pir|F69452|F69452 probable aspartate transaminase (EC 2.6.1.1) a...    58   3e-07   Archaeoglobus fulgidus
pir|A40465|A40465 alanine transaminase (EC 2.6.1.2), cytosolic -...    58   3e-07   Homo sapiens [man]
gb:BC074194_2557710 Xenopus laevis MGC82097 protein, mRNA (cDNA ...    58   3e-07   
gb:AL646064_546322 Ralstonia solanacearum GMI1000 chromosome, co...    58   3e-07   
gb:AE017291_433254 Leptospira interrogans serovar Copenhageni st...    58   3e-07   
gb:AE017269_422902 Bacillus cereus ATCC 10987, section 6 of 18 o...    58   3e-07   
gb:AE008692_241465 Zymomonas mobilis subsp. mobilis ZM4, complet...    58   3e-07   
gb:MLO672114_148685 Mesorhizobium loti R7A symbiosis island; seg...    58   3e-07   
pir|S07088|S07088 aspartate transaminase (EC 2.6.1.1) - Sulfolob...    58   3e-07   Saccharolobus solfataricus
pir|E70338|E70338 probable aspartate transaminase (EC 2.6.1.1) a...    58   3e-07   Aquifex aeolicus
sp|O33822|AAT_THEAQ|AAT_THEAQ Aspartate aminotransferase (EC 2.6.1.1) (Tra...    58   3e-07   Thermus aquaticus
sp|P14909|AAT_SULSO|AAT_SULSO Aspartate aminotransferase (EC 2.6.1.1) (Tra...    58   3e-07   Saccharolobus solfataricus
sp|P36692|AAT_STRGR|AAT_STRGR Probable aspartate aminotransferase (EC 2.6....    58   3e-07   Streptomyces griseus
gb:AP005551_1853949 Oryza sativa (japonica cultivar-group) genom...    57   5e-07   
gb:NCB23E9_1689734 Neurospora crassa DNA linkage group II BAC cl...    57   5e-07   
gb:AP006841_572114 Bacteroides fragilis YCH46 DNA, complete genome.    57   5e-07   
gb:AE017325_443455 Listeria monocytogenes str. 4b F2365, section...    57   5e-07   
gb:AE017011_378885 Bacillus cereus ATCC 14579 section 14 of 18 o...    57   5e-07   
gb:AE011467_273288 Leptospira interrogans serovar lai str. 56601...    57   5e-07   
pir|T51918|T51918 hypothetical protein B23I11.300 [imported] - N...    57   5e-07   Neurospora crassa
pir|AF1200|AF1200 aminotransferases (to B. subtilis PatA protein...    57   5e-07   Listeria monocytogenes
gb:AP003235_1825908 Oryza sativa (japonica cultivar-group) genom...    57   6e-07   
gb:AK075894_1171084 Mus musculus adult male tongue cDNA, RIKEN f...    57   6e-07   
gb:AK033424_1163327 Mus musculus adult male colon cDNA, RIKEN fu...    57   6e-07   
gb:AE014295_311173 Bifidobacterium longum NCC2705, complete genome.    57   6e-07   
gb:AE013186_289998 Thermoanaerobacter tengcongensis MB4, section...    57   6e-07   
gb:AE008692_241688 Zymomonas mobilis subsp. mobilis ZM4, complet...    57   6e-07   
gb:CP000024_875892 Streptococcus thermophilus CNRZ1066, complete...    57   8e-07   
gb:CP000023_874004 Streptococcus thermophilus LMG 18311, complet...    57   8e-07   
gb:BA000043_738749 Geobacillus kaustophilus HTA426 DNA, complete...    57   8e-07   
gb:SME591784_184573 Sinorhizobium meliloti 1021 complete chromos...    57   8e-07   
gb:AB063283_8798 Phormidium lapideum aspC gene for aspartate ami...    57   8e-07   
pir|AI1683|AI1683 aspartate aminotransferases homolog aspB [impo...    57   8e-07   
gb:BC088407_2110531 Rattus norvegicus glutamic pyruvate transami...    56   1e-06   
gb:BC034219_2097609 Mus musculus glutamic pyruvate transaminase ...    56   1e-06   
gb:AP004342_1840512 Oryza sativa (japonica cultivar-group) genom...    56   1e-06   
gb:AY236227_1592019 Oryza sativa (indica cultivar-group) alanine...    56   1e-06   
gb:CP000009_863116 Gluconobacter oxydans 621H, complete genome.        56   1e-06   
gb:AE017180_399360 Geobacter sulfurreducens PCA, complete genome.      56   1e-06   
gb:AE017029_381746 Bacillus anthracis str. Ames section 6 of 18 ...    56   1e-06   
pir|C97623|C97623 aspartate aminotransferase A (transaminase A) ...    56   1e-06   
sp|P47039|YJG0_YEAST|YJG0_YEAST Hypothetical aminotransferase YJL060W (EC 2...    56   1e-06   
gb:BX571657_777716 Wolinella succinogenes, complete genome; segm...    56   1e-06   
gb:AE016791_334079 Pseudomonas putida KT2440 section 18 of 21 of...    56   1e-06   
gb:AE015940_320422 Clostridium tetani E88, section 5 of 10 of th...    56   1e-06   
gb:CP000033_89132 Lactobacillus acidophilus NCFM, complete genome.     56   1e-06   
pir|AI2771|AI2771 aminotransferase, class I [imported] - Agrobac...    56   1e-06   
pir|C83924|C83924 aspartate aminotransferase BH2195 [imported] -...    56   1e-06   
pir|H97551|H97551 probable aminotransferase aatc [imported] - Ag...    56   1e-06   
gb:BC061955_2553335 Danio rerio similar to glutamic pyruvate tra...    55   2e-06   
gb:BX572091_796300 Prochlorococcus marinus MED4 complete genome;...    55   2e-06   
gb:BA000013_672808 Mesorhizobium loti MAFF303099 pMLa DNA, cpmpl...    55   2e-06   
gb:AE017282_428781 Methylococcus capsulatus str. Bath, complete ...    55   2e-06   
gb:AE016952_365743 Enterococcus faecalis V583, section 6 of 11 o...    55   2e-06   
pir|A83171|A83171 probable aminotransferase PA3798 [imported] - ...    55   2e-06   
pir|S75949|S75949 probable aspartate transaminase (EC 2.6.1.1) a...    55   2e-06   
gb:BC055182_2551264 Danio rerio zgc:63644, mRNA (cDNA clone MGC:...    55   2e-06   
gb:AY872142_2150306 Synthetic construct hypothetical protein (FT...    55   2e-06   
gb:AJ749949_531622 Francisella tularensis subsp. tularensis comp...    55   2e-06   
gb:AE017180_398392 Geobacter sulfurreducens PCA, complete genome.      55   2e-06   
sp|P52894|ALA2_HORVU|ALA2_HORVU Alanine aminotransferase 2 (EC 2.6.1.2) (GP...    55   2e-06   
gb:AY774385_2149098 Synthetic construct Francisella tularensis c...    55   3e-06   
gb:RATAAT_2131353 Rattus norvegicus mRNA for alanine aminotransf...    55   3e-06   
gb:BC022625_2093823 Mus musculus glutamic pyruvic transaminase 1...    55   3e-06   
gb:AY664419_1620656 Zea mays cultivar Mo17 locus 9009, complete ...    55   3e-06   
gb:AY664415_1620618 Zea mays cultivar B73 locus 9009, complete s...    55   3e-06   
gb:AJ749949_531870 Francisella tularensis subsp. tularensis comp...    55   3e-06   
gb:AF031938_471077 Sinorhizobium meliloti hypothetical protein (...    55   3e-06   
gb:REU80928_163307 Rhizobium etli strain CFN42 symbiotic plasmid...    55   3e-06   
pir|G83861|G83861 aspartate aminotransferase aspB [imported] - B...    55   3e-06   
pir|H83766|H83766 aspartate aminotransferase BH0936 [imported] -...    55   3e-06   
pir|H84220|H84220 aspartate aminotransferase [imported] - Haloba...    55   3e-06   
sp|P25409|ALAT_RAT|ALAT_RAT Alanine aminotransferase (EC 2.6.1.2) (Glutam...    55   3e-06   
sp|Q8QZR5|ALAT_MOUSE|ALAT_MOUSE Alanine aminotransferase (EC 2.6.1.2) (Glut...    55   3e-06   
gb:AE017348_1758317 Cryptococcus neoformans var. neoformans JEC2...    54   4e-06   
gb:AY042902_1560967 Arabidopsis thaliana alanine aminotransferas...    54   4e-06   
gb:AB010074_1510961 Arabidopsis thaliana genomic DNA, chromosome...    54   4e-06   
gb:AB007404_1510100 Oryza sativa gene for alanine aminotransfera...    54   4e-06   
gb:AE016959_1022368 Oryza sativa (japonica cultivar-group) chrom...    54   4e-06   
gb:BX957222_844649 Methanococcus maripaludis S2 complete genome;...    54   4e-06   
gb:BX950851_842223 Erwinia carotovora subsp. atroseptica SCRI104...    54   4e-06   
gb:AE017164_395474 Prochlorococcus marinus subsp. marinus str. C...    54   4e-06   
gb:CR522870_101010 Desulfotalea psychrophila LSv54 chromosome.         54   4e-06   
pir|AE2641|AE2641 aspartate aminotransferase [imported] - Agroba...    54   4e-06   
pir|G97423|G97423 probable aspartate transaminase (EC 2.6.1.1) T...    54   4e-06   
pir|B70815|B70815 probable transaminase (EC 2.6.1.-) Rv0858c [si...    54   4e-06   
pir|A75490|A75490 probable transaminase (EC 2.6.1.-) DR0671 [sim...    54   4e-06   
pir|A69516|A69516 probable aspartate transaminase (EC 2.6.1.1) a...    54   4e-06   
gb:AY659335_2148345 Synthetic construct Peudomonas aeruginosa cl...    54   5e-06   
gb:AB086353_1524549 Brassica oleracea BO-ACS2 mRNA for 1-aminocy...    54   5e-06   
gb:AX063831_1458829 Sequence 113 from Patent WO0100843.>gb:AX064...    54   5e-06   
gb:BA000040_732621 Bradyrhizobium japonicum USDA 110 DNA, comple...    54   5e-06   
gb:BA000036_718541 Corynebacterium glutamicum ATCC 13032 DNA, co...    54   5e-06   
gb:AY238318_601447 Corynebacterium glutamicum aminotransferase-l...    54   5e-06   
gb:AP008231_581260 Synechococcus elongatus PCC 6301 DNA, complet...    54   5e-06   
gb:AE017312_439094 Desulfovibrio vulgaris subsp. vulgaris str. H...    54   5e-06   
gb:AE014295_312395 Bifidobacterium longum NCC2705, complete genome.    54   5e-06   
gb:AB042239_6670 Streptococcus criceti orf1, orf2, orf3, paaA, o...    54   5e-06   
sp|O87320|AATC_RHIME|AATC_RHIME Putative aminotransferase aatC (EC 2.6.1.-)...    54   5e-06   
gb:AF055898_1764641 Zea mays alanine aminotransferase (alt) gene...    54   7e-06   
gb:AP006618_556951 Nocardia farcinica IFM 10152 DNA, complete ge...    54   7e-06   
gb:AL646062_546024 Ralstonia solanacearum GMI1000 chromosome, co...    54   7e-06   
gb:AE011691_275590 Xanthomonas axonopodis pv. citri str. 306, se...    54   7e-06   
pir|E97248|E97248 PLP-dependent aminotransferase [imported] - Cl...    54   7e-06   
pir|AH2346|AH2346 hypothetical protein all4327 [imported] - Nost...    54   7e-06   
sp|P34106|ALA2_PANMI|ALA2_PANMI Alanine aminotransferase 2 (EC 2.6.1.2) (GP...    54   7e-06   
gb:FRU17462_2572069 Fugu rubripes CCBL1 gene, exons 1 to 12.           53   9e-06   
gb:BX640429_810248 Bordetella parapertussis strain 12822, comple...    53   9e-06   
gb:AY596297_632825 Haloarcula marismortui ATCC 43049 chromosome ...    53   9e-06   
gb:AF025665_470136 Thermus aquaticus aspartate aminotransferase ...    53   9e-06   
gb:AE017328_444347 Listeria monocytogenes str. 4b F2365, section...    53   9e-06   
pir|AI1311|AI1311 aspartate aminotransferases homolog aspB [impo...    53   9e-06   
sp|Q59228|AAT_BACST|AAT_BACST Aspartate aminotransferase (EC 2.6.1.1) (Tra...    53   9e-06   
sp|P53001|AAT1_BACSU|AAT1_BACSU Aspartate aminotransferase (EC 2.6.1.1) (Tr...    53   9e-06   
gb:AP004308_1839994 Oryza sativa (japonica cultivar-group) genom...    53   1e-05   
gb:AY714864_1190233 Uncultured archaeon GZfos35B7 clone GZfos35B...    53   1e-05   
gb:BA000045_744183 Gloeobacter violaceus PCC 7421 DNA, complete ...    53   1e-05   
gb:BA000043_737529 Geobacillus kaustophilus HTA426 DNA, complete...    53   1e-05   
gb:AP006627_565231 Bacillus clausii KSM-K16 DNA, complete genome.      53   1e-05   
gb:AL646083_549602 Ralstonia solanacearum GMI1000 megaplasmid, c...    53   1e-05   
gb:AL646067_546939 Ralstonia solanacearum GMI1000 chromosome, co...    53   1e-05   
gb:AF035157_471354 Lactococcus lactis aspartate aminotransferase...    53   1e-05   
gb:AE010757_266294 Methanosarcina acetivorans str. C2A, section ...    53   1e-05   
gb:CP000030_83473 Anaplasma marginale str. St. Maries, complete ...    53   1e-05   
gb:CP000026_76907 Salmonella enterica subsp. enterica serovar Pa...    53   1e-05   
pir|G87420|G87420 aminotransferase, class I [imported] - Cauloba...    53   1e-05   
pir|AE0576|AE0576 probable aminotransferase STY0647 [imported] -...    53   1e-05   
sp|P77806|YBDL_ECOLI|YBDL_ECOLI Hypothetical aminotransferase ybdL (EC 2.6....    53   1e-05   
sp|O86459|AAT_RHILP|AAT_RHILP Aspartate aminotransferase (EC 2.6.1.1) (Tra...    53   1e-05   
sp|P39643|AAT2_BACSU|AAT2_BACSU Probable aspartate aminotransferase (EC 2.6...    53   1e-05   
gb:BT000463_1634741 Arabidopsis thaliana ACC synthase; 1-aminocy...    52   1e-05   
gb:CP000024_876657 Streptococcus thermophilus CNRZ1066, complete...    52   1e-05   
gb:BA000011_665304 Thermoplasma volcanium GSS1 DNA, complete gen...    52   1e-05   
gb:AF146529_483214 Lactococcus lactis subsp. cremoris aromatic a...    52   1e-05   
gb:AE016911_355412 Chromobacterium violaceum ATCC 12472 section ...    52   1e-05   
gb:AE014291_308351 Brucella suis 1330 chromosome I, complete seq...    52   1e-05   
gb:AE011571_274415 Leptospira interrogans serovar lai str. 56601...    52   1e-05   
pir|F86853|F86853 aspartate transaminase (EC 2.6.1.1) [imported]...    52   1e-05   
gb:BPE9834_749729 Bordetella pertussis diaminopimelic acid biosy...    52   2e-05   
gb:BA000028_696669 Oceanobacillus iheyensis HTE831 DNA, complete...    52   2e-05   
gb:AY834753_647055 Cystobacter fuscus cystothiazole A gene clust...    52   2e-05   
gb:AE017300_435487 Leptospira interrogans serovar Copenhageni st...    52   2e-05   
gb:AE012861_286443 Chlorobium tepidum TLS section 82 of 194 of t...    52   2e-05   
gb:AE009866_256686 Pyrobaculum aerophilum strain IM2 section 121...    52   2e-05   
gb:CR555306_107613 Azoarcus sp. EbN1 complete genome.                  52   2e-05   
gb:AE005674_70097 Shigella flexneri 2a str. 301, complete genome...    52   2e-05   
pir|G87340|G87340 aminotransferase, class I [imported] - Cauloba...    52   2e-05   
pir|C85559|C85559 probable aminotransferase ybdL [imported] - Es...    52   2e-05   
gb:AY342007_1600813 Capsicum annuum alanine aminotransferase (Al...    52   2e-05   
gb:AK042391_1166294 Mus musculus 3 days neonate thymus cDNA, RIK...    52   2e-05   
gb:CP000023_874742 Streptococcus thermophilus LMG 18311, complet...    52   2e-05   
gb:CP000010_866021 Burkholderia mallei ATCC 23344 chromosome 1, ...    52   2e-05   
gb:BX572606_803944 Rhodopseudomonas palustris CGA009 complete ge...    52   2e-05   
gb:BX571965_791021 Burkholderia pseudomallei strain K96243, chro...    52   2e-05   
gb:AE014291_308919 Brucella suis 1330 chromosome I, complete seq...    52   2e-05   
gb:LJO548422_140744 Lactobacillus johnsonii aspC gene for PLP-de...    52   2e-05   
gb:CR543861_104433 Acinetobacter sp. ADP1 complete genome.             52   2e-05   
pir|H64603|H64603 probable aspartate transaminase (EC 2.6.1.1) P...    52   2e-05   
sp|Q8BTY1|KAT1_MOUSE|KAT1_MOUSE Kynurenine--oxoglutarate transaminase I (EC...    52   2e-05   
sp|Q92JE7|AAT_RICCN|AAT_RICCN Aspartate aminotransferase (EC 2.6.1.1) (Tra...    52   2e-05   
gb:AE017314_439905 Desulfovibrio vulgaris subsp. vulgaris str. H...    51   3e-05   
gb:AE014295_310787 Bifidobacterium longum NCC2705, complete genome.    51   3e-05   
pir|E87439|E87439 aspartate aminotransferase [imported] - Caulob...    51   3e-05   
sp|P58350|AAB1_RHIME|AAB1_RHIME Aspartate aminotransferase B (EC 2.6.1.1) (...    51   3e-05   
gb:BC021262_1977461 Homo sapiens cysteine conjugate-beta lyase; ...    51   4e-05   
gb:AL441992_1927247 Human DNA sequence from clone RP11-545E17 on...    51   4e-05   
gb:MSU03294_1687244 Malus sylvestris 1-aminocyclopropane-1-carbo...    51   4e-05   
gb:AB038558_1519241 Cucurbita maxima CM-ACS4 mRNA for ACC syntha...    51   4e-05   
gb:BA000040_735676 Bradyrhizobium japonicum USDA 110 DNA, comple...    51   4e-05   
gb:AE013598_297701 Xanthomonas oryzae pv. oryzae KACC10331, comp...    51   4e-05   
gb:CP000033_89206 Lactobacillus acidophilus NCFM, complete genome.     51   4e-05   
pir|AD3384|AD3384 aspartate transaminase (EC 2.6.1.1) [imported]...    51   4e-05   
pir|B84617|B84617 hypothetical protein At2g22810 [imported] - Ar...    51   4e-05   
sp|Q16773|KAT1_HUMAN|KAT1_HUMAN Kynurenine--oxoglutarate transaminase I (EC...    51   4e-05   
sp|P61003|HIS8_METMP|HIS8_METMP Histidinol-phosphate aminotransferase (EC 2...    51   4e-05   
sp|Q06191|AAB2_RHIME|AAB2_RHIME Aspartate aminotransferase B (EC 2.6.1.1) (...    51   4e-05   
gb:AY659294_2148304 Synthetic construct Peudomonas aeruginosa cl...    50   6e-05   
gb:S74029_2139203 kynurenine aminotransferase [rats, kidney, mRN...    50   6e-05   
gb:AE017347_1757782 Cryptococcus neoformans var. neoformans JEC2...    50   6e-05   
gb:MDO011518_1685942 Malus domestica acc synthase gene, exons 1-...    50   6e-05   
gb:AY084599_1569687 Arabidopsis thaliana clone 112880 mRNA, comp...    50   6e-05   
gb:AC007168_1535426 Arabidopsis thaliana chromosome 2 clone T26C...    50   6e-05   
gb:BA000035_717270 Corynebacterium efficiens YS-314 DNA, complet...    50   6e-05   
gb:AP002086_554387 Agrobacterium rhizogenes plasmid pRi1724 DNA,...    50   6e-05   
gb:AL935252_550336 Lactobacillus plantarum strain WCFS1 complete...    50   6e-05   
gb:AE016827_342877 Mannheimia succiniciproducens MBEL55E, comple...    50   6e-05   
gb:AE014291_308706 Brucella suis 1330 chromosome I, complete seq...    50   6e-05   
gb:SME591790_186521 Sinorhizobium meliloti 1021 complete chromos...    50   6e-05   
gb:CP000031_86169 Silicibacter pomeroyi DSS-3, complete genome.        50   6e-05   
pir|E84610|E84610 probable aspartate aminotransferase [imported]...    50   6e-05   
pir|AF3342|AF3342 probable aminotransferase aatc (EC 2.6.1.-) [i...    50   6e-05   
pir|AF2151|AF2151 aminotransferase [imported] - Nostoc sp. (stra...    50   6e-05   
pir|AC1472|AC1472 aminotransferase homolog lin0314 [imported] - ...    50   6e-05   
pir|C97876|C97876 aspartate transaminase (EC 2.6.1.1) [imported]...    50   6e-05   
pir|H71909|H71909 probable aspartate transaminase (EC 2.6.1.1) a...    50   6e-05   
sp|Q9X0Y2|AAT_THEMA|AAT_THEMA Aspartate aminotransferase (EC 2.6.1.1) (Tra...    50   6e-05   
gb:AY206502_2518586 Sparus aurata cytosolic alanine aminotransfe...    50   7e-05   
gb:AF100154_2054470 Rattus norvegicus kynurenine aminotransferas...    50   7e-05   
gb:AF312737_1785208 Malus x domestica ACC synthase mRNA, partial...    50   7e-05   
gb:AF275372_1782536 Arabidopsis thaliana alanine aminotransferas...    50   7e-05   
gb:ACU86865_1745474 Actinidia chinensis 1-aminocyclopropane-1-ca...    50   7e-05   
gb:AY039970_1560476 Arabidopsis thaliana putative alanine aminot...    50   7e-05   
gb:AY035086_1559858 Arabidopsis thaliana putative alanine aminot...    50   7e-05   
gb:AB010102_1511036 Malus x domestica gene for 1-aminocyclopropa...    50   7e-05   
gb:AB007449_1510102 Actinidia deliciosa mRNA for 1-aminocyclopro...    50   7e-05   
gb:BX572601_802116 Rhodopseudomonas palustris CGA009 complete ge...    50   7e-05   
gb:BA000040_732065 Bradyrhizobium japonicum USDA 110 DNA, comple...    50   7e-05   
gb:BA000012_666130 Mesorhizobium loti MAFF303099 DNA, complete g...    50   7e-05   
gb:AL646080_549068 Ralstonia solanacearum GMI1000 megaplasmid, c...    50   7e-05   
gb:AL646060_545638 Ralstonia solanacearum GMI1000 chromosome, co...    50   7e-05   
pir|D83057|D83057 probable aminotransferase PA4722 [imported] - ...    50   7e-05   
pir|D86309|D86309 hypothetical protein T13M22.3 [imported] - Ara...    50   7e-05   
sp|P37821|1A1C_MALDO|1A1C_MALDO 1-aminocyclopropane-1-carboxylate synthase ...    50   7e-05   
gb:AY338236_1600436 Oryza sativa (japonica cultivar-group) putat...    50   9e-05   
gb:BX950851_838983 Erwinia carotovora subsp. atroseptica SCRI104...    50   9e-05   
gb:BX321858_773114 Nitrosomonas europaea ATCC 19718, complete ge...    50   9e-05   
gb:BA000028_694807 Oceanobacillus iheyensis HTE831 DNA, complete...    50   9e-05   
gb:BA000012_666703 Mesorhizobium loti MAFF303099 DNA, complete g...    50   9e-05   
gb:AY150561_592576 Wolbachia endosymbiont of Tunga penetrans asp...    50   9e-05   
gb:AF412406_508251 Wolbachia endosymbiont of Brugia malayi aspar...    50   9e-05   
gb:AE016777_330297 Pseudomonas putida KT2440 section 4 of 21 of ...    50   9e-05   
gb:AE015940_320436 Clostridium tetani E88, section 5 of 10 of th...    50   9e-05   
gb:AE012220_280468 Xanthomonas campestris pv. campestris str. AT...    50   9e-05   
gb:AE011869_277246 Xanthomonas axonopodis pv. citri str. 306, se...    50   9e-05   
pir|D97521|D97521 probable aspartate transaminase (EC 2.6.1.1) a...    50   9e-05   
pir|S31442|S31442 1-aminocyclopropane-1-carboxylate synthase (EC...    50   9e-05   
sp|Q8TVG3|HIS8_METKA|HIS8_METKA Histidinol-phosphate aminotransferase (EC 2...    50   9e-05   
sp|Q7VQW9|HIS8_CANBF|HIS8_CANBF Histidinol-phosphate aminotransferase (EC 2...    50   9e-05   
gb:AY774024_2148737 Synthetic construct Francisella tularensis c...    49   1e-04   
gb:AF531480_1809327 Averrhoa carambola 1-aminocyclopropane-1-car...    49   1e-04   
gb:AF074929_1766129 Sinapis arvensis 1-aminocyclopropane-1-carbo...    49   1e-04   
gb:AJ749949_531341 Francisella tularensis subsp. tularensis comp...    49   1e-04   
gb:AE017312_439282 Desulfovibrio vulgaris subsp. vulgaris str. H...    49   1e-04   
gb:AE017261_420126 Picrophilus torridus DSM 9790, complete genome.     49   1e-04   
gb:AE016860_350873 Pseudomonas syringae pv. tomato str. DC3000 s...    49   1e-04   
gb:AE013444_292371 Methanosarcina mazei strain Goe1, section 226...    49   1e-04   
gb:AE012470_282729 Xanthomonas campestris pv. campestris str. AT...    49   1e-04   
gb:TACID3_196528 Thermoplasma acidophilum complete genome; segme...    49   1e-04   
gb:TACID2_196299 Thermoplasma acidophilum complete genome; segme...    49   1e-04   
pir|F97111|F97111 PLP-dependent aminotransferase [imported] - Cl...    49   1e-04   
pir|T06024|T06024 1-aminocyclopropane-1-carboxylate synthase (EC...    49   1e-04   
pir|T09734|T09734 1-aminocyclopropane-1-carboxylate synthase (EC...    49   1e-04   
pir|T08064|T08064 alanine transaminase (EC 2.6.1.2) - Chlamydomo...    49   1e-04   
gb:AF043122_1763676 Lycopersicon esculentum ACC synthase (LE-ACS...    49   2e-04   
gb:AY388987_1604377 Pyrus communis 1-aminocyclopropane-1-carboxy...    49   2e-04   
gb:CP000025_878608 Campylobacter jejuni RM1221, complete genome.       49   2e-04   
gb:BX897699_827764 Bartonella henselae strain Houston-1, complet...    49   2e-04   
gb:BA000040_728875 Bradyrhizobium japonicum USDA 110 DNA, comple...    49   2e-04   
gb:BA000035_716994 Corynebacterium efficiens YS-314 DNA, complet...    49   2e-04   


>gb:CBL458993_1645670 Coleus blumei mRNA for tyrosine aminotransferase
            (tat gene).
          Length = 411

 Score =  290 bits (741), Expect = 4e-77
 Identities = 141/201 (70%), Positives = 167/201 (83%)
 Frame = +1

Query: 418  EKKQTRGEIETPTNITIKGILGLLMANIEGSEGDDSKKVISLGMGDPTAYSCFHSPALAQ 597
            E + +  E+E PT ITIKGILGLLMAN +  E  + K+VISLG+GDPTAYSCFH+   AQ
Sbjct: 2    ELQNSAQEMEAPTTITIKGILGLLMANTDAKE--NGKRVISLGIGDPTAYSCFHASNAAQ 59

Query: 598  QAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALS 777
            + V + L S KFNGY+PT GLPQTR+AIA+YLSRDLP K+ A+ VYVTAGCTQAIE ALS
Sbjct: 60   EGVVECLRSAKFNGYAPTAGLPQTRQAIAEYLSRDLPYKLPAESVYVTAGCTQAIEIALS 119

Query: 778  ILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIAVV 957
            +LA PGANILLPRP FPIY LCA+FR++EVRY+DL PEK WEVDL AVE LAD NT+A+V
Sbjct: 120  VLARPGANILLPRPCFPIYGLCASFRNIEVRYFDLHPEKGWEVDLQAVEDLADHNTVAMV 179

Query: 958  IINPGNPCGNVYTYQHRQEIA 1020
            IINPGNPCGNVY+YQH +++A
Sbjct: 180  IINPGNPCGNVYSYQHLKKVA 200



>gb:AX575733_1470707 Sequence 11 from Patent
            WO02072848.>gb:AB007644_1510136 Arabidopsis thaliana
            genomic DNA, chromosome 5, TAC
            clone:K19P17.>gb:BT001912_1635515 Arabidopsis thaliana
            clone C105108 putative tyrosine aminotransferase
            (At5g53970) mRNA, complete cds.
          Length = 414

 Score =  282 bits (722), Expect = 7e-75
 Identities = 135/191 (70%), Positives = 161/191 (84%)
 Frame = +1

Query: 448  TPTNITIKGILGLLMANIEGSEGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSY 627
            T + ITIKGIL LLM +I   E +  K+VISLGMGDPT YSCF +  ++ QAVSD+L S 
Sbjct: 7    TTSTITIKGILSLLMESITTEEDEGGKRVISLGMGDPTLYSCFRTTQVSLQAVSDSLLSN 66

Query: 628  KFNGYSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANIL 807
            KF+GYSPTVGLPQ R+AIA+YLSRDLP K+S DDV++T+GCTQAI+ ALS+LA P ANIL
Sbjct: 67   KFHGYSPTVGLPQARRAIAEYLSRDLPYKLSQDDVFITSGCTQAIDVALSMLARPRANIL 126

Query: 808  LPRPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGN 987
            LPRPGFPIY LCA FRHLEVRY DLLPE  WE+DL+AVE+LAD+NT+A+V+INPGNPCGN
Sbjct: 127  LPRPGFPIYELCAKFRHLEVRYVDLLPENGWEIDLDAVEALADENTVALVVINPGNPCGN 186

Query: 988  VYTYQHRQEIA 1020
            VY+YQH  +IA
Sbjct: 187  VYSYQHLMKIA 197



>gb:BT000782_1635053 Arabidopsis thaliana clone RAFL07-10-M07 (R10775)
            putatative tyrosine aminotransferase (At5g53970) mRNA,
            complete cds.
          Length = 414

 Score =  279 bits (713), Expect = 7e-74
 Identities = 134/191 (70%), Positives = 160/191 (83%)
 Frame = +1

Query: 448  TPTNITIKGILGLLMANIEGSEGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSY 627
            T + ITIKGIL LLM +I   E +  K+VISLGMGDPT YSCF +  ++ QAVSD+L S 
Sbjct: 7    TTSTITIKGILSLLMESITTEEDEGGKRVISLGMGDPTLYSCFRTTQVSLQAVSDSLLSN 66

Query: 628  KFNGYSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANIL 807
            KF+GYS TVGLPQ R+AIA+YLSRDLP K+S DDV++T+GCTQAI+ ALS+LA P ANIL
Sbjct: 67   KFHGYSHTVGLPQARRAIAEYLSRDLPYKLSQDDVFITSGCTQAIDVALSMLARPRANIL 126

Query: 808  LPRPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGN 987
            LPRPGFPIY LCA FRHLEVRY DLLPE  WE+DL+AVE+LAD+NT+A+V+INPGNPCGN
Sbjct: 127  LPRPGFPIYELCAKFRHLEVRYVDLLPENGWEIDLDAVEALADENTVALVVINPGNPCGN 186

Query: 988  VYTYQHRQEIA 1020
            VY+YQH  +IA
Sbjct: 187  VYSYQHLMKIA 197



>gb:AP005310_1850345 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0477B05.
          Length = 439

 Score =  212 bits (540), Expect = 8e-54
 Identities = 95/186 (51%), Positives = 139/186 (74%)
 Frame = +1

Query: 463  TIKGILGLLMANIEGSEGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGY 642
            +I+ +L  + ++++ +     + V+ LG GDPTA +C+ +   A+ AV D L S   NGY
Sbjct: 40   SIRAVLNRVNSSVDAAAAGGPRPVLRLGNGDPTASACYRTAPAAEDAVVDALRSGAHNGY 99

Query: 643  SPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPG 822
            S TVG+   R+AIA+YLSRDLP ++SA+D+Y+T+GC QAIE  +S+LA PG+NILLP+PG
Sbjct: 100  SLTVGVLSARRAIAEYLSRDLPYELSANDIYLTSGCVQAIEVMISVLAQPGSNILLPKPG 159

Query: 823  FPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQ 1002
            FP+Y     F +LEVR++DL+PE+ WEVDL  V+++AD+NT+A+V+INP NPCG+VY+Y 
Sbjct: 160  FPLYESRTTFSNLEVRHFDLIPERGWEVDLEGVQAIADENTVAIVVINPSNPCGSVYSYD 219

Query: 1003 HRQEIA 1020
            H  +IA
Sbjct: 220  HLAKIA 225



>gb:AP005743_1857002 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC clone:P0543C11.
          Length = 444

 Score =  209 bits (531), Expect = 9e-53
 Identities = 98/165 (59%), Positives = 128/165 (77%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
            + V+ L  GDP+ +  F + A A+ AV+D L S  FN Y   VGLP  R+A+AD+LSRDL
Sbjct: 62   RPVLPLAHGDPSVFPEFRTAAEAEDAVADALRSGDFNCYPAGVGLPAARRAVADHLSRDL 121

Query: 706  PEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLL 885
            P K+S+DD+++TAG TQAIE  +SILA PG NILLPRPG+P Y   AAF +LEVR++DL+
Sbjct: 122  PYKLSSDDIFLTAGGTQAIEVVISILAQPGTNILLPRPGYPNYEARAAFNNLEVRHFDLI 181

Query: 886  PEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            PEK WE+DLN++ES+AD+NT A+VIINP NPCGNVYTY+H  ++A
Sbjct: 182  PEKGWEIDLNSLESIADKNTTAIVIINPNNPCGNVYTYEHLSKVA 226



>gb:AB018112_1513780 Arabidopsis thaliana genomic DNA, chromosome 5,
            P1 clone:MAB16.
          Length = 420

 Score =  202 bits (514), Expect = 9e-51
 Identities = 99/193 (51%), Positives = 136/193 (70%)
 Frame = +1

Query: 442  IETPTNITIKGILGLLMANIEGSEGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLS 621
            +E   ++TI+  L  L+  ++G    D + VI LG GDP+ +  F +   A +A+ D + 
Sbjct: 17   VERSNSLTIRDYLNTLINCLDGG---DVRPVIPLGHGDPSPFPSFRTDQAAVEAICDAVR 73

Query: 622  SYKFNGYSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGAN 801
            S KFN YS + G+P  RKA+A+YLS DL  ++S +DV++TAGC QAIE  +S LA PGAN
Sbjct: 74   STKFNNYSSSSGVPVARKAVAEYLSSDLSYQISPNDVHITAGCVQAIEILISALAIPGAN 133

Query: 802  ILLPRPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPC 981
            ILLPRP +P+Y   AAF  LEVRY+DLLPE  W+VDL+ VE+LAD  T+A+++INP NPC
Sbjct: 134  ILLPRPTYPMYDSRAAFCQLEVRYFDLLPENGWDVDLDGVEALADDKTVAILVINPCNPC 193

Query: 982  GNVYTYQHRQEIA 1020
            GNV++ QH Q+IA
Sbjct: 194  GNVFSRQHLQKIA 206



>gb:AY054204_1563026 Arabidopsis thaliana At2g20610/F23N11.7 mRNA,
            complete cds.
          Length = 462

 Score =  201 bits (511), Expect = 2e-50
 Identities = 93/189 (49%), Positives = 132/189 (69%)
 Frame = +1

Query: 454  TNITIKGILGLLMANIEGSEGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKF 633
            + +T++G++ +L  N      D +K ++ LG GDP+ Y CF +   A+ AV D L S K 
Sbjct: 45   STVTLRGVIYMLFDNCGK---DVNKTILPLGHGDPSVYPCFRTCIEAEDAVVDVLRSGKG 101

Query: 634  NGYSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLP 813
            N Y P  G+   R+A+ADY++RDLP K++ +D+++TAGC Q IE     LA P ANILLP
Sbjct: 102  NSYGPGAGILPARRAVADYMNRDLPHKLTPEDIFLTAGCNQGIEIVFESLARPNANILLP 161

Query: 814  RPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVY 993
            RPGFP Y   AA+  LEVR +DLLPEK WE+DL  +E++AD+NT+A+V+INP NPCGNVY
Sbjct: 162  RPGFPHYDARAAYSGLEVRKFDLLPEKEWEIDLEGIEAIADENTVAMVVINPNNPCGNVY 221

Query: 994  TYQHRQEIA 1020
            ++ H +++A
Sbjct: 222  SHDHLKKVA 230



>pir|C84591|C84591 probable tyrosine aminotransferase [imported] -
            Arabidopsis thaliana>gb:AC007048_1535096 Arabidopsis
            thaliana chromosome 2 clone F23N11 map mi148, complete
            sequence.>gb:AY050987_1562467 Arabidopsis thaliana
            putative tyrosine aminotransferase (At2g20610) mRNA,
            complete cds.>gb:AY091293_1574499 Arabidopsis thaliana
            putative tyrosine aminotransferase (At2g20610) mRNA,
            complete cds.>gb:AF301898_1784276 Arabidopsis thaliana
            Columbia ROOTY/SUPERROOT1 (RTY/SUR1) mRNA, complete cds.
          Length = 462

 Score =  201 bits (511), Expect = 2e-50
 Identities = 93/189 (49%), Positives = 132/189 (69%)
 Frame = +1

Query: 454  TNITIKGILGLLMANIEGSEGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKF 633
            + +T++G++ +L  N      D +K ++ LG GDP+ Y CF +   A+ AV D L S K 
Sbjct: 45   STVTLRGVIYMLFDNCGK---DVNKTILPLGHGDPSVYPCFRTCIEAEDAVVDVLRSGKG 101

Query: 634  NGYSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLP 813
            N Y P  G+   R+A+ADY++RDLP K++ +D+++TAGC Q IE     LA P ANILLP
Sbjct: 102  NSYGPGAGILPARRAVADYMNRDLPHKLTPEDIFLTAGCNQGIEIVFESLARPNANILLP 161

Query: 814  RPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVY 993
            RPGFP Y   AA+  LEVR +DLLPEK WE+DL  +E++AD+NT+A+V+INP NPCGNVY
Sbjct: 162  RPGFPHYDARAAYSGLEVRKFDLLPEKEWEIDLEGIEAIADENTVAMVVINPNNPCGNVY 221

Query: 994  TYQHRQEIA 1020
            ++ H +++A
Sbjct: 222  SHDHLKKVA 230



>gb:AX575731_1470706 Sequence 9 from Patent WO02072848.
          Length = 462

 Score =  199 bits (507), Expect = 6e-50
 Identities = 92/189 (48%), Positives = 131/189 (69%)
 Frame = +1

Query: 454  TNITIKGILGLLMANIEGSEGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKF 633
            + +T++G++ +L  N      D +K ++ LG GDP+ Y CF +   A+ AV D L S K 
Sbjct: 45   STVTLRGVIYMLFDNCSK---DVNKTILPLGHGDPSVYPCFRTCIEAEDAVVDVLRSGKG 101

Query: 634  NGYSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLP 813
            N Y P  G+   R+A+ADY++RDLP K++ +D+++TAGC Q IE     LA P ANILLP
Sbjct: 102  NSYGPGAGILPARRAVADYMNRDLPHKLTPEDIFLTAGCNQGIEIVFESLARPNANILLP 161

Query: 814  RPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVY 993
            RPGFP Y   AA+  LEVR +DLLPEK WE+DL  +E++AD+ T+A+V+INP NPCGNVY
Sbjct: 162  RPGFPHYDARAAYSGLEVRKFDLLPEKEWEIDLEGIEAIADEKTVAMVVINPNNPCGNVY 221

Query: 994  TYQHRQEIA 1020
            ++ H +++A
Sbjct: 222  SHDHLKKVA 230



>gb:AF301900_1784278 Arabidopsis thaliana Wassilewskija Ws-2
            ROOTY/SUPERROOT1 (RTY/SUR1) mRNA, complete cds.
          Length = 462

 Score =  199 bits (505), Expect = 1e-49
 Identities = 92/189 (48%), Positives = 131/189 (69%)
 Frame = +1

Query: 454  TNITIKGILGLLMANIEGSEGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKF 633
            + +T++G++ +L  N      D +K ++ LG GDP+ Y CF +   A+ AV D L S K 
Sbjct: 45   STVTLRGVIYMLFDNCGK---DVNKTILPLGHGDPSVYPCFRTCIEAEDAVVDVLRSGKG 101

Query: 634  NGYSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLP 813
            N Y P  G+   R+A+ADY++RDLP K++ +D+++TAGC Q IE     LA P ANILLP
Sbjct: 102  NSYGPGAGILPARRAVADYMNRDLPHKLTPEDIFLTAGCNQGIEIVFESLARPNANILLP 161

Query: 814  RPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVY 993
            RPGFP Y   AA+  LEVR +DLLPEK WE+DL  +E++AD+ T+A+V+INP NPCGNVY
Sbjct: 162  RPGFPHYDARAAYSGLEVRKFDLLPEKEWEIDLEGIEAIADEKTVAMVVINPNNPCGNVY 221

Query: 994  TYQHRQEIA 1020
            ++ H +++A
Sbjct: 222  SHDHLKKVA 230



>gb:AF301899_1784277 Arabidopsis thaliana Landsberg errecta
            ROOTY/SUPERROOT1 (RTY/SUR1) mRNA, complete cds.
          Length = 462

 Score =  199 bits (505), Expect = 1e-49
 Identities = 92/189 (48%), Positives = 131/189 (69%)
 Frame = +1

Query: 454  TNITIKGILGLLMANIEGSEGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKF 633
            + +T++G++ +L  N      D +K ++ LG GDP+ Y CF +   A+ AV D L S K 
Sbjct: 45   STVTLRGVIYMLFDNCGK---DVNKTILPLGHGDPSVYPCFRTCIEAEDAVVDVLRSGKG 101

Query: 634  NGYSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLP 813
            N Y P  G+   R+A+ADY++RDLP K++ +D+++TAGC Q IE     LA P ANILLP
Sbjct: 102  NSYGPGAGILPARRAVADYMNRDLPHKLTPEDIFLTAGCNQGIEIVFESLARPNANILLP 161

Query: 814  RPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVY 993
            RPGFP Y   AA+  LEVR +DLLPEK WE+DL  +E++AD+ T+A+V+INP NPCGNVY
Sbjct: 162  RPGFPHYDARAAYSGLEVRKFDLLPEKEWEIDLEGIEAIADEKTVAMVVINPNNPCGNVY 221

Query: 994  TYQHRQEIA 1020
            ++ H +++A
Sbjct: 222  SHDHLKKVA 230



>gb:AK176613_1818601 Arabidopsis thaliana mRNA for tyrosine
            transaminase-like protein, complete cds, clone:
            RAFL25-13-N23.
          Length = 449

 Score =  189 bits (481), Expect = 6e-47
 Identities = 87/168 (51%), Positives = 115/168 (68%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS 696
            D  K ++ L  GDP+ Y C+ +  L + AV D L S K N Y P  G+   R+A+ADY++
Sbjct: 57   DVKKPLLPLAHGDPSVYPCYRTSILVENAVVDVLRSGKGNSYGPAAGILPARQAVADYVN 116

Query: 697  RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
            RDL  KV  +DV++T GC Q IE  L  LA P ANILLPRP +P Y   A +  LEVR +
Sbjct: 117  RDLTNKVKPNDVFITVGCNQGIEVVLQSLARPNANILLPRPSYPHYEARAVYSGLEVRKF 176

Query: 877  DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            DLLPEK WE+DL  +E++AD+NT+A+VIINP NPCGNVY+Y H +++A
Sbjct: 177  DLLPEKEWEIDLPGIEAMADENTVAMVIINPNNPCGNVYSYDHLKKVA 224



>pir|T04612|T04612 tyrosine transaminase homolog F20O9.100 -
            Arabidopsis thaliana>gb:ATCHRIV68_1546722 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            68.>gb:ATF20O9_1549541 Arabidopsis thaliana DNA
            chromosome 4, BAC clone F20O9 (ESSA
            project).>gb:AY142527_1582956 Arabidopsis thaliana
            putative tyrosine transaminase (At4g28420) mRNA, complete
            cds.
          Length = 389

 Score =  189 bits (481), Expect = 6e-47
 Identities = 87/168 (51%), Positives = 115/168 (68%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS 696
            D  K ++ L  GDP+ Y C+ +  L + AV D L S K N Y P  G+   R+A+ADY++
Sbjct: 57   DVKKPLLPLAHGDPSVYPCYRTSILVENAVVDVLRSGKGNSYGPAAGILPARQAVADYVN 116

Query: 697  RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
            RDL  KV  +DV++T GC Q IE  L  LA P ANILLPRP +P Y   A +  LEVR +
Sbjct: 117  RDLTNKVKPNDVFITVGCNQGIEVVLQSLARPNANILLPRPSYPHYEARAVYSGLEVRKF 176

Query: 877  DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            DLLPEK WE+DL  +E++AD+NT+A+VIINP NPCGNVY+Y H +++A
Sbjct: 177  DLLPEKEWEIDLPGIEAMADENTVAMVIINPNNPCGNVYSYDHLKKVA 224



>gb:AP004679_1843244 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, BAC clone:OSJNBa0021N09.
          Length = 315

 Score =  186 bits (471), Expect = 8e-46
 Identities = 88/166 (53%), Positives = 122/166 (73%), Gaps = 1/166 (0%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYS-PTVGLPQTRKAIADYLSRD 702
            + VI L  GDP++ +CF +   A++AV+  + S  +NGYS P   LP  R+AIA+YLS D
Sbjct: 44   RPVIPLSHGDPSSSACFRTAPEAEEAVAAAVRSGDYNGYSSPATSLP-ARRAIAEYLSCD 102

Query: 703  LPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDL 882
            LP K+  DD+++T+G TQAIE  +S+   PGANILLP+PG+P +   A F  +EVR YDL
Sbjct: 103  LPYKLCTDDIFLTSGGTQAIEIVMSVFGQPGANILLPKPGYPKHEAHAVFHRMEVRLYDL 162

Query: 883  LPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            +PE+ WE+++ AVE+LAD+NT+A+VI NP NPCGNVYTY+H  +IA
Sbjct: 163  VPERGWEINVEAVEALADENTVAIVITNPNNPCGNVYTYEHLSKIA 208



>gb:AP004679_1843243 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 6, BAC clone:OSJNBa0021N09.
          Length = 441

 Score =  186 bits (471), Expect = 8e-46
 Identities = 88/166 (53%), Positives = 122/166 (73%), Gaps = 1/166 (0%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYS-PTVGLPQTRKAIADYLSRD 702
            + VI L  GDP++ +CF +   A++AV+  + S  +NGYS P   LP  R+AIA+YLS D
Sbjct: 44   RPVIPLSHGDPSSSACFRTAPEAEEAVAAAVRSGDYNGYSSPATSLP-ARRAIAEYLSCD 102

Query: 703  LPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDL 882
            LP K+  DD+++T+G TQAIE  +S+   PGANILLP+PG+P +   A F  +EVR YDL
Sbjct: 103  LPYKLCTDDIFLTSGGTQAIEIVMSVFGQPGANILLPKPGYPKHEAHAVFHRMEVRLYDL 162

Query: 883  LPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            +PE+ WE+++ AVE+LAD+NT+A+VI NP NPCGNVYTY+H  +IA
Sbjct: 163  VPERGWEINVEAVEALADENTVAIVITNPNNPCGNVYTYEHLSKIA 208



>gb:AP005310_1850343 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 2, PAC
            clone:P0477B05.>gb:AP005532_1853631 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 2, BAC
            clone:OSJNBa0010K08.
          Length = 430

 Score =  182 bits (463), Expect = 7e-45
 Identities = 88/167 (52%), Positives = 117/167 (70%)
 Frame = +1

Query: 520  DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSR 699
            D++ V  L  GDP+A++CF +   A  AV+   +S K+N YSP VG+     A+A +LSR
Sbjct: 48   DARPVAPLAHGDPSAFACFRAAPAATDAVAAAAASGKYNYYSPAVGIAPACSAVAAHLSR 107

Query: 700  DLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYD 879
            +LP  VS  DV +TAGC  A+E  +S+LA PGAN+LLPRPG+P+YA  AA   LE R++D
Sbjct: 108  ELPYAVSPADVVLTAGCNHAVEIMMSVLASPGANVLLPRPGYPLYASRAALSGLEFRHFD 167

Query: 880  LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            LLP+  WEVDL  VE+LAD NT+A+VI+NP NPCG VY+  H  +IA
Sbjct: 168  LLPDSEWEVDLAGVEALADANTVAMVIVNPNNPCGCVYSRDHLAKIA 214



>gb:D88273_1675104 Hordeum vulgare naat-A mRNA for nicotianamine
            aminotransferase A, complete cds.
          Length = 461

 Score =  182 bits (463), Expect = 7e-45
 Identities = 91/187 (48%), Positives = 133/187 (71%), Gaps = 1/187 (0%)
 Frame = +1

Query: 463  TIKGILGLLMANIEGSEGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGY 642
            +I+ I   + A++E S     + V+ L  GDP+ +  F +   A+ AV+  L + +FN Y
Sbjct: 60   SIRAIRYKISASVEES---GPRPVLPLAHGDPSVFPAFRTAVEAEDAVAAALRTGQFNCY 116

Query: 643  SPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYP-GANILLPRP 819
            +  VGLP  R A+A++LS+ +P K+SADDV++TAG TQAIE  + +LA   GANILLPRP
Sbjct: 117  AAGVGLPAARSAVAEHLSQGVPYKLSADDVFLTAGGTQAIEVIIPVLAQTAGANILLPRP 176

Query: 820  GFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTY 999
            G+P Y   AAF  LEVR++DL+P+K WE+D++++ES+AD+NT A+VIINP NPCG+VY+Y
Sbjct: 177  GYPNYEARAAFNKLEVRHFDLIPDKGWEIDIDSLESIADKNTTAMVIINPNNPCGSVYSY 236

Query: 1000 QHRQEIA 1020
             H  ++A
Sbjct: 237  DHLAKVA 243



>gb:AB024006_1515688 Hordeum vulgare naat-B and naat-A genes for
            nicotianamine aminotransferase, complete cds.
          Length = 461

 Score =  182 bits (463), Expect = 7e-45
 Identities = 91/187 (48%), Positives = 133/187 (71%), Gaps = 1/187 (0%)
 Frame = +1

Query: 463  TIKGILGLLMANIEGSEGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGY 642
            +I+ I   + A++E S     + V+ L  GDP+ +  F +   A+ AV+  L + +FN Y
Sbjct: 60   SIRAIRYKISASVEES---GPRPVLPLAHGDPSVFPAFRTAVEAEDAVAAALRTGQFNCY 116

Query: 643  SPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYP-GANILLPRP 819
            +  VGLP  R A+A++LS+ +P K+SADDV++TAG TQAIE  + +LA   GANILLPRP
Sbjct: 117  AAGVGLPAARSAVAEHLSQGVPYKLSADDVFLTAGGTQAIEVIIPVLAQTAGANILLPRP 176

Query: 820  GFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTY 999
            G+P Y   AAF  LEVR++DL+P+K WE+D++++ES+AD+NT A+VIINP NPCG+VY+Y
Sbjct: 177  GYPNYEARAAFNKLEVRHFDLIPDKGWEIDIDSLESIADKNTTAMVIINPNNPCGSVYSY 236

Query: 1000 QHRQEIA 1020
             H  ++A
Sbjct: 237  DHLAKVA 243



>gb:AB024006_1515687 Hordeum vulgare naat-B and naat-A genes for
            nicotianamine aminotransferase, complete cds.
          Length = 551

 Score =  181 bits (460), Expect = 2e-44
 Identities = 90/192 (46%), Positives = 133/192 (69%), Gaps = 1/192 (0%)
 Frame = +1

Query: 448  TPTNITIKGILGLLMANIEGSEGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSY 627
            T  N++I+ I   + A+++       + V+ L  GDP+ +  F +   A+ AV+  L + 
Sbjct: 145  TGANMSIRAIRYKISASVQEK---GPRPVLPLAHGDPSVFPAFRTAVEAEDAVAAALRTG 201

Query: 628  KFNGYSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYP-GANI 804
            +FN Y   VGLP  R A+A++LS+ +P  +SADDV++TAG TQAIE  + +LA   GANI
Sbjct: 202  QFNCYPAGVGLPAARSAVAEHLSQGVPYMLSADDVFLTAGGTQAIEVIIPVLAQTAGANI 261

Query: 805  LLPRPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCG 984
            LLPRPG+P Y   AAF  LEVR++DL+P+K WE+D++++ES+AD+NT A+VIINP NPCG
Sbjct: 262  LLPRPGYPNYEARAAFNRLEVRHFDLIPDKGWEIDIDSLESIADKNTTAMVIINPNNPCG 321

Query: 985  NVYTYQHRQEIA 1020
            +VY+Y H  ++A
Sbjct: 322  SVYSYDHLSKVA 333



>gb:AB005788_1509700 Hordeum vulgare mRNA for nicotianamine
            aminotransferase B, complete cds.
          Length = 551

 Score =  180 bits (457), Expect = 4e-44
 Identities = 89/192 (46%), Positives = 133/192 (69%), Gaps = 1/192 (0%)
 Frame = +1

Query: 448  TPTNITIKGILGLLMANIEGSEGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSY 627
            T  N++I+ I   + A+++       + V+ L  GDP+ +  F +   A+ AV+  + + 
Sbjct: 145  TGANMSIRAIRYKISASVQEK---GPRPVLPLAHGDPSVFPAFRTAVEAEDAVAAAVRTG 201

Query: 628  KFNGYSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYP-GANI 804
            +FN Y   VGLP  R A+A++LS+ +P  +SADDV++TAG TQAIE  + +LA   GANI
Sbjct: 202  QFNCYPAGVGLPAARSAVAEHLSQGVPYMLSADDVFLTAGGTQAIEVIIPVLAQTAGANI 261

Query: 805  LLPRPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCG 984
            LLPRPG+P Y   AAF  LEVR++DL+P+K WE+D++++ES+AD+NT A+VIINP NPCG
Sbjct: 262  LLPRPGYPNYEARAAFNRLEVRHFDLIPDKGWEIDIDSLESIADKNTTAMVIINPNNPCG 321

Query: 985  NVYTYQHRQEIA 1020
            +VY+Y H  ++A
Sbjct: 322  SVYSYDHLSKVA 333



>gb:AY085324_1570396 Arabidopsis thaliana clone 14570 mRNA, complete
            sequence.
          Length = 445

 Score =  174 bits (442), Expect = 2e-42
 Identities = 83/169 (49%), Positives = 119/169 (70%), Gaps = 1/169 (0%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS 696
            +  K ++    G+P+A+S F +   A++AV+D   S   N Y+P+ G+ + R+A+A+YL+
Sbjct: 46   NSGKTILFPTPGEPSAHSNFRTCPEAEEAVADAARSGMANSYAPSPGVFKARRAVAEYLN 105

Query: 697  RDLPEKVSADDVYVTAGCTQAIETALSILA-YPGANILLPRPGFPIYALCAAFRHLEVRY 873
             +LP K+ A+DVY+T GC QAIE  +  LA  P ANILLPRPG+P Y   A +  LE+R 
Sbjct: 106  GELPTKLKAEDVYITGGCNQAIEIVIDSLAGNPSANILLPRPGYPHYDARAVYSGLEIRK 165

Query: 874  YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            YDLLPE  WE++L+ +E+ AD+NT+A+VIINP NPCGNVYTY H  ++A
Sbjct: 166  YDLLPESDWEINLDGLEAAADENTVAMVIINPNNPCGNVYTYDHLNKVA 214



>gb:AX575729_1470705 Sequence 7 from Patent WO02072848.
          Length = 444

 Score =  174 bits (441), Expect = 3e-42
 Identities = 87/196 (44%), Positives = 128/196 (65%), Gaps = 1/196 (0%)
 Frame = +1

Query: 436  GEIETPTNITIKGILGLLMANIEGSEGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDT 615
            G     T +T++ +   +  N   + G   K ++    G+P+A+S F +   A++AV+D 
Sbjct: 22   GATSDATAVTLRKLAFGMFKNCTMNSG---KTILFPTPGEPSAHSNFRTCPEAEEAVADA 78

Query: 616  LSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILA-YP 792
              S   N Y+P+ G+ + R+A+A+YL+ +LP K+ A+DVY+T GC QAIE  +  LA  P
Sbjct: 79   ARSGMANSYAPSPGVFKARRAVAEYLNGELPTKLKAEDVYITGGCNQAIEIVIDSLAGNP 138

Query: 793  GANILLPRPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPG 972
              NILLPRPG+P Y   A +  LE+R YDLLPE  WE++L+ +E+ AD+NT+A+VIINP 
Sbjct: 139  STNILLPRPGYPHYDARAVYSGLEIREYDLLPESDWEINLDGLEAAADENTVAMVIINPN 198

Query: 973  NPCGNVYTYQHRQEIA 1020
            NPCGNVYTY H  ++A
Sbjct: 199  NPCGNVYTYDHLNKVA 214



>pir|C84641|C84641 probable tyrosine aminotransferase [imported] -
            Arabidopsis thaliana>gb:AC006585_1534518 Arabidopsis
            thaliana chromosome 2 clone F27C12 map mi238, complete
            sequence.>gb:BT002475_1636078 Arabidopsis thaliana
            putative tyrosine aminotransferase (At2g24850) mRNA,
            complete cds.>gb:BT006593_1639480 Arabidopsis thaliana
            At2g24850 mRNA, complete cds.
          Length = 445

 Score =  171 bits (434), Expect = 2e-41
 Identities = 82/169 (48%), Positives = 118/169 (69%), Gaps = 1/169 (0%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS 696
            +  K ++    G+P+A+S F +   A++AV+    S   N Y+P+ G+ + R+A+A+YL+
Sbjct: 46   NSGKTILFPTPGEPSAHSNFRTCPEAEEAVAAAARSGMANSYAPSPGVFKARRAVAEYLN 105

Query: 697  RDLPEKVSADDVYVTAGCTQAIETALSILA-YPGANILLPRPGFPIYALCAAFRHLEVRY 873
             +LP K+ A+DVY+T GC QAIE  +  LA  P ANILLPRPG+P Y   A +  LE+R 
Sbjct: 106  GELPTKLKAEDVYITGGCNQAIEIVIDSLAGNPSANILLPRPGYPHYDARAVYSGLEIRK 165

Query: 874  YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            YDLLPE  WE++L+ +E+ AD+NT+A+VIINP NPCGNVYTY H  ++A
Sbjct: 166  YDLLPESDWEINLDGLEAAADENTVAMVIINPNNPCGNVYTYDHLNKVA 214



>gb:AK090244_1176197 Mus musculus cDNA, RIKEN full-length enriched
            library, clone:G630024H23 product:TYROSINE
            AMINOTRANSFERASE (EC 2.6.1.5) (L-TYROSINE:2-OXOGLUTARATE
            AMINOTRANSFERASE) (TAT) homolog [Rattus norvegicus], full
            insert sequence.
          Length = 454

 Score =  159 bits (402), Expect = 8e-38
 Identities = 78/166 (46%), Positives = 112/166 (67%), Gaps = 1/166 (0%)
 Frame = +1

Query: 523  SKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRD 702
            +K VISL +GDPT +    +     QA+ D L S K+NGY+P++G   +R+ +A Y    
Sbjct: 70   NKTVISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGYLSSREEVASYYH-- 127

Query: 703  LPEK-VSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYD 879
             PE  + A DV +T+GC+QAIE  L++LA PG NIL+PRPGF +Y   A    +EV+ Y+
Sbjct: 128  CPEAPLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYN 187

Query: 880  LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            LLPEK+WE+DL  +ESL D+ T  +V+ NP NPCG+V++ +H Q+I
Sbjct: 188  LLPEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKI 233



>sp|Q8QZR1|ATTY_MOUSE Tyrosine aminotransferase (EC 2.6.1.5)
            (L-tyrosine:2-oxoglutarate aminotransferase)
            (TAT).>gb:BC023949_2094334 Mus musculus tyrosine
            aminotransferase, mRNA (cDNA clone MGC:38102
            IMAGE:5310059), complete cds.>gb:BC024120_2094393 Mus
            musculus tyrosine aminotransferase, mRNA (cDNA clone
            MGC:37790 IMAGE:5097591), complete
            cds.>gb:BC024264_2094413 Mus musculus tyrosine
            aminotransferase, mRNA (cDNA clone MGC:37819
            IMAGE:5098682), complete cds.>gb:BC025934_2095232 Mus
            musculus tyrosine aminotransferase, mRNA (cDNA clone
            MGC:37772 IMAGE:5097113), complete
            cds.>gb:BC028821_2096329 Mus musculus tyrosine
            aminotransferase, mRNA (cDNA clone MGC:37789
            IMAGE:5097589), complete cds.>gb:BC030728_2096859 Mus
            musculus tyrosine aminotransferase, mRNA (cDNA clone
            MGC:37828 IMAGE:5099036), complete
            cds.>gb:BC030729_2096860 Mus musculus tyrosine
            aminotransferase, mRNA (cDNA clone MGC:37842
            IMAGE:5099570), complete cds.>gb:BC037526_2098072 Mus
            musculus tyrosine aminotransferase, mRNA (cDNA clone
            MGC:37796 IMAGE:5097795), complete cds.
          Length = 454

 Score =  159 bits (402), Expect = 8e-38
 Identities = 78/166 (46%), Positives = 112/166 (67%), Gaps = 1/166 (0%)
 Frame = +1

Query: 523  SKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRD 702
            +K VISL +GDPT +    +     QA+ D L S K+NGY+P++G   +R+ +A Y    
Sbjct: 70   NKTVISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGYLSSREEVASYYH-- 127

Query: 703  LPEK-VSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYD 879
             PE  + A DV +T+GC+QAIE  L++LA PG NIL+PRPGF +Y   A    +EV+ Y+
Sbjct: 128  CPEAPLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYN 187

Query: 880  LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            LLPEK+WE+DL  +ESL D+ T  +V+ NP NPCG+V++ +H Q+I
Sbjct: 188  LLPEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKI 233



>gb:RNO010709_2135343 Rattus norvegicus gene encoding tyrosine
            aminotransferase.
          Length = 454

 Score =  158 bits (400), Expect = 1e-37
 Identities = 77/166 (46%), Positives = 112/166 (67%), Gaps = 1/166 (0%)
 Frame = +1

Query: 523  SKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS-R 699
            +K VISL +GDPT +    +     QA+ D L S K+NGY+P++G   +R+ +A Y    
Sbjct: 70   NKTVISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGYLSSREEVASYYHCH 129

Query: 700  DLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYD 879
            + P  + A DV +T+GC+QAIE  L++LA PG NIL+PRPGF +Y   A    +EV+ Y+
Sbjct: 130  EAP--LEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYN 187

Query: 880  LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            LLPEK+WE+DL  +ESL D+ T  +V+ NP NPCG+V++ +H Q+I
Sbjct: 188  LLPEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKI 233



>gb:AX575725_1470703 Sequence 3 from Patent WO02072848.
          Length = 454

 Score =  158 bits (400), Expect = 1e-37
 Identities = 77/166 (46%), Positives = 112/166 (67%), Gaps = 1/166 (0%)
 Frame = +1

Query: 523  SKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS-R 699
            +K VISL +GDPT +    +     QA+ D L S K+NGY+P++G   +R+ +A Y    
Sbjct: 70   NKTVISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGYLSSREEVASYYHCH 129

Query: 700  DLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYD 879
            + P  + A DV +T+GC+QAIE  L++LA PG NIL+PRPGF +Y   A    +EV+ Y+
Sbjct: 130  EAP--LEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYN 187

Query: 880  LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            LLPEK+WE+DL  +ESL D+ T  +V+ NP NPCG+V++ +H Q+I
Sbjct: 188  LLPEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKI 233



>gb:AX575723_1470702 Sequence 1 from Patent WO02072848.
          Length = 456

 Score =  158 bits (400), Expect = 1e-37
 Identities = 77/166 (46%), Positives = 112/166 (67%), Gaps = 1/166 (0%)
 Frame = +1

Query: 523  SKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS-R 699
            +K VISL +GDPT +    +     QA+ D L S K+NGY+P++G   +R+ +A Y    
Sbjct: 72   NKTVISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGYLSSREEVASYYHCH 131

Query: 700  DLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYD 879
            + P  + A DV +T+GC+QAIE  L++LA PG NIL+PRPGF +Y   A    +EV+ Y+
Sbjct: 132  EAP--LEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYN 189

Query: 880  LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            LLPEK+WE+DL  +ESL D+ T  +V+ NP NPCG+V++ +H Q+I
Sbjct: 190  LLPEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKI 235



>sp|P04694|ATTY_RAT Tyrosine aminotransferase (EC 2.6.1.5)
            (L-tyrosine:2-oxoglutarate aminotransferase)
            (TAT).>pir|A23310|XNRTY tyrosine transaminase (EC
            2.6.1.5) - rat>gb:BC089813_2111012 Rattus norvegicus
            tyrosine aminotransferase, mRNA (cDNA clone MGC:108738
            IMAGE:7372826), complete cds.>gb:RNTATR_2136532 Rattus
            norvegicus mRNA for tyrosine aminotransferase.
          Length = 454

 Score =  158 bits (400), Expect = 1e-37
 Identities = 77/166 (46%), Positives = 112/166 (67%), Gaps = 1/166 (0%)
 Frame = +1

Query: 523  SKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS-R 699
            +K VISL +GDPT +    +     QA+ D L S K+NGY+P++G   +R+ +A Y    
Sbjct: 70   NKTVISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGYLSSREEVASYYHCH 129

Query: 700  DLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYD 879
            + P  + A DV +T+GC+QAIE  L++LA PG NIL+PRPGF +Y   A    +EV+ Y+
Sbjct: 130  EAP--LEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYN 187

Query: 880  LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            LLPEK+WE+DL  +ESL D+ T  +V+ NP NPCG+V++ +H Q+I
Sbjct: 188  LLPEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKI 233



>gb:AF163863_1415364 Mustela vison tyrosine aminotransferase gene,
            complete cds.
          Length = 454

 Score =  158 bits (399), Expect = 2e-37
 Identities = 77/165 (46%), Positives = 111/165 (67%), Gaps = 1/165 (0%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
            K +I+L +GDPT +    +     QA+ D L S K+NGY+P++G   +R+ IA Y  R  
Sbjct: 71   KTMIALSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGYLSSREEIASYYHR-- 128

Query: 706  PEK-VSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDL 882
            PE  + A DV +T+GC+QAIE  L++LA PG NIL+PRPGF +Y   A    +EV+ Y+L
Sbjct: 129  PEAPLEAKDVILTSGCSQAIELCLAVLANPGQNILVPRPGFSLYRTLAESMGIEVKLYNL 188

Query: 883  LPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            LPEK+WE+DL  +ESL D+ T  +++ NP NPCG+V++  H Q+I
Sbjct: 189  LPEKSWEIDLKQLESLIDEKTACLIVNNPSNPCGSVFSRSHLQKI 233



>gb:AY070389_1566788 Arabidopsis thaliana putative tyrosine
            transaminase (At4g23590) mRNA, complete
            cds.>gb:AY123024_1579902 Arabidopsis thaliana putative
            tyrosine transaminase (At4g23590) mRNA, complete cds.
          Length = 424

 Score =  157 bits (397), Expect = 3e-37
 Identities = 73/143 (51%), Positives = 104/143 (72%)
 Frame = +1

Query: 592  AQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETA 771
            A++AV   +     N Y+P++GLP  ++A+A+YL+RDL  K++ DDVY+T GC QAIE A
Sbjct: 57   AEKAVVKAVLCGTGNAYAPSIGLPVAKRAVAEYLNRDLDNKLTGDDVYMTVGCKQAIELA 116

Query: 772  LSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIA 951
            +SILA P ANILLPRPGFP   + + ++HLEVR Y+ +PE+ +E+D N+V  + D+NT A
Sbjct: 117  VSILAKPKANILLPRPGFPWDMVHSIYKHLEVRRYEFIPERDFEIDFNSVREMVDENTFA 176

Query: 952  VVIINPGNPCGNVYTYQHRQEIA 1020
            + IINP NP GN YT  H +++A
Sbjct: 177  IFIINPHNPNGNYYTEAHLKQLA 199



>pir|T05591|T05591 tyrosine transaminase homolog F9D16.60 -
            Arabidopsis thaliana>gb:ATCHRIV59_1546196 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            59.>gb:ATF9D16_1551283 Arabidopsis thaliana DNA
            chromosome 4, BAC clone F9D16 (ESSAII project).
          Length = 448

 Score =  157 bits (397), Expect = 3e-37
 Identities = 73/143 (51%), Positives = 104/143 (72%)
 Frame = +1

Query: 592  AQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETA 771
            A++AV   +     N Y+P++GLP  ++A+A+YL+RDL  K++ DDVY+T GC QAIE A
Sbjct: 57   AEKAVVKAVLCGTGNAYAPSIGLPVAKRAVAEYLNRDLDNKLTGDDVYMTVGCKQAIELA 116

Query: 772  LSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIA 951
            +SILA P ANILLPRPGFP   + + ++HLEVR Y+ +PE+ +E+D N+V  + D+NT A
Sbjct: 117  VSILAKPKANILLPRPGFPWDMVHSIYKHLEVRRYEFIPERDFEIDFNSVREMVDENTFA 176

Query: 952  VVIINPGNPCGNVYTYQHRQEIA 1020
            + IINP NP GN YT  H +++A
Sbjct: 177  IFIINPHNPNGNYYTEAHLKQLA 199



>gb:RATTATRA_2133964 Rat tyrosine aminotransferase mRNA, complete cds.
          Length = 454

 Score =  155 bits (392), Expect = 1e-36
 Identities = 76/166 (45%), Positives = 111/166 (66%), Gaps = 1/166 (0%)
 Frame = +1

Query: 523  SKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS-R 699
            +K VISL +GDPT +    +     QA+ D L S K+NGY+P++G   +R+ +A Y    
Sbjct: 70   NKTVISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGYLSSREEVASYYHCH 129

Query: 700  DLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYD 879
            + P  + A DV +T+GC+QAIE  L++LA PG NIL+PRPGF +Y   A    +EV+ Y+
Sbjct: 130  EAP--LEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYN 187

Query: 880  LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            LLPEK+WE+DL  +ESL D+    +V+ NP NPCG+V++ +H Q+I
Sbjct: 188  LLPEKSWEIDLKQLESLIDEKLECLVVNNPSNPCGSVFSKRHLQKI 233



>gb:BC074414_2557919 Xenopus laevis hypothetical protein LOC443707,
            mRNA (cDNA clone IMAGE:7019538), partial cds.
          Length = 484

 Score =  155 bits (391), Expect = 2e-36
 Identities = 74/165 (44%), Positives = 111/165 (67%), Gaps = 1/165 (0%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
            K +I+L +GDPT +    +     +A+ + + S K+NGY+P++G   +R+ +A Y +   
Sbjct: 100  KPMIALSIGDPTVFGNLPTDDAVNKAMKEAIDSKKYNGYAPSIGYLSSREVVAKYYT--C 157

Query: 706  PEK-VSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDL 882
            PE  + A DV +T+GC+QAIE AL++LA PG NIL+PRPGF +Y   A    +EV+ Y+L
Sbjct: 158  PEAPLEAKDVILTSGCSQAIELALAVLANPGQNILVPRPGFSLYKTLALSLGIEVKLYNL 217

Query: 883  LPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            LPEK+WE+DL  +ESL D  T  ++I NP NPCG+V+  +H Q+I
Sbjct: 218  LPEKSWEIDLKHMESLVDDKTACIIINNPSNPCGSVFNRKHLQKI 262



>gb:BC075603_2558699 Xenopus tropicalis tyrosine aminotransferase,
            mRNA (cDNA clone MGC:89628 IMAGE:6995608), complete cds.
          Length = 456

 Score =  154 bits (390), Expect = 2e-36
 Identities = 74/165 (44%), Positives = 112/165 (67%), Gaps = 1/165 (0%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
            K +I+L +GDPT +    +     +A+ + + S K+NGY+P++G   +R+ +A Y +   
Sbjct: 72   KPMIALSIGDPTVFGNLPTDNEVMKAMKEAIDSKKYNGYAPSIGYLSSREVVAKYYT--C 129

Query: 706  PEK-VSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDL 882
            PE  + A DV +T+GC+QAIE AL++LA PG NIL+PRPGF +Y   A    +EV+ Y+L
Sbjct: 130  PEATLEAKDVILTSGCSQAIELALAVLANPGQNILVPRPGFSLYKTLALSLGIEVKLYNL 189

Query: 883  LPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            LPEK+WE+DL  +ESL D  T  ++I NP NPCG+V++ +H Q+I
Sbjct: 190  LPEKSWEIDLTHMESLVDDKTACIIINNPSNPCGSVFSRKHLQKI 234



>sp|P17735|ATTY_HUMAN Tyrosine aminotransferase (EC 2.6.1.5)
            (L-tyrosine:2-oxoglutarate aminotransferase)
            (TAT).>pir|S10887|S10887 tyrosine transaminase (EC
            2.6.1.5) - human>gb:HSTAT2_2020639 Human gene for
            tyrosine aminotransferase (TAT) (EC 2.6.1.5) Exon 2 (and
            joined CDS).>gb:HSTATR_2020640 Human mRNA for tyrosine
            aminotransferase (TAT) (EC 2.6.1.5).>gb:HSTYAT_2021356
            H.sapiens mRNA for tyrosine aminotransferase.
          Length = 454

 Score =  154 bits (390), Expect = 2e-36
 Identities = 75/166 (45%), Positives = 111/166 (66%), Gaps = 1/166 (0%)
 Frame = +1

Query: 523  SKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRD 702
            +K +ISL +GDPT +    +     QA+ D L S K+NGY+P++G   +R+ IA Y    
Sbjct: 70   NKTMISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGFLSSREEIASYYH-- 127

Query: 703  LPEK-VSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYD 879
             PE  + A DV +T+GC+QAI+  L++LA PG NIL+PRPGF +Y   A    +EV+ Y+
Sbjct: 128  CPEAPLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYN 187

Query: 880  LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            LLPEK+WE+DL  +E L D+ T  +++ NP NPCG+V++ +H Q+I
Sbjct: 188  LLPEKSWEIDLKQLEYLIDEKTACLIVNNPSNPCGSVFSKRHLQKI 233



>gb:AY187682_1588170 Brassica oleracea cystine lyase BOCL-3 mRNA,
            complete cds.
          Length = 424

 Score =  151 bits (381), Expect = 2e-35
 Identities = 69/143 (48%), Positives = 104/143 (72%)
 Frame = +1

Query: 592  AQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETA 771
            A++AV   + S   N Y+P++GLP  + A+A+YL+RDLP+K++A DV++T GC +AI+ A
Sbjct: 58   AEKAVVKFILSGTGNAYAPSIGLPLAKSAVAEYLNRDLPKKLTAADVFMTVGCKRAIDLA 117

Query: 772  LSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIA 951
            + ILA P AN+LLPRPGFP   +   ++ LEVRYYD +PE+ +E+D  +V+ + D+NT A
Sbjct: 118  VDILAKPKANVLLPRPGFPWDVVRCIYKKLEVRYYDFIPEQNFEIDFESVKKVTDKNTFA 177

Query: 952  VVIINPGNPCGNVYTYQHRQEIA 1020
            + IINP NP GN Y+  H +++A
Sbjct: 178  IFIINPHNPNGNTYSEAHLKQLA 200



>pir|T05592|T05592 tyrosine transaminase homolog F9D16.70 -
            Arabidopsis thaliana>gb:AX575727_1470704 Sequence 5 from
            Patent WO02072848.>gb:ATCHRIV59_1546197 Arabidopsis
            thaliana DNA chromosome 4, contig fragment No.
            59.>gb:ATF9D16_1551284 Arabidopsis thaliana DNA
            chromosome 4, BAC clone F9D16 (ESSAII
            project).>gb:AY099811_1576836 Arabidopsis thaliana
            tyrosine transaminase like protein (At4g23600) mRNA,
            complete cds.>gb:BT000307_1634585 Arabidopsis thaliana
            tyrosine transaminase like protein (At4g23600) mRNA,
            complete cds.>gb:AF268090_1782030 Arabidopsis thaliana
            coronatine-regulated tyrosine aminotransferase (F9D16.70)
            mRNA, complete cds.
          Length = 422

 Score =  146 bits (368), Expect = 7e-34
 Identities = 68/143 (47%), Positives = 104/143 (72%)
 Frame = +1

Query: 592  AQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETA 771
            A++AV   +     N Y+P++GL   + A+A+YL++ LP+K++ADDV++T GC QAIE A
Sbjct: 57   AEKAVVKAVLYGSGNAYAPSLGLAAAKSAVAEYLNQGLPKKLTADDVFMTLGCKQAIELA 116

Query: 772  LSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIA 951
            + ILA P AN+LLP PGFP   + + +++LEVR+Y+ LPEK +E+D ++V +L D+NT A
Sbjct: 117  VDILAKPKANVLLPSPGFPWDLVRSIYKNLEVRHYNFLPEKNFEIDFDSVRALVDENTFA 176

Query: 952  VVIINPGNPCGNVYTYQHRQEIA 1020
            + IINP NP GN Y+  H +++A
Sbjct: 177  IFIINPHNPNGNTYSEAHLKQLA 199



>gb:AE014298_1125623 Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE003495_1212632 Drosophila melanogaster
            chromosome X, section 47 of 74 of the complete
            sequence.>gb:AY069305_1294035 Drosophila melanogaster
            HL07974 full length cDNA.
          Length = 501

 Score =  140 bits (353), Expect = 4e-32
 Identities = 70/165 (42%), Positives = 105/165 (63%), Gaps = 1/165 (0%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
            K +I L +GDPT +    +     +AV  +L S K+NGY+ T G    RKA+A Y +   
Sbjct: 109  KPMIPLSIGDPTTFGNLKAADETMKAVLHSLESGKYNGYASTQGHEIARKAVAKYSAHQR 168

Query: 706  PE-KVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDL 882
            P+ ++ A++V + +GC+ A+E  +  LA  G N+L+PRPGF +Y   A    +EVRYYDL
Sbjct: 169  PDGEIDANEVVLCSGCSSALEYCILALADRGQNVLVPRPGFCLYYTLAQGLDIEVRYYDL 228

Query: 883  LPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            LP++ W  DL  +ESL D+NT A++I NP NPCG+V+  +H +E+
Sbjct: 229  LPDQQWRADLVQLESLIDENTAALLINNPSNPCGSVFDEKHLREL 273



>gb:AY752843_1179986 Culicoides sonorensis clone CsTAT1 tyrosine
           aminotransferase mRNA, partial cds.
          Length = 212

 Score =  135 bits (341), Expect = 1e-30
 Identities = 69/170 (40%), Positives = 105/170 (61%), Gaps = 2/170 (1%)
 Frame = +1

Query: 487 LMANIEGS--EGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGL 660
           + A +EG   E +  K++I+L +GDPT +           +V   + + K+NGY P+ G 
Sbjct: 45  IRAIVEGMKIEPNPDKQLIALSIGDPTTFGNMRPSKEVIDSVKHVVQNEKYNGYGPSNGF 104

Query: 661 PQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYAL 840
            + RKAI +Y       +++ +DV + +GC+ A++  ++ LA  G NIL PRPGF IY  
Sbjct: 105 IEARKAICEYEKHQ--GELTPNDVIICSGCSSALDLCITALAGFGQNILCPRPGFSIYRT 162

Query: 841 CAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNV 990
            A    +EVR YDL+PEK W++DL+ +ESL D+NT A++I NP NPCG+V
Sbjct: 163 LAEGFGIEVRNYDLIPEKKWQIDLDHLESLIDENTAALIITNPSNPCGSV 212



>pir|T22087|T22087 hypothetical protein F42D1.2 - Caenorhabditis
            elegans>gb:CEF42D1_1363781 Caenorhabditis elegans cosmid
            F42D1, complete sequence.
          Length = 464

 Score =  119 bits (297), Expect = 1e-25
 Identities = 64/166 (38%), Positives = 101/166 (60%), Gaps = 2/166 (1%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIAD-YLSRD 702
            KKVI L +GDP+         +A QA+ +++SS+ F+GY P VG    R+AI + Y S D
Sbjct: 74   KKVIKLHLGDPSVGGKLPPSEIAVQAMHESVSSHMFDGYGPAVGALAAREAIVERYSSAD 133

Query: 703  LPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYA-LCAAFRHLEVRYYD 879
                 +ADDV + +GC+ A++ A+  +A  G NIL+P PGFP+Y+ LC     ++  Y  
Sbjct: 134  --NVFTADDVVLASGCSHALQMAIEAVANAGENILVPHPGFPLYSTLCRPHNIVDKPYKI 191

Query: 880  LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
             +  +   +DL+ + ++ D NT A+++ NPGNP G V+T +H +EI
Sbjct: 192  DMTGEDVRIDLSYMATIIDDNTKAIIVNNPGNPTGGVFTKEHLEEI 237



>sp|P33447|ATTY_TRYCR Tyrosine aminotransferase (EC 2.6.1.5)
            (L-tyrosine:2-oxoglutarate aminotransferase)
            (TAT).>gb:TRBANTA_1400583 Trypanosoma cruzi antigen
            tyrosine aminotransferase gene, complete cds.
          Length = 416

 Score =  103 bits (256), Expect = 7e-21
 Identities = 52/170 (30%), Positives = 90/170 (52%), Gaps = 6/170 (3%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYL---- 693
            K +I L +GDPT      + A   + + + + S + NGY PTVG P+ R+A+A +     
Sbjct: 33   KPIIKLSVGDPTLDKNLLTSAAQIKKLKEAIDSQECNGYFPTVGSPEAREAVATWWRNSF 92

Query: 694  --SRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEV 867
                +L   +  D+V + +G +  I  A++ +   G   L+P+PGFP Y        + +
Sbjct: 93   VHKEELKSTIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGM 152

Query: 868  RYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
             +Y+  PE  WE DL+ +  L D  T  +++ NP NPCG+ ++ +H ++I
Sbjct: 153  HFYNCRPENDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDI 202



>gb:AF165323_1246718 Trypanosoma rangeli tyrosine aminotransferase
            gene, complete cds.
          Length = 420

 Score =  100 bits (250), Expect = 4e-20
 Identities = 54/170 (31%), Positives = 86/170 (50%), Gaps = 6/170 (3%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYL---- 693
            K +I L +GDPT      +PA   + +   + S  +NGY PTVG P+   AIA +     
Sbjct: 38   KPIIKLSVGDPTLDKNLLTPASHMEKLKKVVDSQDWNGYLPTVGAPEACDAIATWWRNSF 97

Query: 694  --SRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEV 867
              ++ L   +  D+V   +G +  I  A++ +   G  +L+P+PGFP Y        L +
Sbjct: 98   VHNKQLKGSIVKDNVVCCSGGSHGILMAITAICDAGDYVLVPKPGFPHYETVCKAYGLGM 157

Query: 868  RYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
              Y+   +  WE DL+ +  L D  T  +VI NP NPCG+ +  QH +++
Sbjct: 158  HLYNCRADNNWEADLDEIRQLKDDKTKLIVITNPSNPCGSNFRRQHVEDL 207



>gb:AE012558_284806 Xylella fastidiosa Temecula1, section 6 of 9 of
            the complete genome.>gb:AE009442_961382 Xylella
            fastidiosa Temecula1, complete genome.
          Length = 425

 Score = 92.8 bits (229), Expect = 1e-17
 Identities = 53/166 (31%), Positives = 89/166 (53%)
 Frame = +1

Query: 520  DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSR 699
            + +K+I L +G+P A+  F +P   Q+A++D +   + + Y+   GLP  R+AIA   +R
Sbjct: 37   EGRKLIKLNIGNPGAFG-FRAPEHLQRAIADDMG--RTDPYTHQQGLPIAREAIAAAYAR 93

Query: 700  DLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYD 879
                 V AD V+V  G ++ I+ +L  L  PG  +L+P P +P+++           YY 
Sbjct: 94   RHYPDVDADRVFVGNGVSELIDLSLRALLNPGDEVLVPSPDYPLWSAATILNDGRPVYYR 153

Query: 880  LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
              PE  ++ D   +E+L    T A+V+INP NP G  Y+ +  + I
Sbjct: 154  CAPENGFQPDAVEIETLVSSRTRAIVLINPNNPSGANYSQELLERI 199



>gb:AP006878_576246 Thermococcus kodakaraensis strain KOD1 DNA,
            complete genome.
          Length = 399

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 53/163 (32%), Positives = 81/163 (49%)
 Frame = +1

Query: 529  KVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLP 708
            +VI L +GDP  Y  F  P   ++A    +     N Y P+ GLP+ R+A+     R   
Sbjct: 31   EVIRLNIGDPGKYD-FQPPEHMKEAYCRAIKE-GHNYYGPSEGLPEMREAVVQREKRKNG 88

Query: 709  EKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLP 888
              ++ DDV VT   T+A++     L  PG NIL+P P +P Y     F       YD + 
Sbjct: 89   VDITPDDVRVTTAVTEALQLLFGALLDPGDNILVPSPSYPPYTGLVKFYGGIPNEYDTIE 148

Query: 889  EKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            E  W+ D++ +    ++ T A+ +INP NP G +Y  +  +EI
Sbjct: 149  ENGWQPDIDDMRKRINERTKAIAVINPNNPTGALYEKKTVKEI 191



>pir|C82564|C82564 aminotransferase XF2396 [imported] - Xylella
            fastidiosa  (strain 9a5c)>gb:AE004048_50024 Xylella
            fastidiosa 9a5c, section 194 of 229 of the complete
            genome.>gb:AE003849_1117234 Xylella fastidiosa 9a5c,
            complete genome.
          Length = 425

 Score = 92.0 bits (227), Expect = 2e-17
 Identities = 54/167 (32%), Positives = 91/167 (54%), Gaps = 1/167 (0%)
 Frame = +1

Query: 520  DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIAD-YLS 696
            + +K+I L +G+P A+  F +P   Q+A++D +   + + Y+   GLP  R+AIA  Y+ 
Sbjct: 37   EGRKLIKLNIGNPGAFG-FRAPEHLQRAIADDMG--RTDPYTHQQGLPIAREAIAAAYVR 93

Query: 697  RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
            R  P+   AD V+V  G ++ I+ +L  L  PG  +L+P P +P+++           YY
Sbjct: 94   RHYPD-ADADRVFVGNGVSELIDLSLRALLNPGDEVLVPSPDYPLWSAATILNDGRPVYY 152

Query: 877  DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
               PE  ++ D   +E+L    T A+V+INP NP G  Y+ +  + I
Sbjct: 153  RCAPENGFQPDAVEIETLVSSRTRAIVLINPNNPSGANYSQELLERI 199



>gb:AE011997_278408 Xanthomonas axonopodis pv. citri str. 306, section
            375 of 469 of the complete genome.>gb:AE008923_920183
            Xanthomonas axonopodis pv. citri str. 306, complete
            genome.
          Length = 423

 Score = 90.1 bits (222), Expect = 6e-17
 Identities = 50/164 (30%), Positives = 87/164 (53%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
            +K+I L +G+P A+  F +P   Q+A++D +   + + Y+   GLP+ R+AIA   +R  
Sbjct: 38   RKLIKLNIGNPGAFG-FRAPEHLQRAIADDMG--RTDPYTHQQGLPEAREAIATAYARRQ 94

Query: 706  PEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLL 885
                  D ++V  G ++ I+ +L  L  PG  +L+P P +P+++           YY   
Sbjct: 95   HPDAHPDRIFVGNGVSELIDLSLRALLNPGDEVLVPSPDYPLWSAATILNDGRPVYYRCA 154

Query: 886  PEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            PE  ++ D   +E+L    T A+V+INP NP G  Y+ +  + I
Sbjct: 155  PENGFQPDPVEIETLVSSRTRAIVLINPNNPSGASYSRELLERI 198



>gb:AE012455_282590 Xanthomonas campestris pv. campestris str. ATCC
            33913, section 363 of 460 of the complete
            genome.>gb:AE008922_915872 Xanthomonas campestris pv.
            campestris str. ATCC 33913, complete genome.
          Length = 423

 Score = 89.4 bits (220), Expect = 1e-16
 Identities = 49/164 (29%), Positives = 87/164 (53%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
            +K+I L +G+P A+  F +P   Q+A++D +   + + Y+   GLP+ R+AIA   +R  
Sbjct: 38   RKLIKLNIGNPGAFG-FRAPEHLQRAIADDMG--RTDPYTHQQGLPEAREAIAAAYARRQ 94

Query: 706  PEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLL 885
                  D +++  G ++ I+ +L  L  PG  +L+P P +P+++           YY   
Sbjct: 95   HPDAHPDRIFIGNGVSELIDLSLRALLNPGDEVLVPSPDYPLWSAATILNDGRPVYYRCA 154

Query: 886  PEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            PE  ++ D   +E+L    T A+V+INP NP G  Y+ +  + I
Sbjct: 155  PENGFQPDPVEIETLVSSRTRAIVLINPNNPSGASYSRELLERI 198



>gb:AF266241_2483293 Gillichthys seta clone Eh24 tyrosine
           aminotransferase mRNA, partial cds.
          Length = 209

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 60/168 (35%), Positives = 101/168 (60%), Gaps = 3/168 (1%)
 Frame = +1

Query: 412 ETEKKQTRGEIETPTNITIKGILGLLMANIEGSE--GDDSKKVISLGMGDPTAYSCFHSP 585
           +T+ ++ R E++ P+++  K  L  + A ++G +   + +K +I+L +GDPT +    + 
Sbjct: 49  KTKSRRQRWEVK-PSDMAQK-TLNPIRAIVDGMKLTPNPNKPMIALSIGDPTVFGNLPTD 106

Query: 586 ALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE-KVSADDVYVTAGCTQAI 762
               QA+ D + S+KFNGY+P+VG  Q+R+A+A++ S   PE  + A+DV +T+GC+QAI
Sbjct: 107 ETVLQAMKDAIDSHKFNGYAPSVGYLQSRQAVANFYS--CPEAPLDAEDVILTSGCSQAI 164

Query: 763 ETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPEKAWEV 906
           + A+S+L  PG +     P F        F  +EV     LPEK+WEV
Sbjct: 165 DLAISVLCNPG-DTSWCLPSFS-STNSGCFLGIEVNSTS-LPEKSWEV 209



>gb:AE010251_261064 Pyrococcus furiosus DSM 3638, section 126 of 173
            of the complete genome.>gb:AF163769_484624 Pyrococcus
            furiosus alanine aminotransferase (aat) gene, complete
            cds.>gb:AE009950_901845 Pyrococcus furiosus DSM 3638,
            complete genome.
          Length = 398

 Score = 88.6 bits (218), Expect = 2e-16
 Identities = 53/163 (32%), Positives = 80/163 (49%)
 Frame = +1

Query: 529  KVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLP 708
            KVI L +GDP  +  F  P   ++A    +     N Y  + GLP+ RKAI +   R   
Sbjct: 31   KVIRLNIGDPVKFD-FQPPEHMKEAYCKAIKE-GHNYYGDSEGLPELRKAIVEREKRKNG 88

Query: 709  EKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLP 888
              ++ DDV VTA  T+A++     L  PG  IL+P P +P Y     F   +   Y  + 
Sbjct: 89   VDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTIE 148

Query: 889  EKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            E+ W+ D++ +       T A+ +INP NP G +Y  +  +EI
Sbjct: 149  EEDWQPDIDDIRKKITDRTKAIAVINPNNPTGALYDKKTLEEI 191



>gb:AE014295_311106 Bifidobacterium longum NCC2705, complete genome.
          Length = 514

 Score = 87.4 bits (215), Expect = 4e-16
 Identities = 64/235 (27%), Positives = 104/235 (44%), Gaps = 13/235 (5%)
 Frame = +1

Query: 352  TALLNLDSLNL----SHFLQKIVIETEKKQTRGEIETPTNITI--KGILGLLMANIEGSE 513
            T  LN D+ N      H    +     K QT  EI      T      L  ++ ++ G  
Sbjct: 71   TTQLNSDASNSVTDGEHAATPLATGASKPQTDSEIPVGRRRTFGKSHKLDNVLYDVRGPV 130

Query: 514  GDDSKK-------VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTR 672
             D++ +       ++ L +G+P  +  F +P      ++  L+  +  GYSP+ GL   R
Sbjct: 131  ADEAMRMEANGTHILKLNIGNPAPFG-FRTPDEVVYDMAHQLTDTE--GYSPSKGLFSAR 187

Query: 673  KAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAF 852
            KAI  Y        V+ DD+Y   G ++ I  ++S L   G  +L+P P +P++  C   
Sbjct: 188  KAIMQYAQLKNIPNVTIDDIYTGNGVSELINLSMSALLDTGDEVLVPSPDYPLWTACVNL 247

Query: 853  RHLEVRYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
                  +Y    +  W  D++ + S    NT A+VIINP NP G +Y  +  Q+I
Sbjct: 248  AGGTAVHYLCDEQSEWYPDIDDIRSKITSNTKAIVIINPNNPTGALYPKEVLQQI 302



>gb:AE013598_294795 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 840

 Score = 85.1 bits (209), Expect = 2e-15
 Identities = 46/157 (29%), Positives = 83/157 (52%)
 Frame = +1

Query: 526 KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
           +K+I L +G+P A+  F +P   Q+A++D +   + + Y+   GL + R+A+A   +R  
Sbjct: 455 RKLIKLNIGNPGAFG-FRAPEHLQRAIADDMG--RTDPYTHQQGLLEAREAVAKAYARRQ 511

Query: 706 PEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLL 885
                 D +++  G ++ I+ +L  L  PG  +L+P P +P+++           YY   
Sbjct: 512 HPDAHPDRIFIGNGVSELIDLSLRALLNPGDEVLVPSPDYPLWSAATILNDGRPVYYRCA 571

Query: 886 PEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYT 996
           PE  ++ D   +E+L    T A+V+INP NP G  Y+
Sbjct: 572 PENGFQPDPVEIETLVSSRTRAIVLINPNNPSGASYS 608



>pir|G81078|G81078 probable transaminase (EC 2.6.1.-) NMB1473
            [similarity] - Neisseria meningitidis (strain MC58
            serogroup B)>gb:AE002497_46881 Neisseria meningitidis
            serogroup B strain MC58 section 139 of 206 of the
            complete genome.>gb:AE002098_896994 Neisseria
            meningitidis serogroup B strain MC58 complete genome.
          Length = 404

 Score = 84.3 bits (207), Expect = 3e-15
 Identities = 51/169 (30%), Positives = 84/169 (49%), Gaps = 1/169 (0%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFN-GYSPTVGLPQTRKAIADYL 693
            ++  K++ L +G+P  +  F +P    + + D + +   + GY  + GL   RKAI  Y 
Sbjct: 30   EEGNKILKLNIGNPAPFG-FEAP---DEILVDVIRNLPTSQGYCDSKGLYSARKAIVHYY 85

Query: 694  SRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRY 873
                   ++ DDVY+  G ++ I  ++  L   G  IL+P P +P++   A      VR+
Sbjct: 86   QTKGLRDITVDDVYIGNGVSELITMSMQALLNDGDEILIPAPDYPLWTAAATLAGGTVRH 145

Query: 874  YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            Y    E  W  +L  +E+     T A+V+INP NP G VY+ +   EIA
Sbjct: 146  YLCDEENGWFPNLADMEAKITPKTKAIVVINPNNPTGAVYSREILLEIA 194



>pir|G81863|G81863 probable transaminase (EC 2.6.1.-) NMA1684
            [similarity] - Neisseria meningitidis (strain Z2491
            serogroup A)>gb:NMA5Z2491_154568 Neisseria meningitidis
            serogroup A strain Z2491 complete genome; segment 5/7.
          Length = 404

 Score = 84.0 bits (206), Expect = 5e-15
 Identities = 51/169 (30%), Positives = 84/169 (49%), Gaps = 1/169 (0%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFN-GYSPTVGLPQTRKAIADYL 693
            ++  K++ L +G+P  +  F +P    + + D + +   + GY  + GL   RKAI  Y 
Sbjct: 30   EEGNKILKLNIGNPAPFG-FEAP---DEILVDVIRNLPTSQGYCDSKGLYSARKAIVHYY 85

Query: 694  SRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRY 873
                   ++ DDVY+  G ++ I  ++  L   G  IL+P P +P++   A      VR+
Sbjct: 86   QTKGLRDITVDDVYIGNGVSELITMSMQALLDDGDEILIPAPDYPLWTAAATLAGGTVRH 145

Query: 874  YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            Y    E  W  +L  +E+     T A+V+INP NP G VY+ +   EIA
Sbjct: 146  YLCDEENGWFPNLADMEAKITPKTKAIVVINPNNPTGAVYSREILLEIA 194



>gb:BX321864_774697 Nitrosomonas europaea ATCC 19718, complete genome;
            segment 9/10.
          Length = 408

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 52/167 (31%), Positives = 81/167 (48%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS 696
            D+ ++VI L +G+P ++  F +P    Q V   LS+   +GY  + GL   RKAI  Y  
Sbjct: 30   DEGQRVIKLNIGNPASFG-FEAPDEILQDVIRNLSAA--SGYCDSKGLFAARKAIMHYTQ 86

Query: 697  RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
                  V  DD+Y+  G ++ I  A   L   G  IL+P P +P++    +      R+Y
Sbjct: 87   EKNIANVQMDDIYIGNGVSELIMLATQALLENGDEILVPSPDYPLWTAAISLAGGVARHY 146

Query: 877  DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
                + +W  D   +++     T A+VIINP NP G +Y     +EI
Sbjct: 147  TCDEQSSWLPDPENIKAQVSSRTRAIVIINPNNPTGALYPDDLLREI 193



>gb:AE004969_60748 Neisseria gonorrhoeae FA 1090, complete genome.
          Length = 404

 Score = 83.2 bits (204), Expect = 8e-15
 Identities = 50/169 (29%), Positives = 84/169 (49%), Gaps = 1/169 (0%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFN-GYSPTVGLPQTRKAIADYL 693
            ++  K++ L +G+P  +  F +P    + + D + +   + GY  + GL   RKAI  Y 
Sbjct: 30   EEGNKILKLNIGNPAPFG-FEAP---DEILVDVIRNLPTSQGYCDSKGLYSARKAIVHYY 85

Query: 694  SRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRY 873
                   ++ +DVY+  G ++ I  ++  L   G  IL+P P +P++   A      VR+
Sbjct: 86   QNKGLRDITVNDVYIGNGVSELIAMSMQALLNDGDEILIPAPDYPLWTAAATLAGGTVRH 145

Query: 874  YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            Y    E  W  +L  +E+     T A+V+INP NP G VY+ +   EIA
Sbjct: 146  YLCDEENGWFPNLADMEAKITSKTKAIVVINPNNPTGAVYSKEILLEIA 194



>pir|A75128|A75128 probable transaminase (EC 2.6.1.-) aspB-like2
            PAB1810 [similarity] - Pyrococcus abyssi (strain
            Orsay)>gb:CNSPAX03_849585 Pyrococcus abyssi complete
            genome; segment 3/6.
          Length = 398

 Score = 82.8 bits (203), Expect = 1e-14
 Identities = 50/163 (30%), Positives = 79/163 (48%)
 Frame = +1

Query: 529  KVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLP 708
            KVI L +GDP  +  F  P   ++A    +     N Y  + GL + R+AI +   +   
Sbjct: 31   KVIRLNIGDPVKFD-FQPPEHMKEAYCKAIKE-GHNYYGDSEGLMELREAIVEREKKKNG 88

Query: 709  EKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLP 888
              ++ DDV VTA  T+A++     L  PG  IL+P P +P Y     F       Y  + 
Sbjct: 89   VNITPDDVRVTAAVTEALQMIFGALLDPGDEILIPGPSYPPYTGLVKFYGGVPVEYRTIE 148

Query: 889  EKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            E+ W+ D++ +     + T A+ +INP NP G +Y  +  +EI
Sbjct: 149  EEGWQPDIDDLRKKITERTKAIAVINPNNPTGALYDKKTLEEI 191



>gb:L78665_139837 Methylobacillus flagellatum aspartate
           aminotransferase (aat), membrane protein (orf-1),
           homoserine dehydrogenase (hom), and threonine synthase
           (thrC) thymidylate sythase (thyA) genes, complete cds.
          Length = 429

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 48/159 (30%), Positives = 78/159 (49%)
 Frame = +1

Query: 517 DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS 696
           +D  ++I L +G+P  +  F +P    Q V   + S   +GY+ + GL   RKAI  Y  
Sbjct: 30  EDGHRIIKLNIGNPAPFG-FAAPEEILQDVIRNMDSA--SGYTDSKGLFAARKAIMHYTQ 86

Query: 697 RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
           +   + V+ DD+ +  G ++ I  A+  L   G  +L+P P +P++           R+Y
Sbjct: 87  QKNIQGVTIDDIIIGNGVSELIVMAMQALLNNGDQVLVPMPDYPLWTAAVNLAGGTARHY 146

Query: 877 DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVY 993
               +  W  DL  +E+    NT  +VIINP NP G +Y
Sbjct: 147 VCDEQTGWLPDLRDIENKITANTRGIVIINPNNPTGALY 185



>pir|D71003|D71003 probable transaminase (EC 2.6.1.-) PH1322
            [similarity] - Pyrococcus horikoshii>gb:BA000001_649990
            Pyrococcus horikoshii OT3 DNA, complete genome.
          Length = 401

 Score = 80.9 bits (198), Expect = 4e-14
 Identities = 50/163 (30%), Positives = 78/163 (47%)
 Frame = +1

Query: 529  KVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLP 708
            KVI L +GDP  +  F  P   ++A    +     N Y  + GL + R+AI         
Sbjct: 34   KVIRLNIGDPVKFD-FQPPEHMKEAYCRAIQE-GHNYYGDSEGLIELREAIVKREKEKNG 91

Query: 709  EKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLP 888
              ++ DDV VTA  T+A++     L  PG  IL+P P +P Y     F   +   Y  + 
Sbjct: 92   VDITPDDVRVTAAVTEALQLIFGALLDPGDEILIPGPSYPPYTGLVKFYGGKPVEYRTIE 151

Query: 889  EKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            E+ W+ D++ +     + T A+ +INP NP G +Y  +  +EI
Sbjct: 152  EEGWQPDIDDLRKKISERTKAIAVINPNNPTGALYDKKTIEEI 194



>gb:SAG766852_171248 Streptococcus agalactiae NEM316 complete genome,
            segment 10.>gb:AE014267_306973 Streptococcus agalactiae
            2603V/R section 77 of 100 of the complete
            genome.>gb:AE009948_937086 Streptococcus agalactiae
            2603V/R complete genome.
          Length = 403

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 47/167 (28%), Positives = 84/167 (50%), Gaps = 1/167 (0%)
 Frame = +1

Query: 520  DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFN-GYSPTVGLPQTRKAIADYLS 696
            + +K++ L  G+P A+  F +P    + + D +++ + + GYS + G+   RKA+  Y  
Sbjct: 31   NGEKILRLNTGNPAAFG-FEAP---DEVIRDLITNARESEGYSDSKGIFSARKAVMQYYQ 86

Query: 697  RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
                  V  DD+Y+  G ++ I  ++  L      +L+P P +P++  C +       +Y
Sbjct: 87   LQNIH-VDMDDIYIVNGVSEGISMSMQALLDNDDEVLVPMPDYPLWTACVSLAGGNAVHY 145

Query: 877  DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
                E  W  D++ ++S     T A+V+INP NP G VY  +  QEI
Sbjct: 146  ICDEEANWYPDIDDIKSKITSKTKAIVLINPNNPTGAVYPREILQEI 192



>pir|D72450|D72450 probable aspartate transaminase (EC 2.6.1.1)
           APE2248 [similarity] - Aeropyrum pernix (strain
           K1)>gb:BA000002_653004 Aeropyrum pernix K1 DNA, complete
           genome.
          Length = 409

 Score = 80.5 bits (197), Expect = 5e-14
 Identities = 47/160 (29%), Positives = 79/160 (49%), Gaps = 2/160 (1%)
 Frame = +1

Query: 520 DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSR 699
           + ++VIS G+G P   +  H    A++A+ +      F GY+ T G+P+ R+AIA YL+ 
Sbjct: 39  EGRRVISFGIGQPDFPTPHHIREAAKKALDEG-----FTGYTETAGIPELREAIAWYLNS 93

Query: 700 DLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYD 879
                VS ++V  T G   AI   +++   PG  +++P P +  YA  A        Y  
Sbjct: 94  RYGADVSPEEVIATTGAKTAIFLGMALYLRPGDEVIIPDPSYYAYAQVAKLFGARPVYVP 153

Query: 880 LL--PEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVY 993
           +   P   +  D+  +E    + T  +V+ NP NP G+V+
Sbjct: 154 MKFEPGLGFRFDIEGIERAVSEKTRMIVVNNPHNPTGSVF 193



>gb:CP000023_875487 Streptococcus thermophilus LMG 18311, complete
           genome.>gb:CP000024_877414 Streptococcus thermophilus
           CNRZ1066, complete genome.
          Length = 404

 Score = 79.7 bits (195), Expect = 8e-14
 Identities = 45/157 (28%), Positives = 79/157 (50%), Gaps = 1/157 (0%)
 Frame = +1

Query: 526 KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFN-GYSPTVGLPQTRKAIADYLSRD 702
           +K++ L  G+P  +  F +P    + + D + + + + GYS + G+   RKAI  Y    
Sbjct: 33  EKILRLNTGNPAEFG-FTAP---DEVIRDLIMNVRNSEGYSDSKGIFSARKAIMQYCQLK 88

Query: 703 LPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDL 882
               V  DD+Y+  G ++ I  ++  L   G  +L+P P +P++  C +       +Y  
Sbjct: 89  GFPNVDIDDIYIGNGVSEMIPMSMQALLDDGDEVLVPMPDYPLWTACVSLAGGNAVHYVC 148

Query: 883 LPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVY 993
             +  W  D++ ++S    NT A+VIINP NP G +Y
Sbjct: 149 DEKSNWYPDIDDIKSKITSNTKAIVIINPNNPTGALY 185



>gb:CR543861_103992 Acinetobacter sp. ADP1 complete genome.
          Length = 476

 Score = 79.7 bits (195), Expect = 8e-14
 Identities = 58/209 (27%), Positives = 95/209 (45%), Gaps = 8/209 (3%)
 Frame = +1

Query: 415  TEKKQTRGEIETPTNITIKGILGLLMANIEG-------SEGDDSKKVISLGMGDPTAYSC 573
            +E  +    I+TP  I     L  +  +I G          +   K+I L +G+P  +  
Sbjct: 62   SESLKMTNTIQTPREIKKSSKLEHVCYDIRGPVLRAANEMEEQGHKIIKLNIGNPAPFG- 120

Query: 574  FHSPALAQQAVSDT-LSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGC 750
            F +P   Q+ ++D  L+     GY+ + G+   RKAI  Y  +     +  +DVYV  G 
Sbjct: 121  FEAP---QEIINDVALNLPNAIGYTDSKGIFPARKAICQYYQQKGIRDMHVNDVYVGNGV 177

Query: 751  TQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESL 930
            ++ I  A+  L   G  +L+P P +P++            +Y    E +W  D+  +ES 
Sbjct: 178  SELIVMAMQGLLNDGDEMLVPMPDYPLWTAAVNLSGGTAIHYKCDEENSWYPDIVDMESK 237

Query: 931  ADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
               NT  +V+INP NP G+VY     Q+I
Sbjct: 238  ITPNTRGIVVINPNNPTGSVYPRHVLQQI 266



>gb:CP000003_861431 Streptococcus pyogenes MGAS10394, complete genome.
          Length = 416

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 46/165 (27%), Positives = 83/165 (50%), Gaps = 1/165 (0%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFN-GYSPTVGLPQTRKAIADYLSRD 702
            +K++ L  G+P A+  F +P    + + D + + + + GYS + G+   RKAI  Y    
Sbjct: 45   EKILRLNTGNPAAFG-FEAP---DEVIRDLIVNARLSEGYSDSKGIFSARKAIMQYCQLK 100

Query: 703  LPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDL 882
                V  +D+Y+  G ++ I  +L  L   G  +L+P P +P++  C +    +  +Y  
Sbjct: 101  GFPDVDIEDIYLGNGVSELISMSLQALLDNGDEVLVPMPDYPLWTACVSLGGGKAVHYLC 160

Query: 883  LPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
              E  W  D+  ++S     T A+V+INP NP G +Y  +  ++I
Sbjct: 161  DEEAGWYPDIADIKSKITSRTKAIVVINPNNPTGALYPKEILEDI 205



>gb:BA000034_713245 Streptococcus pyogenes SSI-1 DNA, complete genome.
          Length = 412

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 46/165 (27%), Positives = 83/165 (50%), Gaps = 1/165 (0%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFN-GYSPTVGLPQTRKAIADYLSRD 702
            +K++ L  G+P A+  F +P    + + D + + + + GYS + G+   RKAI  Y    
Sbjct: 41   EKILRLNTGNPAAFG-FEAP---DEVIRDLIVNARLSEGYSDSKGIFSARKAIMQYCQLK 96

Query: 703  LPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDL 882
                V  +D+Y+  G ++ I  +L  L   G  +L+P P +P++  C +    +  +Y  
Sbjct: 97   GFPDVDIEDIYLGNGVSELISISLQALLDNGDEVLVPMPDYPLWTACVSLGGGKAVHYLC 156

Query: 883  LPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
              E  W  D+  ++S     T A+V+INP NP G +Y  +  ++I
Sbjct: 157  DEEAGWYPDIADIKSKITSRTKAIVVINPNNPTGALYPKEILEDI 201



>gb:AE016862_351211 Pseudomonas syringae pv. tomato str. DC3000
           section 7 of 21 of the complete
           genome.>gb:AE016853_1036386 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 403

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 47/160 (29%), Positives = 80/160 (50%)
 Frame = +1

Query: 517 DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS 696
           ++  +++ L +G+P  +  F +P    Q V   L + +  GYS + GL   RKA+  Y  
Sbjct: 29  EEGHRILKLNIGNPAPFG-FEAPDEILQDVIRNLPTAQ--GYSDSKGLFSARKAVMQYYQ 85

Query: 697 RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
           +   E V  +D+Y+  G ++ I  ++  L   G  +L+P P +P++    A       +Y
Sbjct: 86  QKQVEGVGIEDIYLGNGVSELIVMSMQALLNNGDEVLVPAPDYPLWTAAVALSGGSPVHY 145

Query: 877 DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYT 996
               +  W  DL  +++    NT A+VIINP NP G VY+
Sbjct: 146 LCDEQANWWPDLEDIKAKITPNTKAMVIINPNNPTGAVYS 185



>gb:AE010090_259248 Streptococcus pyogenes strain MGAS8232, section
            138 of 173 of the complete genome.>gb:AE009949_905630
            Streptococcus pyogenes strain MGAS8232, complete genome.
          Length = 404

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 46/165 (27%), Positives = 83/165 (50%), Gaps = 1/165 (0%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFN-GYSPTVGLPQTRKAIADYLSRD 702
            +K++ L  G+P A+  F +P    + + D + + + + GYS + G+   RKAI  Y    
Sbjct: 33   EKILRLNTGNPAAFG-FEAP---DEVIRDLIVNARLSEGYSDSKGIFSARKAIMQYCQLK 88

Query: 703  LPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDL 882
                V  +D+Y+  G ++ I  +L  L   G  +L+P P +P++  C +    +  +Y  
Sbjct: 89   GFPDVDIEDIYLGNGVSELISMSLQALLDNGDEVLVPMPDYPLWTACVSLGGGKAVHYLC 148

Query: 883  LPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
              E  W  D+  ++S     T A+V+INP NP G +Y  +  ++I
Sbjct: 149  DEEAGWYPDIADIKSKITSRTKAIVVINPNNPTGALYLKEILEDI 193



>gb:AE006605_220639 Streptococcus pyogenes M1 GAS, section 134 of 167
            of the complete genome.>gb:AE014165_305022 Streptococcus
            pyogenes MGAS315, section 30 of 37 of the complete
            genome.>gb:AE014074_928201 Streptococcus pyogenes
            MGAS315, complete genome.>gb:AE004092_1106485
            Streptococcus pyogenes M1 GAS, complete genome.
          Length = 404

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 46/165 (27%), Positives = 83/165 (50%), Gaps = 1/165 (0%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFN-GYSPTVGLPQTRKAIADYLSRD 702
            +K++ L  G+P A+  F +P    + + D + + + + GYS + G+   RKAI  Y    
Sbjct: 33   EKILRLNTGNPAAFG-FEAP---DEVIRDLIVNARLSEGYSDSKGIFSARKAIMQYCQLK 88

Query: 703  LPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDL 882
                V  +D+Y+  G ++ I  +L  L   G  +L+P P +P++  C +    +  +Y  
Sbjct: 89   GFPDVDIEDIYLGNGVSELISISLQALLDNGDEVLVPMPDYPLWTACVSLGGGKAVHYLC 148

Query: 883  LPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
              E  W  D+  ++S     T A+V+INP NP G +Y  +  ++I
Sbjct: 149  DEEAGWYPDIADIKSKITSRTKAIVVINPNNPTGALYPKEILEDI 193



>pir|B83293|B83293 transaminase (EC 2.6.1.-) [similarity] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004709_57064
           Pseudomonas aeruginosa PAO1, section 270 of 529 of the
           complete genome.>gb:AE004091_971164 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 403

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 46/160 (28%), Positives = 81/160 (50%)
 Frame = +1

Query: 517 DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS 696
           ++  +++ L +G+P  +  F +P    Q V   L + +  GYS + GL   RKA+  Y  
Sbjct: 29  EEGHRILKLNIGNPAPFG-FEAPEEILQDVIRNLPTAQ--GYSDSKGLFSARKAVMQYYQ 85

Query: 697 RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
           +   E V  +D+Y+  G ++ I  ++  L   G  +L+P P +P++    +    +  +Y
Sbjct: 86  QKQVEGVGIEDIYLGNGVSELIVMSMQALLNNGDEVLIPAPDYPLWTAAVSLAGGKPVHY 145

Query: 877 DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYT 996
               +  W  DL  +++    NT A+VIINP NP G VY+
Sbjct: 146 LCDEQANWWPDLEDIKAKITPNTRAMVIINPNNPTGAVYS 185



>gb:AE016913_355956 Chromobacterium violaceum ATCC 12472 section 4 of
            16 of the complete genome.>gb:AE016825_1041110
            Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 434

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 46/167 (27%), Positives = 81/167 (48%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS 696
            D+  ++I L +G+P  +  F    + +  + +  ++   +GYS + GL   RKAI  Y  
Sbjct: 54   DEGHRIIKLNIGNPAPFGFFAPDEIIEDVIVNLPAA---SGYSDSKGLFAARKAIMHYAQ 110

Query: 697  RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
            +     V+ DD+ V  G ++ I  A+  L   G  +L+P P +P++    +    +  +Y
Sbjct: 111  QKHLPNVAMDDIIVGNGVSELIVMAMQALLDNGDEVLVPAPDYPLWTAAVSLAGGKAVHY 170

Query: 877  DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
                E+ W   ++ + +     T A+VIINP NP G VY     Q+I
Sbjct: 171  LCDEEQGWFPSIDDIRAKITPTTRAIVIINPNNPTGAVYPPALLQQI 217



>gb:AE016780_331305 Pseudomonas putida KT2440 section 7 of 21 of the
           complete genome.>gb:AE015451_946382 Pseudomonas putida
           KT2440 complete genome.
          Length = 403

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 46/160 (28%), Positives = 82/160 (51%)
 Frame = +1

Query: 517 DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS 696
           ++  +++ L +G+P  +  F +P    Q V   L + +  GYS + GL   RKA+  Y  
Sbjct: 29  EEGHRILKLNIGNPAPFG-FEAPDEILQDVIRNLPTAQ--GYSDSKGLFSARKAVMQYCQ 85

Query: 697 RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
           +   E V+ +D+Y+  G ++ I  ++  L   G  +L+P P +P++    +    +  +Y
Sbjct: 86  QKDIEGVTIEDIYLGNGVSELIVMSMQALLNNGDEVLIPAPDYPLWTAAVSLAGGKPVHY 145

Query: 877 DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYT 996
               +  W  DL  +++    NT A+VIINP NP G VY+
Sbjct: 146 LCDEQADWFPDLEDIKAKITPNTKALVIINPNNPTGAVYS 185



>gb:AE006039_214940 Pasteurella multocida subsp. multocida str. Pm70
            section 6 of 204 of the complete
            genome.>gb:AE004439_1117670 Pasteurella multocida subsp.
            multocida str. Pm70, complete genome.
          Length = 404

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 49/167 (29%), Positives = 80/167 (47%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS 696
            ++  K++ L +G+P  +  F +P      V   L + +  GY  + GL   RKAI  Y  
Sbjct: 30   EEGHKILKLNIGNPAPFG-FEAPDEILVDVIRNLPTAQ--GYCDSKGLYSARKAIVQYYQ 86

Query: 697  RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
                   + +DVY+  G ++ I  +L  L   G  +L+P P +P++   A     +  +Y
Sbjct: 87   SKGIHGATVNDVYIGNGVSELITMSLQALLNDGDEVLIPMPDYPLWTAAATLAGGKPVHY 146

Query: 877  DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
                E  W  D+N ++S   + T A+V+INP NP G VY+     EI
Sbjct: 147  LCDEEANWFPDVNDIKSKITKRTKAIVVINPNNPTGAVYSQDLLLEI 193



>gb:AF289216_496156 Thermococcus sp. TK1 isolate TK1 alanine
            aminotransferase gene, complete cds.>gb:AF319635_499555
            Thermococcus litoralis putative dihidrodipicolinate
            synthase (dapA), Ni-Fe hydrogenase maturation protein
            HypC (hypC), Ni-Fe hydrogenase maturation protein HypD
            (hypD), and alanine aminotransferase-like protein (aat)
            genes, complete cds.
          Length = 397

 Score = 77.8 bits (190), Expect = 3e-13
 Identities = 47/163 (28%), Positives = 79/163 (48%)
 Frame = +1

Query: 529  KVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLP 708
            K+I L +GDP  +  F  P   ++A  + +     N Y  + G  + R+AI +   +   
Sbjct: 31   KIIKLNIGDPVKFD-FQPPEHMKKAYCEAIME-GHNYYGDSEGDRELREAIVEREKKKNG 88

Query: 709  EKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLP 888
              ++ +DV VTA  T+A++     L   G  IL+P P +P Y     F     + Y  + 
Sbjct: 89   VDITPEDVQVTAAVTEALQFIFGALIDGGEEILIPGPSYPPYVGLVKFYGGVPKAYRTVE 148

Query: 889  EKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            E+ W+ D++ +     + T A+ +INP NP G +Y  +  QEI
Sbjct: 149  EEGWQPDIDDMRKKITEKTKAIAVINPNNPTGALYEKKTLQEI 191



>gb:AE015009_314123 Streptococcus mutans UA159 section 157 of 185 of
           the complete genome.>gb:AE014133_941124 Streptococcus
           mutans UA159 complete genome.
          Length = 405

 Score = 77.4 bits (189), Expect = 4e-13
 Identities = 43/159 (27%), Positives = 80/159 (50%), Gaps = 1/159 (0%)
 Frame = +1

Query: 520 DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS- 696
           + +K++ L  G+P A+       + +  + +   S    GYS + G+   RKAI  Y   
Sbjct: 32  NGEKILRLNTGNPAAFGLTAPDEVIRDLIMNARES---EGYSDSKGIFSARKAIMQYCQL 88

Query: 697 RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
           +++P+ V  DD+Y+  G ++ I  ++  L   G  +L+P P +P++    +    +  +Y
Sbjct: 89  KNIPD-VDVDDIYIGNGVSEMITMSMQGLLDDGDEVLVPMPDYPLWTAAVSLAGGQAVHY 147

Query: 877 DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVY 993
                  W  D++ ++S    NT A+V+INP NP G +Y
Sbjct: 148 VCDESSNWYPDIDNIKSKITSNTKALVVINPNNPTGALY 186



>gb:BX950851_841769 Erwinia carotovora subsp. atroseptica SCRI1043,
           complete genome.
          Length = 404

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 48/161 (29%), Positives = 81/161 (50%), Gaps = 1/161 (0%)
 Frame = +1

Query: 517 DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIAD-YL 693
           ++  KV+ L +G+P  +  F +P      V   L + +  GY  + GL   RKAI   Y 
Sbjct: 30  EEGNKVLKLNIGNPAPFG-FEAPDEILVDVIRNLPTAQ--GYCDSKGLYSARKAIVQHYQ 86

Query: 694 SRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRY 873
           +RD+ + ++ +DVY+  G ++ I  ++  L  PG  +L+P P +P++    +  +    +
Sbjct: 87  ARDMRD-MTVEDVYIGNGVSELIVQSMQALLNPGDEMLVPAPDYPLWTAAVSLSNGNAVH 145

Query: 874 YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYT 996
           Y       W  DL+ +      NT  +VIINP NP G VY+
Sbjct: 146 YLCDESSDWFPDLDDIRKKITSNTRGIVIINPNNPTGAVYS 186



>gb:BA000030_702794 Streptomyces avermitilis MA-4680 genomic DNA,
            complete genome.
          Length = 408

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 51/166 (30%), Positives = 84/166 (50%), Gaps = 2/166 (1%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
            + VI  G G+P     F +P    QA  +  S+ K++ Y+P  GLP+ + AIA    RD 
Sbjct: 39   RPVIGFGAGEPD----FPTPDYIVQAAIEACSNPKYHRYTPAGGLPELKAAIAAKTLRDS 94

Query: 706  PEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLL 885
              +V A  V VT G  QAI  A + +  PG  +++P P +  Y    + R       D++
Sbjct: 95   GYEVDASQVLVTNGGKQAIYEAFAAILDPGDEVIVPAPYWTTYP--ESIRLAGGVPVDVV 152

Query: 886  PEK--AWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
             ++   + V +  +E+   +NT  ++ ++P NP G VYT +  +EI
Sbjct: 153  ADETTGYRVSVEQLEAARTENTKVLLFVSPSNPTGAVYTREQIEEI 198



>gb:AY596298_634853 Haloarcula marismortui ATCC 43049 chromosome II,
            complete sequence.
          Length = 372

 Score = 77.0 bits (188), Expect = 6e-13
 Identities = 49/169 (28%), Positives = 83/169 (49%)
 Frame = +1

Query: 514  GDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYL 693
            G+D+   I+LG+G P     F +P  A++A    +     + Y+   G+P+ R+AI+D  
Sbjct: 24   GEDA---INLGLGQPD----FPTPEHAREAAMSAIQDGMGDSYTSNKGIPELREAISDRY 76

Query: 694  SRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRY 873
            + D  + + A+++  TAG ++AI  A+     PG  +L P PGF  Y         E + 
Sbjct: 77   ATDNGQDIPAENIIATAGASEAIHVAIEAHVQPGDEVLCPDPGFLAYEQLVLLAGGEPKR 136

Query: 874  YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
             +L  +    +D  AVE+    NT   ++ +P NP G V + +   E A
Sbjct: 137  VELRDDLT--LDPAAVENAITDNTSLFIVNSPANPTGAVQSKRDMAEFA 183



>pir|H82131|H82131 transaminase (EC 2.6.1.-) [similarity] - Vibrio
            cholerae  (strain N16961 serogroup O1)>gb:AE004273_52355
            Vibrio cholerae O1 biovar eltor str. N16961 chromosome I,
            section 181 of 251 of the complete
            chromosome.>gb:AE003852_1053129 Vibrio cholerae O1 biovar
            eltor str. N16961 chromosome I, complete chromosome.
          Length = 404

 Score = 76.3 bits (186), Expect = 9e-13
 Identities = 45/168 (26%), Positives = 80/168 (47%), Gaps = 1/168 (0%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFN-GYSPTVGLPQTRKAIADYL 693
            ++  K++ L +G+P  +  F +P    + + D + +   + GY  + G+   RKA+  Y 
Sbjct: 30   EEGHKILKLNIGNPAPFG-FDAP---DEILVDVIRNLPTSQGYCDSKGIYSARKAVVQYY 85

Query: 694  SRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRY 873
             +     +  +DVY+  G ++ I  A+  L   G  +L+P P +P++    A    +  +
Sbjct: 86   QKKGIRSLDVEDVYIGNGASELIVMAMQALLNNGDEMLVPAPDYPLWTAAVALSGGKAVH 145

Query: 874  YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            Y    E  W  DL+ + S     T  +V+INP NP G VY+     EI
Sbjct: 146  YICDEEADWYPDLDDIRSKITPKTRGIVLINPNNPTGAVYSRDFLLEI 193



>gb:AE016827_343426 Mannheimia succiniciproducens MBEL55E, complete
            genome.
          Length = 404

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 47/169 (27%), Positives = 81/169 (47%), Gaps = 1/169 (0%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKF-NGYSPTVGLPQTRKAIADYL 693
            ++  K++ L +G+P  +  F +P    + + D + +     GY  + GL   RKAI  Y 
Sbjct: 30   EEGHKILKLNIGNPAPFG-FEAP---DEILIDVIRNLPTAQGYCDSKGLYSARKAIVQYY 85

Query: 694  SRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRY 873
                    + +DVY+  G ++ I  A+  L   G  +L+P P +P++         +  +
Sbjct: 86   QSKGIHGATVNDVYIGNGASELITMAMQALLNDGDEVLVPMPDYPLWTAAVTLAGGKAVH 145

Query: 874  YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            Y    E+ W   ++ ++S     T A+VIINP NP G VY+ +   EIA
Sbjct: 146  YLCDEEQDWFPAIDDIKSKITSRTKAIVIINPNNPTGAVYSKELLLEIA 194



>sp|P71348|YFBQ_HAEIN Probable aminotransferase HI0286 (EC
            2.6.1.-).>gb:U32714_203964 Haemophilus influenzae Rd KW20
            section 29 of 163 of the complete
            genome.>gb:L42023_1096513 Haemophilus influenzae Rd KW20
            complete genome.
          Length = 404

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 47/167 (28%), Positives = 80/167 (47%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS 696
            ++  K++ L +G+P  +  F +P      V   L S +  GY  + GL   RKAI  Y  
Sbjct: 30   EEGNKILKLNIGNPAPFG-FEAPDEILVDVLRNLPSAQ--GYCDSKGLYSARKAIVQYYQ 86

Query: 697  RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
                   + +DVY+  G ++ I  A+  L   G  +L+P P +P++         +  +Y
Sbjct: 87   SKGILGATVNDVYIGNGVSELITMAMQALLNDGDEVLVPMPDYPLWTAAVTLSGGKAVHY 146

Query: 877  DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
                +  W   ++ +++  +  T A+VIINP NP G VY+ +  QEI
Sbjct: 147  LCDEDANWFPTIDDIKAKVNAKTKAIVIINPNNPTGAVYSKELLQEI 193



>gb:BX571869_787948 Photorhabdus luminescens subsp. laumondii TTO1
            complete genome; segment 11/17.
          Length = 404

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 47/167 (28%), Positives = 79/167 (47%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS 696
            ++  KV+ L +G+P  +  F +P      V   L + +  GYS + GL   RKAI  +  
Sbjct: 30   EEGNKVLKLNIGNPAPFG-FEAPDEILVDVIRNLPTAQ--GYSDSKGLYSARKAIMQHYQ 86

Query: 697  RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
                  V+ +D+Y+  G ++ I  A+  L   G  +L+P P +P++    +    +  +Y
Sbjct: 87   ARNMMDVTVEDIYIGNGVSELIVQAMQALLNTGDEMLVPAPDYPLWTAAVSLSSGKAVHY 146

Query: 877  DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
                   W  DLN + +     T  +VIINP NP G VY+ +   E+
Sbjct: 147  MCDEGSDWFPDLNDIRNKITPRTRGIVIINPNNPTGAVYSKELLLEV 193



>sp|Q9V0L2|AAT_PYRAB Aspartate aminotransferase (EC 2.6.1.1)
            (Transaminase A) (AspAT).>pir|B75122|B75122 probable
            aromatic-amino-acid transaminase (EC 2.6.1.57) PAB0525
            [similarity] - Pyrococcus abyssi (strain
            Orsay)>gb:CNSPAX03_849538 Pyrococcus abyssi complete
            genome; segment 3/6.
          Length = 389

 Score = 74.7 bits (182), Expect = 3e-12
 Identities = 53/171 (30%), Positives = 88/171 (51%), Gaps = 6/171 (3%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
            K VISLG+G+P   +  H    A++A+   L+ Y      P +GLP+ R+AIA+ L +  
Sbjct: 26   KDVISLGIGEPDFDTPQHIKEYAKEALDMGLTHY-----GPNIGLPELREAIAEKLKKQ- 79

Query: 706  PEKVSAD---DVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYA---LCAAFRHLEV 867
               + AD   ++ V  G  QA    LS     G  +L+P P F  YA   + A  + +EV
Sbjct: 80   -NNIEADPNKEIMVLVGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEV 138

Query: 868  RYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
              Y+   E  + ++++ ++    + T A++I +P NP G+V   +  +EIA
Sbjct: 139  PTYE---ENEFRLNVDELKKYVTEKTKALIINSPCNPTGSVLKKKDLEEIA 186



>gb:AE015690_316853 Shewanella oneidensis MR-1 section 239 of 457 of
           the complete genome.>gb:AE014299_952450 Shewanella
           oneidensis MR-1 complete genome.
          Length = 404

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 46/161 (28%), Positives = 77/161 (47%), Gaps = 1/161 (0%)
 Frame = +1

Query: 517 DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSY-KFNGYSPTVGLPQTRKAIADYL 693
           D+  +++ L +G+P  +  F +P   ++ V D + +     GY  + GL   RKAI  + 
Sbjct: 30  DEGHRILKLNIGNPAPFG-FEAP---EEIVRDVILNLPSAQGYCESKGLFSARKAIVQHY 85

Query: 694 SRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRY 873
                  V  +DVY+  G ++ I  A+  L      IL+P P +P++   A     +  +
Sbjct: 86  QAQGIYDVDIEDVYIGNGVSELIMMAMQGLLNTADEILIPSPDYPLWTAAANLAGGKAVH 145

Query: 874 YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYT 996
           Y    E  W  DL+ ++S     T  +V+INP NP G VY+
Sbjct: 146 YRCDEEADWFPDLDDIKSKISSRTRGIVLINPNNPTGAVYS 186



>gb:AE013096_289015 Thermoanaerobacter tengcongensis MB4, section 123
            of 244 of the complete genome.>gb:AE008691_1111080
            Thermoanaerobacter tengcongensis strain MB4, complete
            genome.
          Length = 395

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 43/163 (26%), Positives = 82/163 (50%)
 Frame = +1

Query: 532  VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
            VI  G+G+P     F +P+  ++A  D +    +  Y+P+ G+P+ +KAI + L +D   
Sbjct: 32   VIDFGVGEPD----FDTPSYIKEAAIDAIKR-GYTKYTPSSGIPELKKAICEKLLKDNGL 86

Query: 712  KVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPE 891
              + + + V+ G   +I  ALS +  PG  +++P P +  Y       + +  +     E
Sbjct: 87   SYTPEQIVVSNGAKHSIYNALSAILNPGDEVIIPVPYWLSYPEMVRLAYGKPVFVHTKEE 146

Query: 892  KAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
              +++    +E+     T A+++ +P NP G VYT +  +EIA
Sbjct: 147  NDFKITAEELENAITPKTKAIILNSPNNPSGAVYTKEELEEIA 189



>gb:BX936398_837232 Yersinia pseudotuberculosis IP32953 genome,
            complete sequence.
          Length = 404

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 49/168 (29%), Positives = 84/168 (50%), Gaps = 1/168 (0%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIAD-YL 693
            ++  KV+ L +G+P  +  F +P      V   L + +  GY  + GL   RKAI   Y 
Sbjct: 30   EEGNKVLKLNIGNPAPFG-FDAPDEILVDVIRNLPTAQ--GYCDSKGLFSARKAIMQHYQ 86

Query: 694  SRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRY 873
            +RD+ + ++ +D+Y+  G ++ I  ++  L   G  +L+P P +P++    +    +  +
Sbjct: 87   ARDIRD-LTVEDIYIGNGVSELIVQSMQALLNLGDEMLVPAPDYPLWTAAVSLSSGKAVH 145

Query: 874  YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            Y    E  W  DL+ + S     T  +VIINP NP G VY+ +   EI
Sbjct: 146  YMCDEESGWFPDLDDIRSKITPRTRGIVIINPNNPTGAVYSKELLLEI 193



>gb:AL646064_546254 Ralstonia solanacearum GMI1000 chromosome,
           complete sequence; segment 8/19.
          Length = 413

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 44/160 (27%), Positives = 78/160 (48%)
 Frame = +1

Query: 517 DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS 696
           ++  ++I L +G+   +  F +P   QQ +   L +    GYS + G+   RKA+  Y  
Sbjct: 30  EEGHQIIKLNIGNLAPFG-FDAPEEIQQDMIRNLPNSA--GYSDSKGIFAARKAVMHYTQ 86

Query: 697 RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
           +   + V+ DD+Y+  G ++ I  A + L   G  +LLP P +P++    +       +Y
Sbjct: 87  QQGIKNVTLDDIYLGNGASELIALATNALLDAGDELLLPAPDYPLWTAMTSLSGGTPVHY 146

Query: 877 DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYT 996
                  W  DL+ + +    NT  +V+INP NP G +Y+
Sbjct: 147 LCDESNGWMPDLDDIRAKITPNTKGIVVINPNNPTGALYS 186



>gb:CR555306_108222 Azoarcus sp. EbN1 complete genome.
          Length = 406

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 45/159 (28%), Positives = 79/159 (49%)
 Frame = +1

Query: 517 DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS 696
           D+  K+I L +G+  A+  F +P   Q  +   L +    GYS + G+   RKA+  Y  
Sbjct: 28  DEGHKIIKLNIGNLAAFG-FDAPEEIQLDMIRNLPNSA--GYSESKGIFAARKAVMHYTQ 84

Query: 697 RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
           +   + V+ +D+Y+  G ++ I  A++ L   G  +L+P P +P++    +       +Y
Sbjct: 85  QKHIKGVTLEDIYIGNGVSELIVMAMNALLNIGDEVLVPAPDYPLWTAAVSLSGGTPVHY 144

Query: 877 DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVY 993
                  W  DL+ + +    NT A+V+INP NP G +Y
Sbjct: 145 ICDEANEWLPDLDDMRARITPNTRAIVVINPNNPTGALY 183



>gb:AY137386_591575 Photorhabdus temperata K122 NADH dehydrogenase I
           subunit C (nuoC) gene, partial cds; and NADH
           dehydrogenase I subunit B (nuoB), NADH dehydrogenase I
           subunit A (nuoA), LysR-family transcriptional regulator
           HexA (hexA), putative aminotransferase (yfbQ), b2291,
           YfbS (yfbS), b2295, acetate kinase (ack), and
           phosphotransacetylase (pta) genes, complete cds.
          Length = 436

 Score = 73.2 bits (178), Expect = 8e-12
 Identities = 46/160 (28%), Positives = 76/160 (47%)
 Frame = +1

Query: 517 DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS 696
           ++  KV+ L +G+P  +  F +P      V   L + +  GYS + GL   RKAI  +  
Sbjct: 62  EEGNKVLKLNIGNPAPFG-FEAPDEILVDVIRNLPTAQ--GYSDSKGLYSARKAIMQHYQ 118

Query: 697 RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
                 VS +D+Y+  G ++ I  A+  L   G  +L+P P +P++    +    +  +Y
Sbjct: 119 ARNMLDVSVEDIYIGNGVSELIVQAMQALLNTGDEMLVPAPDYPLWTAAVSLSSGKAVHY 178

Query: 877 DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYT 996
                  W  DL+ + +     T  +VIINP NP G VY+
Sbjct: 179 MCDEGSDWFPDLDDIRNKITPRTRGIVIINPNNPTGAVYS 218



>gb:AE014295_312185 Bifidobacterium longum NCC2705, complete genome.
          Length = 401

 Score = 73.2 bits (178), Expect = 8e-12
 Identities = 48/154 (31%), Positives = 76/154 (49%)
 Frame = +1

Query: 532 VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
           V+  G G+P     F +PA   +A +D     K   Y+PT GLP+ R+AIA  + RD   
Sbjct: 36  VVGFGAGEPN----FPTPANVVKAAADACLDPKNYKYTPTPGLPELREAIAAKMLRDSGY 91

Query: 712 KVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPE 891
           +V+AD V VT G  QA+  +  IL   G  +++P P +  Y                  +
Sbjct: 92  EVNADQVVVTNGGKQAVYESFQILLNDGDEVIIPAPYWTSYPEAVKLAGGVPVEVFAGAD 151

Query: 892 KAWEVDLNAVESLADQNTIAVVIINPGNPCGNVY 993
             +E  L A+E+   ++T A+++ +P NP G V+
Sbjct: 152 VNFEPSLEALEAARTEHTKAIIVNSPNNPTGAVW 185



>gb:AE010232_260820 Pyrococcus furiosus DSM 3638, section 107 of 173
            of the complete genome.>gb:AE009950_901601 Pyrococcus
            furiosus DSM 3638, complete genome.
          Length = 389

 Score = 73.2 bits (178), Expect = 8e-12
 Identities = 52/171 (30%), Positives = 88/171 (51%), Gaps = 6/171 (3%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
            K VISLG+G+P   +  H    A++ +   L+ Y      P VGLP+ R+AIA+ L +  
Sbjct: 26   KDVISLGIGEPDFDTPAHIKEYAKEGLDKGLTHY-----GPNVGLPELREAIAEKLKKQ- 79

Query: 706  PEKVSAD---DVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYA---LCAAFRHLEV 867
               + AD   ++ V  G  QA   +L+     G  +L+P P F  YA   + A  + +EV
Sbjct: 80   -NGIEADPNSEIMVLVGANQAFLMSLATFLKDGEEVLIPSPMFVSYAPAVILAGGKPVEV 138

Query: 868  RYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
              Y+   +  + ++++ ++    + T A++I +P NP G V T +  +EIA
Sbjct: 139  PTYE---DNEFRINVDDLKKHVSEKTRALIINSPNNPTGAVLTKKDLEEIA 186



>pir|D95233|D95233 aminotransferase, class I [imported] -
            Streptococcus pneumoniae (strain
            TIGR4)>gb:AE007488_227122 Streptococcus pneumoniae TIGR4
            section 171 of 194 of the complete
            genome.>gb:AE005672_1104890 Streptococcus pneumoniae
            TIGR4, complete genome.
          Length = 404

 Score = 73.2 bits (178), Expect = 8e-12
 Identities = 45/167 (26%), Positives = 81/167 (48%), Gaps = 1/167 (0%)
 Frame = +1

Query: 520  DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFN-GYSPTVGLPQTRKAIADYLS 696
            + +K++ L  G+P  +  F +P    + + D + + + + GYS + G+   RKAI  Y  
Sbjct: 31   NGEKILRLNTGNPAEFG-FTAP---DEVIHDLIMNARDSEGYSDSKGIFSARKAIMQYCQ 86

Query: 697  RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
                  V  DD+Y+  G ++ I  ++  L   G  +L+P P +P++    +       +Y
Sbjct: 87   LKKFPNVDTDDIYLGNGVSELIVMSMQGLLDNGDEVLVPMPDYPLWTAAVSLAGGNAVHY 146

Query: 877  DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
                   W  D++ ++S    NT A+V+INP NP G +Y  +   EI
Sbjct: 147  ICDEAVEWYPDIDDIKSKITSNTKAIVLINPNNPTGALYPKELLLEI 193



>sp|Q60317|AAT1_METJA Probable aspartate aminotransferase 1 (EC
           2.6.1.1) (Transaminase A) (ASPAT).>pir|A64300|A64300
           aspartate transaminase (EC 2.6.1.1) - Methanococcus
           jannaschii>gb:U67459_206088 Methanocaldococcus
           jannaschii DSM 2661 section 1 of 150 of the complete
           genome.>gb:L77117_1098846 Methanocaldococcus jannaschii
           DSM 2661, complete genome.
          Length = 375

 Score = 73.2 bits (178), Expect = 8e-12
 Identities = 45/153 (29%), Positives = 77/153 (50%)
 Frame = +1

Query: 535 ISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEK 714
           I+LG+G+P     F +P    +A    L   K + YSP  G+P+ R+ I++ L  D    
Sbjct: 26  INLGIGEPD----FDTPKHIIEAAKRALDEGKTH-YSPNNGIPELREEISNKLKDDYNLD 80

Query: 715 VSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPEK 894
           V  D++ VT G ++A+  ++  L   G  +L+P P F  Y     F   +++  DL  ++
Sbjct: 81  VDKDNIIVTCGASEALMLSIMTLIDRGDEVLIPNPSFVSYFSLTEFAEGKIKNIDL--DE 138

Query: 895 AWEVDLNAVESLADQNTIAVVIINPGNPCGNVY 993
            + +DL  V+    + T  ++  +P NP G VY
Sbjct: 139 NFNIDLEKVKESITKKTKLIIFNSPSNPTGKVY 171



>pir|F98097|F98097 aspartate transaminase (EC 2.6.1.1) [imported] -
            Streptococcus pneumoniae (strain R6)>gb:AE008545_238127
            Streptococcus pneumoniae R6 section 161 of 184 of the
            complete genome.>gb:AE007317_944285 Streptococcus
            pneumoniae R6, complete genome.
          Length = 404

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 45/167 (26%), Positives = 81/167 (48%), Gaps = 1/167 (0%)
 Frame = +1

Query: 520  DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFN-GYSPTVGLPQTRKAIADYLS 696
            + +K++ L  G+P  +  F +P    + + D + + + + GYS + G+   RKAI  Y  
Sbjct: 31   NGEKILRLNTGNPAEFG-FTAP---DEVIHDLIMNARDSEGYSDSKGIFSARKAIMQYCQ 86

Query: 697  RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
                  V  DD+Y+  G ++ I  ++  L   G  +L+P P +P++    +       +Y
Sbjct: 87   LKKFPNVDIDDIYLGNGVSELIVMSMQGLLDNGDEVLVPMPDYPLWTAAVSLAGGNAVHY 146

Query: 877  DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
                   W  D++ ++S    NT A+V+INP NP G +Y  +   EI
Sbjct: 147  ICDEAVEWYPDIDDIKSKITSNTKAIVLINPNNPTGALYPKELLLEI 193



>pir|AI0797|AI0797 probable aminotransferase STY2561 [imported] -
            Salmonella enterica subsp. enterica serovar Typhi (strain
            CT18)>gb:CP000026_75419 Salmonella enterica subsp.
            enterica serovar Paratypi A str. ATCC
            9150.>gb:AE008804_244004 Salmonella typhimurium LT2,
            section 108 of 220 of the complete
            genome.>gb:AE016836_344706 Salmonella enterica subsp.
            enterica serovar Typhi Ty2, section 3 of 16 of the
            complete genome.>gb:AL627274_542697 Salmonella enterica
            serovar Typhi (Salmonella typhi) strain CT18, complete
            chromosome; segment 10/20.>gb:AE014613_982038 Salmonella
            enterica subsp. enterica serovar Typhi Ty2, complete
            genome.>gb:AE006468_1001086 Salmonella typhimurium LT2,
            complete genome.
          Length = 404

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 46/167 (27%), Positives = 78/167 (46%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS 696
            ++  KV+ L +G+P  +  F +P      V   L + +  GY  + GL   RKAI  +  
Sbjct: 30   EEGNKVLKLNIGNPAPFG-FEAPDEILVDVIRNLPTAQ--GYCDSKGLYSARKAIMQHYQ 86

Query: 697  RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
                  V+ +D+Y+  G ++ I  A+  L   G  +L+P P +P++    +    +  +Y
Sbjct: 87   ARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHY 146

Query: 877  DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
                   W  DL+ + +     T  +VIINP NP G VY+ +   EI
Sbjct: 147  LCDESSDWFPDLDDIRAKITPRTRGIVIINPNNPTGAVYSKELLMEI 193



>gb:AE017333_449115 Bacillus licheniformis DSM 13, complete
            genome.>gb:CP000002_858909 Bacillus licheniformis ATCC
            14580, complete genome.
          Length = 390

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 45/164 (27%), Positives = 82/164 (50%), Gaps = 1/164 (0%)
 Frame = +1

Query: 532  VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
            VISLG+G+P   + ++    +  ++    +SY  N      GL   RK I+ YL++    
Sbjct: 31   VISLGVGEPDFVTAWNVREASILSLEQGYTSYTANA-----GLLSLRKEISAYLNKRFHL 85

Query: 712  KVSADD-VYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLP 888
              + DD + VT G +QA++ A+  +  PG  +L+P P F  Y    +    +  +     
Sbjct: 86   DYAPDDELIVTVGASQALDIAVRAILDPGEEVLIPEPCFVAYEALVSLAGGKAVHIHTNA 145

Query: 889  EKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            E+ ++      E++  + T A+++  P NP G+VY+ +  +EIA
Sbjct: 146  ERGFKASAADFEAVLTERTKAIILCTPSNPTGSVYSKKELEEIA 189



>gb:AE013765_299939 Yersinia pestis KIM section 165 of 415 of the
            complete genome.>gb:AE017136_388151 Yersinia pestis
            biovar Medievalis str. 91001 section 10 of 16 of the
            complete genome.>gb:AE009952_930122 Yersinia pestis KIM
            complete genome.>gb:AE017042_1144717 Yersinia pestis
            biovar Medievalis str. 91001 complete genome.
          Length = 430

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 46/167 (27%), Positives = 79/167 (47%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS 696
            ++  KV+ L +G+P  +  F +P      V   L + +  GY  + GL   RKAI  +  
Sbjct: 56   EEGNKVLKLNIGNPAPFG-FDAPDEILVDVIRNLPTAQ--GYCDSKGLFSARKAIMQHYQ 112

Query: 697  RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
                  ++ +D+Y+  G ++ I  ++  L   G  +L+P P +P++    +    +  +Y
Sbjct: 113  ARNIRDLTVEDIYIGNGVSELIVQSMQALLNLGDEMLVPAPDYPLWTAAVSLSSGKAIHY 172

Query: 877  DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
                E  W  DL+ + S     T  +VIINP NP G VY+ +   EI
Sbjct: 173  MCDEESGWFPDLDDIRSKITPRTRGIVIINPNNPTGAVYSKELLLEI 219



>pir|AD0312|AD0312 aspartate transaminase (EC 2.6.1.1) [imported] -
            Yersinia pestis (strain CO92)>gb:AJ414152_524353 Yersinia
            pestis strain CO92 complete genome; segment 12/20.
          Length = 404

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 46/167 (27%), Positives = 79/167 (47%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS 696
            ++  KV+ L +G+P  +  F +P      V   L + +  GY  + GL   RKAI  +  
Sbjct: 30   EEGNKVLKLNIGNPAPFG-FDAPDEILVDVIRNLPTAQ--GYCDSKGLFSARKAIMQHYQ 86

Query: 697  RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
                  ++ +D+Y+  G ++ I  ++  L   G  +L+P P +P++    +    +  +Y
Sbjct: 87   ARNIRDLTVEDIYIGNGVSELIVQSMQALLNLGDEMLVPAPDYPLWTAAVSLSSGKAIHY 146

Query: 877  DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
                E  W  DL+ + S     T  +VIINP NP G VY+ +   EI
Sbjct: 147  MCDEESGWFPDLDDIRSKITPRTRGIVIINPNNPTGAVYSKELLLEI 193



>pir|F91025|F91025 probable aminotransferase [imported] - Escherichia
            coli  (strain O157:H7, substrain RIMD
            0509952)>pir|G85869|G85869 probable aminotransferase
            Z3551 [imported] - Escherichia coli (strain O157:H7,
            substrain EDL933)>gb:AE005174_67418 Escherichia coli
            O157:H7 EDL933, complete genome.>gb:BA000007_661186
            Escherichia coli O157:H7 DNA, complete genome.
          Length = 405

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 46/167 (27%), Positives = 78/167 (46%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS 696
            ++  KV+ L +G+P  +  F +P      V   L + +  GY  + GL   RKAI  +  
Sbjct: 30   EEGNKVLKLNIGNPAPFG-FDAPDEILVDVIRNLPTAQ--GYCDSKGLYSARKAIMQHYQ 86

Query: 697  RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
                  V+ +D+Y+  G ++ I  A+  L   G  +L+P P +P++    +    +  +Y
Sbjct: 87   ARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHY 146

Query: 877  DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
                   W  DL+ + +     T  +VIINP NP G VY+ +   EI
Sbjct: 147  LCDESSDWFPDLDDIRAKITPRTRGIVIINPNNPTGAVYSKELLMEI 193



>sp|P77727|YFBQ_ECOLI Probable aminotransferase yfbQ (EC
            2.6.1.-).>pir|H65000|H65000 probable transaminase (EC
            2.6.1.-) b2290 [similarity] - Escherichia coli (strain
            K-12)>gb:AE005674_71948 Shigella flexneri 2a str. 301,
            complete genome.>gb:D90860_123563 E.coli genomic DNA,
            Kohara clone #404(51.7-52.1 min.).>gb:U00096_201337
            Escherichia coli K-12 MG1655 complete
            genome.>gb:AE016763_326829 Escherichia coli CFT073
            section 9 of 18 of the complete
            genome.>gb:AE016986_372145 Shigella flexneri 2a str.
            2457T section 9 of 16 of the complete
            genome.>gb:AE014075_957413 Escherichia coli CFT073
            complete genome.>gb:AE014073_996895 Shigella flexneri 2a
            str. 2457T complete genome.
          Length = 405

 Score = 72.4 bits (176), Expect = 1e-11
 Identities = 46/167 (27%), Positives = 78/167 (46%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS 696
            ++  KV+ L +G+P  +  F +P      V   L + +  GY  + GL   RKAI  +  
Sbjct: 30   EEGNKVLKLNIGNPAPFG-FDAPDEILVDVIRNLPTAQ--GYCDSKGLYSARKAIMQHYQ 86

Query: 697  RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
                  V+ +D+Y+  G ++ I  A+  L   G  +L+P P +P++    +    +  +Y
Sbjct: 87   ARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHY 146

Query: 877  DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
                   W  DL+ + +     T  +VIINP NP G VY+ +   EI
Sbjct: 147  LCDESSDWFPDLDDIRAKITPRTRGIVIINPNNPTGAVYSKELLMEI 193



>gb:CR382126_1659204 Kluyveromyces lactis strain NRRL Y-1140
            chromosome F of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 528

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 46/134 (34%), Positives = 71/134 (52%), Gaps = 8/134 (5%)
 Frame = +1

Query: 640  YSPTVGLPQTRKAIADYLS-RDLPEKVSADDVYVTAGCTQAIETALSILAY-PGANILLP 813
            YS + G+   R+ +AD+++ RD  E    +D+Y+TAG + A+   LSIL   P   +L+P
Sbjct: 157  YSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIP 216

Query: 814  RPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESL---ADQNTI---AVVIINPGN 975
             P +P+Y    A  +     Y L  E+ W  D   +E +   A Q  I    +V+INPGN
Sbjct: 217  IPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGN 276

Query: 976  PCGNVYTYQHRQEI 1017
            P G + + Q  Q+I
Sbjct: 277  PTGAILSEQSIQKI 290



>gb:BX572097_798121 Prochlorococcus marinus MIT9313 complete genome;
            segment 3/7.
          Length = 392

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 48/167 (28%), Positives = 77/167 (46%)
 Frame = +1

Query: 520  DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSR 699
            + + + SL  G+P     F++P     A    L       Y P  G P+ R+AIA  LS+
Sbjct: 32   EGRDICSLSAGEPD----FNTPEFIIDATVKALRD-GITRYGPAAGDPELREAIATKLSK 86

Query: 700  DLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYD 879
            +     +A+ V VT G  QAI     ++  PG  +L+P P +  Y   A     +V    
Sbjct: 87   ENTVPTNAEQVLVTNGGKQAIFNLFQVILNPGDEVLIPAPYWLSYPEMARLAGAKVTTLP 146

Query: 880  LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
              PE  + +DLN +E+     T  +++ +PGNP G V   +  + +A
Sbjct: 147  STPENGFCLDLNNLEASIGPKTRLLLLNSPGNPTGRVMARKELETLA 193



>gb:BX571965_791265 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.
          Length = 412

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 43/160 (26%), Positives = 73/160 (45%)
 Frame = +1

Query: 517 DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS 696
           D+  ++I L +G+   +       + Q  + +  +S   +GYS + G+   RKAI  Y  
Sbjct: 30  DEGHRIIKLNIGNLAPFGFDAPDEIIQDMIRNLPAS---SGYSDSKGVFAARKAIMHYTQ 86

Query: 697 RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
           +     V  DD+Y+  G ++ I  A   L   G  +LLP P +P++    +       +Y
Sbjct: 87  QKGVHGVGLDDIYIGNGASELIVMATQALLNDGDEVLLPAPDYPLWTAAVSLSGGTPVHY 146

Query: 877 DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYT 996
                  W  D + +      NT A+V+INP NP G +Y+
Sbjct: 147 VCDESNRWMPDPDDIRRKITPNTKALVVINPNNPTGALYS 186



>gb:BA000031_706387 Vibrio parahaemolyticus RIMD 2210633 DNA,
            chromosome 1, complete sequence.
          Length = 404

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 43/168 (25%), Positives = 79/168 (47%), Gaps = 1/168 (0%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFN-GYSPTVGLPQTRKAIADYL 693
            ++  K++ L +G+P  +  F +P    + + D + +   + GY  + G+   RKA+  + 
Sbjct: 30   EEGHKILKLNIGNPAPFG-FDAP---DEILVDVIRNLPTSQGYCDSKGIYSARKAVVQHY 85

Query: 694  SRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRY 873
             R     +  +DVYV  G ++ I  A+  L   G  +L+P P +P++    A       +
Sbjct: 86   QRKGIRSLDVEDVYVGNGVSELIVMAMQALLNNGDEMLIPAPDYPLWTASVALSGGNPVH 145

Query: 874  YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            Y    +  W  DL+ ++      T  +V+INP NP G VY+     E+
Sbjct: 146  YLCDEQSDWYPDLDDIKKKITPKTRGIVLINPNNPTGAVYSRDFLLEV 193



>gb:BX569692_776073 Synechococcus sp. WH8102 complete genome; segment
            4/7.
          Length = 392

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 47/165 (28%), Positives = 76/165 (46%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
            + + SL  G+P     F +P    +A    L       Y P  G P+ R A+A+ LS   
Sbjct: 34   RDICSLSAGEPD----FDTPDFIVEATRQALRD-GITRYGPAAGDPELRAAVAEKLSSGN 88

Query: 706  PEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLL 885
               ++ + V +T G  QAI     +L  P   +LLP P +  Y   AA    +V+     
Sbjct: 89   GIAITPEQVLITNGGKQAIYNLFQVLLNPDDEVLLPAPYWLSYPEMAALAGAKVKLIPTQ 148

Query: 886  PEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
             E+ + +DL AVE+     +  +++ +PGNP G V   Q  +++A
Sbjct: 149  AEEGFRLDLAAVEAAISPRSRLLLLNSPGNPTGRVMKRQELEDVA 193



>gb:AE016951_365367 Enterococcus faecalis V583, section 5 of 11 of the
            complete genome.>gb:AE016830_991855 Enterococcus faecalis
            V583, complete genome.
          Length = 405

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 45/168 (26%), Positives = 81/168 (48%), Gaps = 1/168 (0%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFN-GYSPTVGLPQTRKAIADYL 693
            ++  +++ L  G+P  +  F +P    + V D + + + + GYS + G+   RKAI  Y 
Sbjct: 30   EEGIRILKLNTGNPAPFG-FDAP---NEIVRDMIVNVRDSEGYSDSKGIFSARKAIEQYC 85

Query: 694  SRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRY 873
                   V+ +D+Y   G ++ I   +  L   G  +L+P P +P++    +       +
Sbjct: 86   QLKKFPNVTINDIYTGNGVSELITMCMQGLLNNGDEVLVPMPDYPLWTASVSLAGGTPVH 145

Query: 874  YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            Y    +  W  D++ ++S    NT A+VIINP NP G +Y  +   EI
Sbjct: 146  YICDEQAEWYPDIDDIKSKITSNTKAIVIINPNNPTGALYPKELLLEI 193



>gb:AE016807_337743 Vibrio vulnificus CMCP6 chromosome I section 11 of
            11 of the complete sequence.>gb:BA000037_721940 Vibrio
            vulnificus YJ016 DNA, chromosome I, complete
            sequence.>gb:AE016795_1047467 Vibrio vulnificus CMCP6
            chromosome I complete sequence.
          Length = 404

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 43/168 (25%), Positives = 79/168 (47%), Gaps = 1/168 (0%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFN-GYSPTVGLPQTRKAIADYL 693
            ++  K++ L +G+P  +  F +P    + + D + +   + GY  + G+   RKA+  + 
Sbjct: 30   EEGHKILKLNIGNPAPFG-FDAP---DEILVDVIRNLPTSQGYCDSKGIYSARKAVVQHY 85

Query: 694  SRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRY 873
             R     +  +DVYV  G ++ I  A+  L   G  +L+P P +P++    A    +  +
Sbjct: 86   QRKGIRSLDVEDVYVGNGVSELIVMAMQALLNNGDEMLVPAPDYPLWTAAVALSGGKAVH 145

Query: 874  YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            Y    +  W  DL+ +       T  +V+INP NP G VY+     E+
Sbjct: 146  YLCDEQADWYPDLDDMRKKITPKTRGIVLINPNNPTGAVYSRDFLLEV 193



>pir|C87222|C87222 probable aspartate aminotransferase [imported] -
            Mycobacterium leprae>gb:MLEPRTN9_148308 Mycobacterium
            leprae strain TN complete genome; segment 9/10.
          Length = 437

 Score = 71.2 bits (173), Expect = 3e-11
 Identities = 46/167 (27%), Positives = 80/167 (47%), Gaps = 1/167 (0%)
 Frame = +1

Query: 520  DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVG-LPQTRKAIADYLS 696
            +  +++ L +G+P  +  F +P +  + +   L   +  GYS + G LP  R  +  Y  
Sbjct: 63   EGHRILKLNIGNPALFG-FDAPDVIMRDMIQALPYAQ--GYSDSQGILPARRAVVTRYEL 119

Query: 697  RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
             D   +   DDVY+  G ++ I   L  L   G  +L+P P +P++    +       +Y
Sbjct: 120  VDGFPRFDVDDVYLGNGVSELITMTLQALLDNGDQVLIPSPDYPLWTASTSLAGGTPVHY 179

Query: 877  DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
                 + W+ D+  VES   + T A+V+INP NP G VY+ +   +I
Sbjct: 180  LCDETQGWQPDIADVESKITERTKALVVINPNNPTGAVYSNEILNQI 226



>gb:AY723777_1624183 Saccharomyces cerevisiae clone FLH001648.01X
           YDR111C gene, complete cds.
          Length = 507

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 45/164 (27%), Positives = 84/164 (51%), Gaps = 10/164 (6%)
 Frame = +1

Query: 529 KVISLGMGDPTAYSCFHSPAL--AQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSR- 699
           +++ +G  +  + + F   AL  A++ ++D   S     YS + G+P  R+ +AD+++R 
Sbjct: 99  EILRVGHNELASLNLFSRDALERAERLLNDIGGS--IGAYSHSQGVPGIRQTVADFITRR 156

Query: 700 DLPEKVSADDVYVTAGCTQAIETALSILAYPG-ANILLPRPGFPIYALCAAFRHLEVRYY 876
           D  E  + +D+Y+T G + A  + LS+L       +L+P P +P+Y   A+  + +V  Y
Sbjct: 157 DGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIPIPQYPLYTASASLFNAQVLPY 216

Query: 877 DLLPEKAWEVDLNAVESLADQ------NTIAVVIINPGNPCGNV 990
            L  E  W  + + +E +             +++INPGNP G V
Sbjct: 217 YLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAV 260



>pir|T37220|T37220 probable transaminase (EC 2.6.1.-) SC2H4.04c
           [similarity] - Streptomyces
           coelicolor>gb:SCO939126_179891 Streptomyces coelicolor
           A3(2) complete genome; segment 23/29.
          Length = 402

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 47/155 (30%), Positives = 76/155 (49%), Gaps = 1/155 (0%)
 Frame = +1

Query: 532 VISLGMGDPTAYSCFHSPALAQQAVSDTLSSY-KFNGYSPTVGLPQTRKAIADYLSRDLP 708
           V+ L  G+P  +  F +P   ++ V D +    + +GY+ + G+   R+A+A      L 
Sbjct: 34  VLRLNTGNPALFG-FEAP---EEIVQDMIRMLPRAHGYTDSRGILSARRAVAQRYQA-LG 88

Query: 709 EKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLP 888
            +V  DDV++  G ++ I  A+  L   G  +L+P P FP++         +  +Y    
Sbjct: 89  LEVDVDDVFLGNGVSELISMAVQALLEDGDEVLIPAPDFPLWTAVTTLAGGKAVHYLCDE 148

Query: 889 EKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVY 993
           +  W  DL  +E+     T AVVIINP NP G VY
Sbjct: 149 QAEWYPDLADMEAKITDRTKAVVIINPNNPTGAVY 183



>sp|P52892|ALAT_YEAST Putative alanine aminotransferase (EC 2.6.1.2)
           (Glutamic--pyruvic transaminase) (GPT)
           (Glutamic--alanine transaminase).>pir|S52677|S52677
           probable membrane protein YDR111c - yeast (Saccharomyces
           cerevisiae)>gb:SC9727_1706174 S.cerevisiae chromosome IV
           cosmid 9727.
          Length = 507

 Score = 70.9 bits (172), Expect = 4e-11
 Identities = 45/164 (27%), Positives = 84/164 (51%), Gaps = 10/164 (6%)
 Frame = +1

Query: 529 KVISLGMGDPTAYSCFHSPAL--AQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSR- 699
           +++ +G  +  + + F   AL  A++ ++D   S     YS + G+P  R+ +AD+++R 
Sbjct: 99  EILRVGHNELASLNLFSRDALERAERLLNDIGGS--IGAYSHSQGVPGIRQTVADFITRR 156

Query: 700 DLPEKVSADDVYVTAGCTQAIETALSILAYPG-ANILLPRPGFPIYALCAAFRHLEVRYY 876
           D  E  + +D+Y+T G + A  + LS+L       +L+P P +P+Y   A+  + +V  Y
Sbjct: 157 DGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIPIPQYPLYTASASLFNAQVLPY 216

Query: 877 DLLPEKAWEVDLNAVESLADQ------NTIAVVIINPGNPCGNV 990
            L  E  W  + + +E +             +++INPGNP G V
Sbjct: 217 YLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAV 260



>gb:AE010175_260089 Pyrococcus furiosus DSM 3638, section 50 of 173 of
            the complete genome.>gb:AE009950_900870 Pyrococcus
            furiosus DSM 3638, complete genome.
          Length = 390

 Score = 70.5 bits (171), Expect = 5e-11
 Identities = 48/165 (29%), Positives = 77/165 (46%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
            + VISLG+G+P     F +P   ++A    L    +  Y+P  G+P+ R+AIA+Y  +  
Sbjct: 32   ENVISLGIGEPD----FDTPNNIKEAAKRALDE-GWTHYTPNAGIPELREAIAEYYKKFY 86

Query: 706  PEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLL 885
               V  D+V VTAG  +A   A   +   G  +++P P F  Y   A     +     L 
Sbjct: 87   GIDVEVDNVLVTAGAYEATYLAFETMLEQGDEVIIPDPAFVCYVEDAKLAEAKPIRLPLR 146

Query: 886  PEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
             E  ++ D++ +     + T  +VI  P NP G V   +  + IA
Sbjct: 147  EENDFKPDIDELLERITKRTRMIVINYPNNPTGAVLDKETAKAIA 191



>pir|E71009|E71009 probable aromatic-amino-acid transaminase (EC
            2.6.1.57) PH1371 [similarity] - Pyrococcus
            horikoshii>gb:BA000001_650039 Pyrococcus horikoshii OT3
            DNA, complete genome.
          Length = 389

 Score = 70.5 bits (171), Expect = 5e-11
 Identities = 53/171 (30%), Positives = 86/171 (50%), Gaps = 6/171 (3%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
            K VISLG+G+P   +  H    A++A+   L+ Y      P +GL + R+AIA+ L +  
Sbjct: 26   KDVISLGIGEPDFDTPQHIKEYAKEALDKGLTHY-----GPNIGLLELREAIAEKLKKQ- 79

Query: 706  PEKVSAD---DVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYA---LCAAFRHLEV 867
               + AD   ++ V  G  QA    LS     G  +L+P P F  YA   + A  + +EV
Sbjct: 80   -NGIEADPKTEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEV 138

Query: 868  RYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
              Y+   E  + ++++ ++      T A++I +P NP G V T +  +EIA
Sbjct: 139  PTYE---EDEFRLNVDELKKYVTDKTRALIINSPCNPTGAVLTKKDLEEIA 186



>gb:BA000035_717442 Corynebacterium efficiens YS-314 DNA, complete
            genome.
          Length = 437

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 44/169 (26%), Positives = 79/169 (46%), Gaps = 2/169 (1%)
 Frame = +1

Query: 520  DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS- 696
            D   ++ L  G+P  +  F +P +  + +   L + +  GYS + G+   R+A+      
Sbjct: 63   DGHNILKLNTGNPAVFG-FDAPDVIMRDMIAALPTSQ--GYSTSKGIIPARRAVVTRYEV 119

Query: 697  -RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRY 873
              D P     DDV++  G ++ I   +  L   G  +L+P P +P++    +    +  +
Sbjct: 120  IPDFPN-FDVDDVFLGNGVSELITMTMQALLNDGDEVLIPAPDYPLWTAATSLSGGKPVH 178

Query: 874  YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            Y    +  W   +  + S   + T A+V+INP NP G VY+ +  QEIA
Sbjct: 179  YLCDEDNEWNPSIEDIRSKITEKTKAIVVINPNNPTGAVYSRKVLQEIA 227



>gb:AE017241_414535 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 15 of 16 of the complete
           genome.>gb:AE016958_1057939 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 430

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 44/160 (27%), Positives = 77/160 (48%), Gaps = 1/160 (0%)
 Frame = +1

Query: 520 DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVG-LPQTRKAIADYLS 696
           +  +++ L +G+P  +  F +P +  + +   L   +  GYS + G LP  R  +  Y  
Sbjct: 56  EGHRILKLNIGNPAPFG-FEAPDVIMRDMIQALPYAQ--GYSDSQGILPARRAVVTRYEL 112

Query: 697 RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
            D   +   DDVY+  G ++ I   L  L   G  +L+P P +P++    +       +Y
Sbjct: 113 VDGFPRFDVDDVYLGNGVSELITMTLQALLDNGDEVLIPSPDYPLWTASTSLAGGTPVHY 172

Query: 877 DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYT 996
                + W+ D+  +ES   + T A+V+INP NP G VY+
Sbjct: 173 LCDETQGWQPDIADLESKITERTKALVVINPNNPTGAVYS 212



>gb:AE013003_288022 Thermoanaerobacter tengcongensis MB4, section 30
            of 244 of the complete genome.>gb:AE008691_1110087
            Thermoanaerobacter tengcongensis strain MB4, complete
            genome.
          Length = 388

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 49/167 (29%), Positives = 79/167 (47%), Gaps = 5/167 (2%)
 Frame = +1

Query: 535  ISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL--- 705
            ISL +G+P   +  H    A++A+ + ++     GY+   GL + R+ IADYL R     
Sbjct: 33   ISLAIGEPDFITPEHIRNAAKKALDEGMT-----GYTVNAGLIELRREIADYLKRRYSLY 87

Query: 706  --PEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYD 879
              PEK    ++ VT G T+AI   LS LA  G  +L+P P F  Y  C      +  +  
Sbjct: 88   YDPEK----EILVTIGATEAIYVTLSTLAEEGDEVLIPEPSFVAYHPCTVIAGAKSVFVP 143

Query: 880  LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
               E  + +  + +E    + +  +++  P NP G V   +  +EIA
Sbjct: 144  TYEEDDFILRADVLEKYITERSKVLILPYPNNPTGAVMPKEALEEIA 190



>pir|H86644|H86644 aspartate aminotransferase [imported] -
           Lactococcus lactis subsp. lactis (strain
           IL1403)>gb:AE006253_217062 Lactococcus lactis subsp.
           lactis IL1403 section 15 of 218 of the complete
           genome.>gb:AE005176_1094135 Lactococcus lactis subsp.
           lactis IL1403, complete genome.
          Length = 404

 Score = 70.1 bits (170), Expect = 7e-11
 Identities = 42/160 (26%), Positives = 77/160 (48%), Gaps = 1/160 (0%)
 Frame = +1

Query: 520 DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLS-SYKFNGYSPTVGLPQTRKAIADYLS 696
           + +K++ L  G+P  +  F +P    + +SD +  +    GYS + G+   RKAI  Y  
Sbjct: 31  NGEKILRLNTGNPAEFG-FLAP---DEVISDLIQHAVDSEGYSDSKGIFSARKAIMQYCQ 86

Query: 697 RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
                 +  +D++   G ++ I  A+  L   G  +L+P P +P++    +       +Y
Sbjct: 87  LKGFPNLDINDIFTGNGVSELIVMAMQGLLDTGDEVLIPMPDYPLWTASVSLAGGTAVHY 146

Query: 877 DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYT 996
               +  W  D++ + S    NT A+V+INP NP G +Y+
Sbjct: 147 LCDEQAGWFPDIDDIRSKITSNTKAIVLINPNNPTGALYS 186



>gb:CR382134_1667315 Debaryomyces hansenii chromosome B of strain
            CBS767 of Debaryomyces hansenii.
          Length = 489

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 39/133 (29%), Positives = 68/133 (51%), Gaps = 7/133 (5%)
 Frame = +1

Query: 640  YSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPG-ANILLPR 816
            YS + G P  RK++AD+++R      ++ D+++T+G + A+   L +L+    +  L+P 
Sbjct: 116  YSHSQGTPHVRKSVADFITRRDGFPSNSSDIFLTSGASAAVSYLLQVLSSSDRSGFLIPI 175

Query: 817  PGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNT------IAVVIINPGNP 978
            P +P+Y    A        Y L  E  W  +   +  L  +N        A+V+INPGNP
Sbjct: 176  PQYPLYTATIALNDAVPIGYYLNEENNWSTNPTQIRELIKENNEKGIQIKALVVINPGNP 235

Query: 979  CGNVYTYQHRQEI 1017
             G++ +Y +  EI
Sbjct: 236  TGSILSYDNIVEI 248



>gb:CR382131_1664643 Yarrowia lipolytica chromosome E of strain CLIB99
            of Yarrowia lipolytica.
          Length = 443

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 54/198 (27%), Positives = 81/198 (40%), Gaps = 13/198 (6%)
 Frame = +1

Query: 463  TIKGILGLLMANIEGSEGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGY 642
            T K +  L+      SE    KKV++LG G    +  +  P  A  A    L     N Y
Sbjct: 33   TPKDVWSLINEAAAASEEASGKKVVNLGQG----FFSYSPPQFAIDAAKKALDVPALNQY 88

Query: 643  SPTVGLPQTRKAIAD----YLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILL 810
            SPT G P   KA++D    Y  R L     A ++ +TAG  + +  A +    PG  +++
Sbjct: 89   SPTRGRPSLLKAVSDAYSPYFGRTLD---PASEIVITAGANEGMYAAFTAFLNPGDEVIV 145

Query: 811  PRPGFPIYALCAAFRHLEVRYYDLLPEK---------AWEVDLNAVESLADQNTIAVVII 963
              P F  Y         +V Y  L P K          W +D+   E+     T  +V+ 
Sbjct: 146  FEPFFDQYISNIELPGGKVVYVPLHPPKDSQHTSSAANWSLDIAEFEAAITPKTKMIVVN 205

Query: 964  NPGNPCGNVYTYQHRQEI 1017
             P NP G V++ +   +I
Sbjct: 206  TPQNPTGKVFSKEELTQI 223



>gb:CP000020_871849 Vibrio fischeri ES114 chromosome I, complete
           sequence.
          Length = 404

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 41/161 (25%), Positives = 78/161 (48%), Gaps = 1/161 (0%)
 Frame = +1

Query: 517 DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFN-GYSPTVGLPQTRKAIADYL 693
           ++  K++ L +G+P  +  F +P    + + D + +   + GY  + G+   RKA+  + 
Sbjct: 30  EEGHKILKLNIGNPAPFG-FDAP---DEILVDVIKNLPTSQGYCDSKGIYSARKAVVQHY 85

Query: 694 SRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRY 873
            R     +  +DVY+  G ++ I  A+  L   G  +L+P P +P++    +    +  +
Sbjct: 86  QRRGLLDLDVEDVYIGNGASELIVMAMQALLNNGDEMLVPAPDYPLWTAAVSLSGGKPVH 145

Query: 874 YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYT 996
           Y       W  DL+ ++     NT  +V+INP NP G VY+
Sbjct: 146 YMCDEGADWYPDLDDIKKKITPNTKGIVLINPNNPTGAVYS 186



>gb:BSUB0017_755105 Bacillus subtilis complete genome (section 17 of
            21): from 3213330 to 3414388.
          Length = 386

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 48/165 (29%), Positives = 83/165 (50%), Gaps = 2/165 (1%)
 Frame = +1

Query: 532  VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
            VISLG+G+P   + ++    +  ++    +SY  N      GL   R+ I+ YLS     
Sbjct: 30   VISLGVGEPDFVTAWNVREASILSLEQGYTSYTANA-----GLYSLREEISRYLSNRFDL 84

Query: 712  KVSAD-DVYVTAGCTQAIETALSILAYPGANILLPRPGFPIY-ALCAAFRHLEVRYYDLL 885
              S D ++ VT G +QA++ A+  +  PG  +++P P F  Y AL +    + V  +   
Sbjct: 85   SYSPDNELIVTVGASQALDIAIRAIVNPGEEVIIPEPCFVAYDALVSLAGGIPVHVH-TT 143

Query: 886  PEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
             +K ++      E+   + T A++I +P NP G+VY+ +   EIA
Sbjct: 144  ADKGFKATAADFEAAVTEKTKAILICSPSNPTGSVYSKEELNEIA 188



>gb:BA000016_673751 Clostridium perfringens str. 13 DNA, complete
            genome.
          Length = 392

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 48/168 (28%), Positives = 82/168 (48%), Gaps = 1/168 (0%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS 696
            ++ + VISLG+G+P     F +P   ++A   +L     + YS   G  + R+ I+ YL+
Sbjct: 27   NEMEDVISLGVGEPD----FVTPWNVREAGIYSLEQGHTH-YSSNAGFIELREEISKYLN 81

Query: 697  RDLPEKVSA-DDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRY 873
            R    + +  D++ VT G ++ I+ AL  L  PG  +++P P F  Y  C AF     + 
Sbjct: 82   RRFSLRYNPKDEILVTVGGSEGIDLALRALVGPGDEVIIPEPSFVAYKGCTAFTGATAKT 141

Query: 874  YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
             DL     +++    +E    + T  V+I  P NP G +   +  Q+I
Sbjct: 142  IDLRACDDFKLTPELLEEAITEKTKVVIIPFPNNPTGAIMNKEELQKI 189



>gb:CR378671_95982 Photobacterium profundum SS9; segment 9/12.
          Length = 404

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 44/168 (26%), Positives = 79/168 (47%), Gaps = 1/168 (0%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFN-GYSPTVGLPQTRKAIADYL 693
            ++  K++ L +G+P  +  F +P    + + D + +   + GY  + G+   RKAI  + 
Sbjct: 30   EEGHKILKLNIGNPAPFG-FDAP---DEILVDVIRNLPTSQGYCDSKGIYPARKAIVQHY 85

Query: 694  SRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRY 873
             +     +  +DVY+  G ++ I  A+  L      IL+P P +P++    +       +
Sbjct: 86   QKRGLLDLDVEDVYIGNGVSELIVMAMQALLDNNDEILVPSPDYPLWTAAVSLSGGNPVH 145

Query: 874  YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            Y    E  W  DL+ ++     NT  +V+INP NP G VY+     EI
Sbjct: 146  YICDEESDWYPDLDDIKKKITPNTRGIVLINPNNPTGAVYSRDFLLEI 193



>pir|G70010|G70010 probable aspartate transaminase (EC 2.6.1.1) yugH
            [similarity] - Bacillus subtilis>gb:BSZ93934_756648
            B.subtilis genomic DNA fragment from patB to yugK.
          Length = 357

 Score = 69.7 bits (169), Expect = 9e-11
 Identities = 48/165 (29%), Positives = 83/165 (50%), Gaps = 2/165 (1%)
 Frame = +1

Query: 532  VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
            VISLG+G+P   + ++    +  ++    +SY  N      GL   R+ I+ YLS     
Sbjct: 30   VISLGVGEPDFVTAWNVREASILSLEQGYTSYTANA-----GLYSLREEISRYLSNRFDL 84

Query: 712  KVSAD-DVYVTAGCTQAIETALSILAYPGANILLPRPGFPIY-ALCAAFRHLEVRYYDLL 885
              S D ++ VT G +QA++ A+  +  PG  +++P P F  Y AL +    + V  +   
Sbjct: 85   SYSPDNELIVTVGASQALDIAIRAIVNPGEEVIIPEPCFVAYDALVSLAGGIPVHVH-TT 143

Query: 886  PEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
             +K ++      E+   + T A++I +P NP G+VY+ +   EIA
Sbjct: 144  ADKGFKATAADFEAAVTEKTKAILICSPSNPTGSVYSKEELNEIA 188



>sp|Q60013|AAT_STRVG Aspartate aminotransferase (EC 2.6.1.1)
           (Transaminase A) (ASPAT).>pir|T11786|T11786 aspartate
           transaminase (EC 2.6.1.1) - Streptomyces
           virginiae>gb:STMVBRA1_193129 Streptomyces virginiae VbrA
           gene for NusG like protein, SecE like protein and
           ribosomal protein, aspartate aminotransferase and
           adenosine deaminase, complete cds.
          Length = 397

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 46/159 (28%), Positives = 79/159 (49%), Gaps = 2/159 (1%)
 Frame = +1

Query: 526 KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
           + VI  G G+P     F +P    +A  +   + K++ Y+P  GLP+ + AIA    RD 
Sbjct: 28  RPVIGFGAGEPD----FPTPDYIVEAAVEACRNPKYHRYTPAGGLPELKAAIAAKTLRDS 83

Query: 706 PEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLL 885
             +V A  V VT G  QAI  A + +  PG  +++P P +  Y    + R       D++
Sbjct: 84  GYEVEASQVLVTNGGKQAIYEAFAAILDPGDEVIVPAPYWTTYP--ESIRLAGGVPVDVV 141

Query: 886 PEK--AWEVDLNAVESLADQNTIAVVIINPGNPCGNVYT 996
            ++   + V +  +E+   + T  V+ ++P NP G+VY+
Sbjct: 142 ADETTGYRVSVEQLEAARTERTKVVLFVSPSNPTGSVYS 180



>gb:AP005393_1851004 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 9, PAC clone:P0488D02.
          Length = 466

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 48/163 (29%), Positives = 81/163 (49%), Gaps = 1/163 (0%)
 Frame = +1

Query: 535  ISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEK 714
            I+LG G P     F  P   ++A    +++ K N Y+   G+P+   AIA+   +D   +
Sbjct: 109  INLGQGFPN----FDGPDFVKEAAIQAINAGK-NQYARGYGVPELNSAIAERFLKDSGLQ 163

Query: 715  VSAD-DVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPE 891
            V  + +V VT+GCT+AI   +  L  PG  ++L  P +  Y    +     V+   L P 
Sbjct: 164  VDPEKEVTVTSGCTEAIAATILGLINPGDEVILFAPFYDSYEATLSMAGANVKAITLRPP 223

Query: 892  KAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
              + V L  +++   +NT A++I  P NP G ++T +  + IA
Sbjct: 224  D-FSVPLEELKAAVSKNTRAIMINTPHNPTGKMFTREELEFIA 265



>gb:BX248360_763393 Corynebacterium diphtheriae gravis NCTC13129,
            complete genome; segment 7/8.
          Length = 423

 Score = 68.6 bits (166), Expect = 2e-10
 Identities = 52/204 (25%), Positives = 95/204 (46%), Gaps = 4/204 (1%)
 Frame = +1

Query: 418  EKKQTRGEIETPTNI--TIKGILGLLMANIEGSEGDDSKKVISLGMGDPTAYSCFHSPAL 591
            ++K+TR   +    +   +  I G + A  E  E D   +++ L  G+P  +  F +P +
Sbjct: 14   QRKRTRRIFDQSDKLKNVLYEIRGPVTAEAEAMELD-GHRILKLNTGNPAIFG-FEAPDV 71

Query: 592  AQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLP--EKVSADDVYVTAGCTQAIE 765
              + +  +L + +  GYS + G+   R+AI       +P       DDVY+  G ++ I 
Sbjct: 72   IMRDMIASLPTSQ--GYSTSKGIIPARRAIVTRYEV-IPGFPAFDVDDVYIGNGVSELIT 128

Query: 766  TALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNT 945
                 L   G  +L+P P +P++    +    +  +Y    E  W   +  ++S   + T
Sbjct: 129  MTTQALLNNGDEVLIPMPDYPLWTAATSLAGGKPVHYLCDEEDDWNPSIEDIKSKITERT 188

Query: 946  IAVVIINPGNPCGNVYTYQHRQEI 1017
             A+V+INP NP G VY+ +  Q+I
Sbjct: 189  KAIVVINPNNPTGAVYSKEVLQKI 212



>gb:BA000030_699895 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 402

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 47/155 (30%), Positives = 75/155 (48%), Gaps = 1/155 (0%)
 Frame = +1

Query: 532 VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIAD-YLSRDLP 708
           V+ L  G+P  +  F +P    Q +   L   + +GY+ + G+   R+A+A  Y  R L 
Sbjct: 34  VLRLNTGNPALFG-FEAPEEILQDMIRMLP--RAHGYTDSRGVLSARRAVAQRYQDRGL- 89

Query: 709 EKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLP 888
            +V  DDV++  G ++ +  A+  L   G  +L+P P FP++         +  +Y    
Sbjct: 90  -EVDVDDVFLGNGVSELVSMAVQALIEDGDEVLIPAPDFPLWTAVTTLAGGKAVHYLCDE 148

Query: 889 EKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVY 993
           +  W  DL  + +     T AVVIINP NP G VY
Sbjct: 149 QADWYPDLADMAAKITDRTRAVVIINPNNPTGAVY 183



>gb:AP006618_561828 Nocardia farcinica IFM 10152 DNA, complete genome.
          Length = 417

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 44/168 (26%), Positives = 80/168 (47%), Gaps = 2/168 (1%)
 Frame = +1

Query: 520  DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADY--L 693
            +  +++ L +G+P  +  F +P +  + +   L   +  GYS + G+   R+AI     L
Sbjct: 43   EGHRILKLNIGNPAPFG-FEAPDVIMRDIIAALPYAQ--GYSESKGILSARRAIVTRYEL 99

Query: 694  SRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRY 873
                PE    DDVY+  G ++ I   +  L   G  +L+P P +P++    +       +
Sbjct: 100  VPGFPE-FDVDDVYLGNGVSELITLTMQALLDNGDEVLIPAPDYPLWTAMTSLAGGTPVH 158

Query: 874  YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            Y       W+ D+  +E+     T A+++INP NP G VY+ +  Q+I
Sbjct: 159  YLCDESNGWQPDIADIEAKITDKTKALLVINPNNPTGAVYSAEVLQQI 206



>sp|O33267|AAT_MYCTU Probable aspartate aminotransferase (EC
           2.6.1.1) (Transaminase A) (ASPAT).>pir|H70506|H70506
           probable transaminase (EC 2.6.1.-) aspC [similarity] -
           Mycobacterium tuberculosis (strain
           H37RV)>gb:AE000516_20343 Mycobacterium tuberculosis
           CDC1551, complete genome.>gb:BX248335_757703
           Mycobacterium bovis subsp. bovis AF2122/97 complete
           genome; segment 2/14.>gb:BX842573_818379 Mycobacterium
           tuberculosis H37Rv complete genome; segment 2/13.
          Length = 429

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 43/161 (26%), Positives = 78/161 (48%), Gaps = 2/161 (1%)
 Frame = +1

Query: 520 DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADY--L 693
           +  +++ L +G+P  +  F +P +  + +   L   +  GYS + G+   R+A+     L
Sbjct: 55  EGHRILKLNIGNPAPFG-FEAPDVIMRDIIQALPYAQ--GYSDSQGILSARRAVVTRYEL 111

Query: 694 SRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRY 873
               P +   DDVY+  G ++ I   L  L   G  +L+P P +P++    +       +
Sbjct: 112 VPGFP-RFDVDDVYLGNGVSELITMTLQALLDNGDQVLIPSPDYPLWTASTSLAGGTPVH 170

Query: 874 YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYT 996
           Y     + W+ D+  +ES   + T A+V+INP NP G VY+
Sbjct: 171 YLCDETQGWQPDIADLESKITERTKALVVINPNNPTGAVYS 211



>gb:BA000030_701171 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 403

 Score = 67.8 bits (164), Expect = 3e-10
 Identities = 42/155 (27%), Positives = 73/155 (47%)
 Frame = +1

Query: 529 KVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLP 708
           +++ L  G+P A+     P + +  + +  S++   GY    GL   R+A+  + ++ L 
Sbjct: 33  RILKLNTGNPAAFGFECPPEILEDILRNVSSAH---GYGDAKGLLAARRAVVMH-NQTLG 88

Query: 709 EKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLP 888
            +   + V+V  G ++ I  A+  L   G  +L+P P +P++    +       +Y    
Sbjct: 89  IETDVEHVFVGNGVSELIVMAMQGLLDDGDEVLVPAPDYPLWTASVSLSGGTAVHYHCDE 148

Query: 889 EKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVY 993
           +  W  DL  VE      T A+VIINP NP G VY
Sbjct: 149 QSDWMPDLADVERKVTDRTKAIVIINPNNPTGAVY 183



>gb:AP006878_575700 Thermococcus kodakaraensis strain KOD1 DNA,
            complete genome.
          Length = 389

 Score = 67.8 bits (164), Expect = 3e-10
 Identities = 51/169 (30%), Positives = 80/169 (47%), Gaps = 6/169 (3%)
 Frame = +1

Query: 532  VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
            VISLG+G+P   +  H    A++A+        +  Y P  GLP  R+A+A  L      
Sbjct: 28   VISLGIGEPDFDTPEHIKGYAKEALDKG-----YTHYGPNAGLPMLREAVAKKLKEQ--N 80

Query: 712  KVSAD---DVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYA---LCAAFRHLEVRY 873
             + AD   +V +  G  QA    L+     G  +L+P P F  YA   + A  + +EV  
Sbjct: 81   GIEADPKTEVMILTGANQAFLMGLATFLKDGEEVLIPSPMFVSYAPAVILAGGKPVEVPT 140

Query: 874  YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            Y+   E  + + ++ +E      T A++I  P NP G+V T +  +EIA
Sbjct: 141  YE---ENEFRLSVDDLEKHVTDKTRALIINTPSNPTGSVLTKKDIEEIA 186



>gb:CR382133_1666476 Debaryomyces hansenii chromosome A of strain
            CBS767 of Debaryomyces hansenii.
          Length = 453

 Score = 67.4 bits (163), Expect = 4e-10
 Identities = 47/193 (24%), Positives = 84/193 (43%), Gaps = 10/193 (5%)
 Frame = +1

Query: 469  KGILGLLMANIEGSEGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSP 648
            K I  L+      ++ +  K +++LG G    +  ++ P  A +AV+   S  +FN Y+ 
Sbjct: 40   KDIWTLINETAAEAQKESGKSIVNLGQG----FFSYNPPDFAIEAVNKATSQPQFNQYAS 95

Query: 649  TVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFP 828
              G P     ++   +++   KV  D++ +T G  + + +       PG  +++ +P F 
Sbjct: 96   ARGNPNLLNELSSLYTKEFNRKVGTDEIQITTGANEGMFSIFFGYLTPGDEVIVFQPFFD 155

Query: 829  IYALCAAFRHLEVRYYDL-LPEKA---------WEVDLNAVESLADQNTIAVVIINPGNP 978
             Y         +V+Y  L  PEK          WEVD   + +     T  +VI  P NP
Sbjct: 156  QYIPNIEMCGGKVKYVQLKFPEKFNGESVSGDDWEVDWEGLTNAITDKTKLIVINTPHNP 215

Query: 979  CGNVYTYQHRQEI 1017
             G V+T +   +I
Sbjct: 216  IGKVFTEEELYKI 228



>gb:BX640414_805489 Bordetella pertussis strain Tohama I, complete
            genome; segment 4/12.
          Length = 384

 Score = 67.4 bits (163), Expect = 4e-10
 Identities = 45/164 (27%), Positives = 75/164 (45%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
            + +ISLG+G+P     F +P    +A+ +  +    NGYS   GL   R+AIA +   + 
Sbjct: 31   RDIISLGIGEPD----FTAPPQVVEAL-ERATRAGLNGYSAPAGLSALREAIAAFYESEF 85

Query: 706  PEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLL 885
              +V    + VTAG + A+  A + L  PGA +L+P P +P  +        + R     
Sbjct: 86   GARVDPARIIVTAGASGALALACAALVNPGAQVLMPDPSYPANSNFVLAAGGQPRLIPST 145

Query: 886  PEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
              K +++    V    +  T  V+I +P NP G    +    E+
Sbjct: 146  AAKRFQLSAQDVRDHWNDATQGVLIASPSNPTGTSIAHDELAEL 189



>gb:AP006878_577420 Thermococcus kodakaraensis strain KOD1 DNA,
           complete genome.
          Length = 392

 Score = 67.4 bits (163), Expect = 4e-10
 Identities = 41/155 (26%), Positives = 73/155 (47%)
 Frame = +1

Query: 526 KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
           + VISLG+G+P     F +P + ++A    +    +  Y+P  G+P+ R+AIA+Y     
Sbjct: 33  ENVISLGIGEPD----FDTPEVIKEAAKRAIDE-GYTHYTPNAGIPEFREAIAEYYKEFY 87

Query: 706 PEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLL 885
              V  +++ VTAG  +A   A   +   G ++++P P F  Y   A      +    L 
Sbjct: 88  NVDVDMNNIIVTAGAYEATYLAFESILEQGDDVIIPDPAFVCYVEDAKIAEAGIIRIPLR 147

Query: 886 PEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNV 990
            E  + +D + +     + T  +V+  P NP G +
Sbjct: 148 EENKFRIDPDELLEAITKRTRMIVMNYPNNPTGAI 182



>gb:CR382126_1658416 Kluyveromyces lactis strain NRRL Y-1140
            chromosome F of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 444

 Score = 67.0 bits (162), Expect = 6e-10
 Identities = 43/180 (23%), Positives = 80/180 (44%), Gaps = 10/180 (5%)
 Frame = +1

Query: 508  SEGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIAD 687
            +E +  + +++LG G    +  +  P  A +     L+    N YSPT G P   K++ D
Sbjct: 48   NEKNQGRSILNLGQG----FFSYSPPKFAIEQAVSALNVPLNNQYSPTRGRPSLLKSLTD 103

Query: 688  YLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEV 867
            + S    E ++  +V +T G  + I  +L  L  PG  +++  P F  Y         +V
Sbjct: 104  FYSPIYNETLNESNVTITTGANEGILASLVGLLNPGDEVIVFEPFFDQYISNIEIPGGKV 163

Query: 868  RYYDLLPEKA----------WEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            RY  L+  K           W++D + +    ++ T  +++  P NP G V+T +   ++
Sbjct: 164  RYVPLVAPKELSERVTIGAEWKIDFDILNKTINERTKCIILNTPHNPIGKVFTREELTQL 223



>gb:BA000039_728141 Thermosynechococcus elongatus BP-1 DNA, complete
            genome.
          Length = 387

 Score = 66.6 bits (161), Expect = 7e-10
 Identities = 49/163 (30%), Positives = 72/163 (44%)
 Frame = +1

Query: 532  VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
            V S   G+P     F +PA  ++AV   L   K   Y P  G P  R+AIA  L+RD   
Sbjct: 32   VCSFSAGEPD----FDTPAHIREAVKTALDQGKTR-YGPAAGEPALRQAIATKLNRDNHL 86

Query: 712  KVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPE 891
               A+++ VT G  QA+   +  L  PG  +++P P +  Y                 PE
Sbjct: 87   PYRAENILVTNGGKQALFNLMLALINPGDEVIIPAPYWVSYPEMVHLASGTPVIVATTPE 146

Query: 892  KAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
              + +    +E      T  VV+ +P NP G VYT +  +E+A
Sbjct: 147  TGYRITPAQLEDAITPKTRLVVLNSPSNPTGMVYTPEEIRELA 189



>gb:BA000028_695778 Oceanobacillus iheyensis HTE831 DNA, complete
            genome.
          Length = 383

 Score = 66.6 bits (161), Expect = 7e-10
 Identities = 52/188 (27%), Positives = 90/188 (47%), Gaps = 1/188 (0%)
 Frame = +1

Query: 457  NITIKGILGLLMANIEGSEGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFN 636
            NI I GI      N+  +E D    ++SL +G P     F++P   +QA  + +++    
Sbjct: 11   NIEISGIRKFF--NLVSNEKD----IVSLTIGQPD----FYTPHAIKQASINAVNN-NHT 59

Query: 637  GYSPTVGLPQTRKAIADYL-SRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLP 813
             Y+   G+ + RKAIA+Y  SR         ++ VTAG ++AI+  L  +  PG  ++LP
Sbjct: 60   TYTANAGVIELRKAIANYYESRYQIPYHPESEIIVTAGASEAIDITLRTILEPGDEVILP 119

Query: 814  RPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVY 993
             P +P Y         +  + D   +  +++  + +E    + T  ++I +P NP G  Y
Sbjct: 120  APIYPGYEPLITLARAKPIHMD-TTKTNFKITKSQLEETITEKTKCIIIPSPSNPTGAAY 178

Query: 994  TYQHRQEI 1017
            T +   EI
Sbjct: 179  TKKELDEI 186



>gb:AY534910_626190 Uncultured marine group II euryarchaeote
            DeepAnt-JyKC7 clone cosmid DeepAnt-JyKC7, complete
            sequence.
          Length = 364

 Score = 66.6 bits (161), Expect = 7e-10
 Identities = 50/168 (29%), Positives = 74/168 (44%)
 Frame = +1

Query: 514  GDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYL 693
            GDD+   +  G+G+P     F  P +A +A S  +     N Y+ T GLP  R  IA+  
Sbjct: 6    GDDA---VQFGLGEPD----FQPPDIAIEAFSKAMKD-GHNKYTTTAGLPALRLKIAEGW 57

Query: 694  SRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRY 873
               +P  + A  V +T   T A+      L  P   +LLP P FP+Y         E   
Sbjct: 58   QHLVPS-LDASSVCMTMSGTNALLDIFLALVDPADEVLLPEPYFPLYPTDVVICGGEPIL 116

Query: 874  YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            Y  L E+ +   +  +ES     T+A++   P NP G   T + R E+
Sbjct: 117  YPCLFERGFVPTVEDLESRVTDKTVAILYNFPSNPTGGNVTTEERDEL 164



>pir|G69119|G69119 probable aspartate transaminase (EC 2.6.1.1)
           MTH1894 [similarity] - Methanobacterium
           thermoautotrophicum (strain Delta H)>gb:AE000941_29550
           Methanobacterium thermoautotrophicum from bases 1724442
           to 1736540 (section 147 of 148) of the complete
           genome.>gb:AE000666_926632 Methanobacterium
           thermoautotrophicum str. Delta H complete genome.
          Length = 374

 Score = 66.6 bits (161), Expect = 7e-10
 Identities = 44/152 (28%), Positives = 72/152 (47%)
 Frame = +1

Query: 535 ISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEK 714
           I+LG+G+P     F  P   ++AV D +       Y+  +G+ + R+AIAD L  +    
Sbjct: 30  INLGIGEPD----FSVPDHVREAVKDAVDE-GLTHYTSNMGMEELREAIADKLKSENRVH 84

Query: 715 VSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPEK 894
              + + VT G ++AI      L   G + L+P PGF  Y  C            L  ++
Sbjct: 85  AEPESIIVTVGASEAIFMCTQALLDIGDHALIPDPGFLSYDACVRLSGAVSIPVPLSMDE 144

Query: 895 AWEVDLNAVESLADQNTIAVVIINPGNPCGNV 990
            + +    VESL  Q+T  +++ +P NP G+V
Sbjct: 145 GFSMSPERVESLITQDTRVIIMNSPSNPTGSV 176



>gb:CR380956_1652204 Candida glabrata strain CBS138 chromosome J
            complete sequence.
          Length = 433

 Score = 66.2 bits (160), Expect = 1e-09
 Identities = 58/214 (27%), Positives = 90/214 (42%), Gaps = 14/214 (6%)
 Frame = +1

Query: 421  KKQTRGEIETPTNITIKGILGLLMANIEGSEGDDSKKVISLGMGDPTAYSCFHSPALAQQ 600
            +K T  ++ T TN      +G        SEG   +++I+LG G    +  +  P  A  
Sbjct: 18   QKNTSKDVWTLTNEFAASAVGK-------SEG---RELINLGQG----FFSYSPPQFAIN 63

Query: 601  AVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSI 780
            A    L     N YSPT G P   K++ +       + +   +V VT G  + I + L  
Sbjct: 64   AAKSALDVPLVNQYSPTRGRPSLIKSLVELYKPVFGDFIDNQNVLVTTGANEGILSCLMG 123

Query: 781  LAYPGANILLPRPGFPIYA----LCAAFRHLEVRYYDLLPEKA----------WEVDLNA 918
            +   G  +++  P F  Y     LC       VRY  + P K           W++D +A
Sbjct: 124  ILNAGDEVIVFEPFFDQYIPNIELCGGV----VRYVPIHPPKEMKTRNTTGDEWQIDWDA 179

Query: 919  VESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            +E   +  T AV+I  P NP G V+T Q   ++A
Sbjct: 180  LEKTFNNKTKAVIINTPHNPIGKVFTEQELTKLA 213



>gb:AE016954_366355 Enterococcus faecalis V583, section 8 of 11 of the
            complete genome.>gb:AE016830_992843 Enterococcus faecalis
            V583, complete genome.
          Length = 399

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 38/162 (23%), Positives = 80/162 (49%)
 Frame = +1

Query: 532  VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
            V+SL +G+P     F +P   Q+A   ++   + + Y+P+ G+P+ ++AI  Y+ R+   
Sbjct: 32   VLSLTVGEPD----FVTPKNIQKAAIASIEDGRASYYTPSGGIPELKQAIVSYVEREYQL 87

Query: 712  KVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPE 891
            +     V VT G   A+      +   G  +++P P +  Y         +  +     E
Sbjct: 88   RYQPKQVIVTDGAKYALYLLFQAILNVGDEVIIPVPYWVSYGEQVKLAEGKPVFVSSTQE 147

Query: 892  KAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            ++++V +  +E++    T A+++ +P NP G +YT +  ++I
Sbjct: 148  QSFKVSVAQLEAVRTDKTKAIILNSPSNPTGVIYTEEELRQI 189



>sp|P52893|ALAM_YEAST Putative alanine aminotransferase,
           mitochondrial precursor (EC 2.6.1.2) (Glutamic--pyruvic
           transaminase) (GPT) (Glutamic--alanine
           transaminase).>pir|S64923|S64923 probable membrane
           protein YLR089c - yeast (Saccharomyces
           cerevisiae)>gb:SCYLR089C_1713502 S.cerevisiae chromosome
           XII reading frame ORF YLR089c.>gb:YSCL9449_1729680
           Saccharomyces cerevisiae chromosome XII cosmid 9449.
          Length = 592

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 41/125 (32%), Positives = 67/125 (53%), Gaps = 8/125 (6%)
 Frame = +1

Query: 640 YSPTVGLPQTRKAIADYLS-RDLPEKVSADDVYVTAGCTQAIETALSILAY-PGANILLP 813
           YS + G+   RK++A++++ RD  E    +D+++TAG + A+   LSI    P   +L+P
Sbjct: 221 YSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIP 280

Query: 814 RPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESL---ADQNTI---AVVIINPGN 975
            P +P+Y    A  + +   Y L     W  +   +E++   A QN I    +V+INPGN
Sbjct: 281 IPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGN 340

Query: 976 PCGNV 990
           P G V
Sbjct: 341 PTGAV 345



>sp|P23034|AAT_BACY2 Aspartate aminotransferase (EC 2.6.1.1)
            (Transaminase A) (ASPAT).>pir|A38621|A38621 aspartate
            transaminase (EC 2.6.1.1) - Bacillus sp. (strain
            YM-2)>gb:BACASPC_744872 Bacillus aspartate
            aminotransferase (aspC) gene, complete cds.
          Length = 392

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 41/163 (25%), Positives = 76/163 (46%)
 Frame = +1

Query: 532  VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
            VI LG G+P     F++P     A  D++    +  Y+P+ GLP  ++AI +   RD   
Sbjct: 34   VIGLGAGEPD----FNTPQNIMDAAIDSMQQ-GYTKYTPSGGLPALKQAIIEKFKRDNQL 88

Query: 712  KVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPE 891
            +   +++ V  G    + T   ++   G  +++P P +  Y            Y +   E
Sbjct: 89   EYKPNEIIVGVGAKHVLYTLFQVILNEGDEVIIPIPYWVSYPEQVKLAGGVPVYIEATSE 148

Query: 892  KAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            + +++    +++     T AV+I +P NP G VYT +  ++IA
Sbjct: 149  QNYKITAEQLKNAITDKTKAVIINSPSNPTGMVYTREELEDIA 191



>sp|O67781|AAT_AQUAE Aspartate aminotransferase (EC 2.6.1.1)
            (Transaminase A) (ASPAT).>pir|A70469|A70469 aspartate
            transaminase (EC 2.6.1.1) aspC1 [similarity] - Aquifex
            aeolicus>gb:AE000766_27136 Aquifex aeolicus VF5 section
            98 of 109 of the complete genome.>gb:AE000657_977667
            Aquifex aeolicus VF5 complete genome.
          Length = 394

 Score = 65.9 bits (159), Expect = 1e-09
 Identities = 46/170 (27%), Positives = 81/170 (47%), Gaps = 7/170 (4%)
 Frame = +1

Query: 532  VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
            VI  G G+P     F +P   ++A    L   K   Y+P+ G+P+ R+AIA+ L ++   
Sbjct: 34   VIGFGAGEPD----FDTPDFIKEACIRALREGKTK-YAPSAGIPELREAIAEKLLKENKV 88

Query: 712  KVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLP- 888
            +    ++ V+AG    +      +   G  +LLP P +  Y         ++R++  +P 
Sbjct: 89   EYKPSEIVVSAGAKMVLFLIFMAILDEGDEVLLPSPYWVTYP-------EQIRFFGGVPV 141

Query: 889  ------EKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
                  EK +++ L  V+    + T A+VI +P NP G VY  +  ++IA
Sbjct: 142  EVPLKKEKGFQLSLEDVKEKVTERTKAIVINSPNNPTGAVYEEEELKKIA 191



>gb:BX640426_809411 Bordetella parapertussis strain 12822, complete
            genome; segment 4/14.>gb:BX640441_814026 Bordetella
            bronchiseptica strain RB50, complete genome; segment
            5/16.
          Length = 384

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 44/164 (26%), Positives = 75/164 (45%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
            + +ISLG+G+P     F +P    +A+ +  +    +GYS   GL   R+AIA +   + 
Sbjct: 31   RDIISLGIGEPD----FTAPPQVVEAL-ERAARAGLSGYSAPAGLSALREAIAAFYESEF 85

Query: 706  PEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLL 885
              +V    + VTAG + A+  A + L  PGA +L+P P +P  +        + R     
Sbjct: 86   GARVDPARIIVTAGASGALALACAALVNPGAQVLMPDPSYPANSNFVLAAGGQPRLIPST 145

Query: 886  PEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
              K +++    V    +  T  V+I +P NP G    +    E+
Sbjct: 146  AAKRFQLSAQDVRDHWNDATQGVLIASPSNPTGTSIAHDELAEL 189



>gb:AE017013_379731 Bacillus cereus ATCC 14579 section 16 of 18 of the
            complete genome.>gb:AE016877_1019981 Bacillus cereus ATCC
            14579 complete genome.
          Length = 396

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 46/166 (27%), Positives = 77/166 (46%), Gaps = 1/166 (0%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
            K VISLG+G+P     F +P   +QA   +L    +  Y+   GL + R+ IA YL +  
Sbjct: 29   KGVISLGVGEPD----FVTPWNVRQACIRSLEQ-GYTSYTANAGLLELRQEIAKYLKKQF 83

Query: 706  PEKVS-ADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDL 882
                  +D++ VT G +QA++ A+  +  P   +L+  P F  YA             + 
Sbjct: 84   AVSYDPSDEIIVTVGASQALDVAMRAIINPDDEVLIVEPSFVSYAPLVTLAGGVPVPVET 143

Query: 883  LPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
              E  ++V    +E+     T A+++ +P NP G +      +EIA
Sbjct: 144  KLENEFKVQPEQIEAAITAKTKAILLCSPNNPTGAMLNKSELEEIA 189



>gb:CR380958_1653601 Candida glabrata strain CBS138 chromosome L
            complete sequence.
          Length = 574

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 42/134 (31%), Positives = 71/134 (52%), Gaps = 8/134 (5%)
 Frame = +1

Query: 640  YSPTVGLPQTRKAIADYLS-RDLPEKVSADDVYVTAGCTQAIETALSILAY-PGANILLP 813
            YS + G+   RK +AD+++ RD       +D+++TAG + A++  LSI        +L+P
Sbjct: 203  YSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIP 262

Query: 814  RPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESL---ADQNTI---AVVIINPGN 975
             P +P+Y    A ++     Y L  E  W  D   +ES+   + +N I    +V+INPGN
Sbjct: 263  IPQYPLYTATLALQNSHALPYYLNEETGWSTDPEELESIILDSIENNIKPSVLVVINPGN 322

Query: 976  PCGNVYTYQHRQEI 1017
            P G V + +  ++I
Sbjct: 323  PTGAVLSEEAIEQI 336



>gb:BX251412_764919 Tropheryma whipplei TW08/27, complete genome;
            segment 3/3.
          Length = 404

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 48/167 (28%), Positives = 84/167 (50%), Gaps = 2/167 (1%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
            K +IS   G+P   +  H  +  Q A + T S++    Y+ T GL + R+AIA+    D 
Sbjct: 32   KPIISYAAGEPDFPTPEHIVSRCQLAAA-TRSNHV---YTETAGLAELREAIAEKTLADS 87

Query: 706  PEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIY--ALCAAFRHLEVRYYD 879
              KVS   + +T GC QA+  A   +  P   ++LP P +  Y  ++ AA   + +   D
Sbjct: 88   FLKVSESQILITNGCKQAVYMACQTILDPNDEVILPTPYWTTYPESIRAAGAKVVIPATD 147

Query: 880  LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
                 ++ V ++ ++S+    T A+++ +P NP G VY+    ++IA
Sbjct: 148  -----SFYVTVDQLQSVLTNKTKAIILSSPSNPSGAVYSLDSLRDIA 189



>gb:AE016852_349241 Tropheryma whipplei str. Twist, section 3 of 3 of
            the complete genome.>gb:AE014184_1029437 Tropheryma
            whipplei str. Twist, complete genome.
          Length = 404

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 48/167 (28%), Positives = 84/167 (50%), Gaps = 2/167 (1%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
            K +IS   G+P   +  H  +  Q A + T S++    Y+ T GL + R+AIA+    D 
Sbjct: 32   KPIISYAAGEPDFPTPEHIVSRCQLAAA-TRSNHV---YTETAGLAELREAIAEKTLADS 87

Query: 706  PEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIY--ALCAAFRHLEVRYYD 879
              KVS   + +T GC QA+  A   +  P   ++LP P +  Y  ++ AA   + +   D
Sbjct: 88   FLKVSESQILITNGCKQAVYMACQTILDPNDEVILPTPYWTTYPESIRAAGAKVVIPATD 147

Query: 880  LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
                 ++ V ++ ++S+    T A+++ +P NP G VY+    ++IA
Sbjct: 148  -----SFYVTVDQLQSVLTNKTKAIILSSPSNPSGAVYSLDSLRDIA 189



>gb:SCO939122_178656 Streptomyces coelicolor A3(2) complete genome;
           segment 19/29.
          Length = 403

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 40/155 (25%), Positives = 73/155 (47%)
 Frame = +1

Query: 529 KVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLP 708
           +++ L  G+P A+     P + +  + +  +++   GY    GL   R+A+  + ++ L 
Sbjct: 33  RILKLNTGNPAAFGFECPPEILEDILRNVSTAH---GYGDAKGLLAARRAVVMH-NQTLG 88

Query: 709 EKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLP 888
            +   + V++  G ++ I  A+  L   G  +L+P P +P++    +       +Y    
Sbjct: 89  IETDVEHVFIGNGVSELIVMAMQGLLDDGDEVLVPAPDYPLWTAAVSLSGGTAVHYRCDE 148

Query: 889 EKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVY 993
           +  W  DL  VE      T A+VIINP NP G VY
Sbjct: 149 QSDWMPDLADVERKITDRTKALVIINPNNPTGAVY 183



>gb:SCO939120_178317 Streptomyces coelicolor A3(2) complete genome;
           segment 17/29.
          Length = 408

 Score = 65.1 bits (157), Expect = 2e-09
 Identities = 44/158 (27%), Positives = 76/158 (48%), Gaps = 2/158 (1%)
 Frame = +1

Query: 526 KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
           + VI  G G+P     F +P    +A  +   + KF+ Y+P  GLP+ + AIA    RD 
Sbjct: 39  RPVIGFGAGEPD----FPTPDYIVEAAVEACKNPKFHRYTPAGGLPELKAAIAAKTLRDS 94

Query: 706 PEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLL 885
             +V    + VT G  QAI  A + +  PG  +++P P +  Y    + R       +++
Sbjct: 95  GYEVDPSQILVTNGGKQAIYEAFAAILDPGDEVIVPAPYWTTYP--ESIRLAGGVPVEVV 152

Query: 886 PEK--AWEVDLNAVESLADQNTIAVVIINPGNPCGNVY 993
            ++   + V +  +E+   + T  V+ ++P NP G VY
Sbjct: 153 ADETTGYRVTVEQLEAARTEKTKVVLFVSPSNPTGAVY 190



>gb:AY069814_1294544 Drosophila melanogaster SD05601 full length cDNA.
          Length = 568

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 43/150 (28%), Positives = 75/150 (50%), Gaps = 11/150 (7%)
 Frame = +1

Query: 601  AVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS-RDLPEKVSADDVYVTAGCTQAIETALS 777
            A+ +         Y+ + GL   R+ +A Y+  RD     +  D+Y+T G +  I++ LS
Sbjct: 183  AILNGCQGQSVGSYTDSAGLEVVRRQVAQYIEKRDGGIASNWQDIYLTGGASPGIKSILS 242

Query: 778  IL----AYPGANILLPRPGFPIY-ALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQ- 939
            ++          +++P P +P+Y A  + +   +V YY L  E  W +D   ++   D+ 
Sbjct: 243  MINAEVGCKAPGVMVPIPQYPLYSATISEYGMTKVDYY-LEEETGWSLDRKELQRSYDEA 301

Query: 940  ----NTIAVVIINPGNPCGNVYTYQHRQEI 1017
                N  A+V+INPGNP G V T ++ +EI
Sbjct: 302  KKVCNPRALVVINPGNPTGQVLTRENIEEI 331



>gb:AE014298_1125498 Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE014298_1125499 Drosophila melanogaster
            chromosome X, complete sequence.>gb:AE014298_1125500
            Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE014298_1125501 Drosophila melanogaster
            chromosome X, complete sequence.>gb:AE014298_1125502
            Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE003492_1212507 Drosophila melanogaster
            chromosome X, section 44 of 74 of the complete
            sequence.>gb:AE003492_1212508 Drosophila melanogaster
            chromosome X, section 44 of 74 of the complete
            sequence.>gb:AE003492_1212509 Drosophila melanogaster
            chromosome X, section 44 of 74 of the complete
            sequence.>gb:AE003492_1212510 Drosophila melanogaster
            chromosome X, section 44 of 74 of the complete
            sequence.>gb:AE003492_1212511 Drosophila melanogaster
            chromosome X, section 44 of 74 of the complete sequence.
          Length = 568

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 43/150 (28%), Positives = 75/150 (50%), Gaps = 11/150 (7%)
 Frame = +1

Query: 601  AVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS-RDLPEKVSADDVYVTAGCTQAIETALS 777
            A+ +         Y+ + GL   R+ +A Y+  RD     +  D+Y+T G +  I++ LS
Sbjct: 183  AILNGCQGQSVGSYTDSAGLEVVRRQVAQYIEKRDGGIASNWQDIYLTGGASPGIKSILS 242

Query: 778  IL----AYPGANILLPRPGFPIY-ALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQ- 939
            ++          +++P P +P+Y A  + +   +V YY L  E  W +D   ++   D+ 
Sbjct: 243  MINAEVGCKAPGVMVPIPQYPLYSATISEYGMTKVDYY-LEEETGWSLDRKELQRSYDEA 301

Query: 940  ----NTIAVVIINPGNPCGNVYTYQHRQEI 1017
                N  A+V+INPGNP G V T ++ +EI
Sbjct: 302  KKVCNPRALVVINPGNPTGQVLTRENIEEI 331



>gb:AE014298_1125497 Drosophila melanogaster chromosome X, complete
            sequence.>gb:AE003492_1212506 Drosophila melanogaster
            chromosome X, section 44 of 74 of the complete sequence.
          Length = 575

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 43/150 (28%), Positives = 75/150 (50%), Gaps = 11/150 (7%)
 Frame = +1

Query: 601  AVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS-RDLPEKVSADDVYVTAGCTQAIETALS 777
            A+ +         Y+ + GL   R+ +A Y+  RD     +  D+Y+T G +  I++ LS
Sbjct: 190  AILNGCQGQSVGSYTDSAGLEVVRRQVAQYIEKRDGGIASNWQDIYLTGGASPGIKSILS 249

Query: 778  IL----AYPGANILLPRPGFPIY-ALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQ- 939
            ++          +++P P +P+Y A  + +   +V YY L  E  W +D   ++   D+ 
Sbjct: 250  MINAEVGCKAPGVMVPIPQYPLYSATISEYGMTKVDYY-LEEETGWSLDRKELQRSYDEA 308

Query: 940  ----NTIAVVIINPGNPCGNVYTYQHRQEI 1017
                N  A+V+INPGNP G V T ++ +EI
Sbjct: 309  KKVCNPRALVVINPGNPTGQVLTRENIEEI 338



>gb:AE013248_290573 Methanosarcina mazei strain Goe1, section 30 of
            379 of the complete genome.>gb:AE008384_964682
            Methanosarcina mazei strain Goe1, complete genome.
          Length = 380

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 54/170 (31%), Positives = 80/170 (47%)
 Frame = +1

Query: 511  EGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADY 690
            EG D   VI+  +G+P     F +P     A +  +   K + Y+P+ G+P+ R AIA+ 
Sbjct: 27   EGTD---VINFSLGEPD----FDTPKNICDAAAKAMYEGKTH-YAPSAGIPELRSAIAEK 78

Query: 691  LSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVR 870
            L  +    VS  DV VT G  Q I   +      G   LL  P +  Y  C  F   +  
Sbjct: 79   LRTENHLDVSEKDVLVTPGAKQGIFEIMMGSLDDGDQALLFDPAWVTYDACIRFAGADTV 138

Query: 871  YYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            +   +PEK +  D N  E + D+ T  +V+ +PGNP G V+  +  Q IA
Sbjct: 139  WVPTVPEKGFLPD-NFAEYINDK-TKLIVVNSPGNPTGGVFGKKTLQCIA 186



>gb:AE013083_288861 Thermoanaerobacter tengcongensis MB4, section 110
            of 244 of the complete genome.>gb:AE008691_1110926
            Thermoanaerobacter tengcongensis strain MB4, complete
            genome.
          Length = 395

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 43/171 (25%), Positives = 82/171 (47%)
 Frame = +1

Query: 508  SEGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIAD 687
            +EG D   VI  G+G+P     F +P   ++A  + +    +  Y+P  G+ + +KAI +
Sbjct: 27   AEGVD---VIDFGVGEPD----FDTPDYIKEAAIEAIKK-GYTKYTPASGILELKKAICE 78

Query: 688  YLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEV 867
             L R+       + + V+ G   +I  ALS +  PG  +++P P +  Y       + + 
Sbjct: 79   KLKRENGLFYEPEQIVVSNGAKHSIYNALSAILNPGDEVIIPVPYWLSYPEMVRLAYGKP 138

Query: 868  RYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
             +     E  +++    + +  +  T A+++ +P NP G VYT +  Q+IA
Sbjct: 139  VFVQTKEENNFKITAEELTAAINPKTKALILNSPNNPTGAVYTRKELQDIA 189



>sp|O58489|AAT_PYRHO Aspartate aminotransferase (EC 2.6.1.1)
           (Transaminase A) (AspAT).>pir|E71125|E71125 probable
           aromatic-amino-acid transaminase (EC 2.6.1.57) PH0771
           [similarity] - Pyrococcus horikoshii>gb:BA000001_649425
           Pyrococcus horikoshii OT3 DNA, complete genome.
          Length = 391

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 43/151 (28%), Positives = 69/151 (45%)
 Frame = +1

Query: 532 VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
           VISLG+G+P     F +P   ++A    L    +  Y+P  G+P+ R+A+ +Y  +    
Sbjct: 34  VISLGIGEPD----FDTPKNIKEAAKRALDE-GWTHYTPNAGIPELREAVVEYYKKFYGI 88

Query: 712 KVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPE 891
            +  ++V +TAG  +    A   L   G  +++P P F  YA  A     +     L  E
Sbjct: 89  DIEVENVIITAGAYEGTYLAFESLLERGDEVIIPDPAFVSYAEDAKVAEAKPVRIPLREE 148

Query: 892 KAWEVDLNAVESLADQNTIAVVIINPGNPCG 984
             +  D N +     +NT  +VI  P NP G
Sbjct: 149 NNFLPDPNELLEKISKNTRMIVINYPNNPTG 179



>gb:AY087416_1572447 Arabidopsis thaliana clone 35179 mRNA, complete
            sequence.
          Length = 404

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 47/163 (28%), Positives = 76/163 (46%), Gaps = 1/163 (0%)
 Frame = +1

Query: 535  ISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEK 714
            I+LG G P     F  P   ++A    +   K N Y+   G+PQ   AIA     D    
Sbjct: 42   INLGQGFPN----FDGPDFVKEAAIQAIKDGK-NQYARGYGIPQLNSAIAARFREDTGLV 96

Query: 715  VSAD-DVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPE 891
            V  + +V VT+GCT+AI  A+  L  PG  ++L  P +  Y    +    +V+   L P 
Sbjct: 97   VDPEKEVTVTSGCTEAIAAAMLGLINPGDEVILFAPFYDSYEATLSMAGAKVKGITLRPP 156

Query: 892  KAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
              + + L  +++     T A+++  P NP G ++T +  + IA
Sbjct: 157  D-FSIPLEELKAAVTNKTRAILMNTPHNPTGKMFTREELETIA 198



>gb:AY074320_1567477 Arabidopsis thaliana putative aminotransferase
            (At1g77670) mRNA, complete cds.
          Length = 440

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 47/163 (28%), Positives = 76/163 (46%), Gaps = 1/163 (0%)
 Frame = +1

Query: 535  ISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEK 714
            I+LG G P     F  P   ++A    +   K N Y+   G+PQ   AIA     D    
Sbjct: 82   INLGQGFPN----FDGPDFVKEAAIQAIKDGK-NQYARGYGIPQLNSAIAARFREDTGLV 136

Query: 715  VSAD-DVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPE 891
            V  + +V VT+GCT+AI  A+  L  PG  ++L  P +  Y    +    +V+   L P 
Sbjct: 137  VDPEKEVTVTSGCTEAIAAAMLGLINPGDEVILFAPFYDSYEATLSMAGAKVKGITLRPP 196

Query: 892  KAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
              + + L  +++     T A+++  P NP G ++T +  + IA
Sbjct: 197  D-FSIPLEELKAAVTNKTRAILMNTPHNPTGKMFTREELETIA 238



>gb:AE017333_447471 Bacillus licheniformis DSM 13, complete
            genome.>gb:CP000002_857278 Bacillus licheniformis ATCC
            14580, complete genome.
          Length = 389

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 43/166 (25%), Positives = 76/166 (45%), Gaps = 1/166 (0%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
            + VISL +G P  ++  H    A++A+ +  +SY  N      G P+ R+A+  Y+ +  
Sbjct: 28   ENVISLTIGQPDFFTPHHVKQAAKKAIDENQTSYTHNA-----GYPELRQAVQLYMKKKA 82

Query: 706  PEKVSAD-DVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDL 882
                 A+ ++ VT G +QAI++A   +  PG  ++LP P +P Y              D 
Sbjct: 83   DLNYEAESEIIVTTGASQAIDSAFRTILSPGDEVILPGPVYPGYEPIIKMCGASPLIID- 141

Query: 883  LPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
                 +++    +E      T  VV+  P NP G   + +  ++IA
Sbjct: 142  TTSHGFKLTAKLIEEALTPKTKCVVLPYPSNPTGMTLSEEELKDIA 187



>gb:AE017310_438648 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 2 of 12 of the complete
           genome.>gb:AE017285_1071809 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 399

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 50/160 (31%), Positives = 77/160 (48%), Gaps = 7/160 (4%)
 Frame = +1

Query: 535 ISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNG-YSPTVGLPQTRKAIADYLSRDLPE 711
           +SLG G P+    F +P    +AV   L      G Y+   G+P  R+AIA  L+     
Sbjct: 33  VSLGQGVPS----FRTPEHIVEAVCRALRDKADAGRYTLQPGMPALREAIAADLAARKGY 88

Query: 712 KVSAD-DVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFR-----HLEVRY 873
            V+ D +V VT G  +A+  AL  +   G  +++P PG+  +A           H+ +R 
Sbjct: 89  MVNPDSEVGVTVGAMEALLMALLTVVDRGDEVIIPSPGYASHAEQVLMAEGVPVHVPLRA 148

Query: 874 YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVY 993
            D      W +D++A+ +     T AV++ NPGNP G VY
Sbjct: 149 DD------WGLDVDAIRAAVTPRTRAVIVCNPGNPTGTVY 182



>gb:AE016942_363301 Bacteroides thetaiotaomicron VPI-5482, section
           17 of 21 of the complete genome.>gb:AE015928_989789
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 393

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 44/157 (28%), Positives = 70/157 (44%), Gaps = 2/157 (1%)
 Frame = +1

Query: 520 DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSR 699
           + K VISLG+G P          +  + + +       +GY P VG+P+ RK  A +  R
Sbjct: 37  EGKDVISLGIGSPD----MPPSKVTIETLCNNAHDPNGHGYQPYVGIPELRKGFAAWYQR 92

Query: 700 DLPEKVSAD-DVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
               +++ + ++    G  + I         PG  +L+P PG+P Y   +     EV  Y
Sbjct: 93  WYGVELNPNTEIQPLIGSKEGILHVTLAFVNPGEQVLVPNPGYPTYTSLSKILGAEVISY 152

Query: 877 DLLPEKAWEVDLNAVESLADQNTIAVVIIN-PGNPCG 984
           DL  E  W  D  A+E + D N + ++  N P  P G
Sbjct: 153 DLKEEDGWMPDFEALEKM-DLNRVKLMWTNYPNMPTG 188



>gb:AE010862_267161 Methanosarcina acetivorans str. C2A, section 207
            of 534 of the complete genome.>gb:AE010299_907720
            Methanosarcina acetivorans str. C2A, complete genome.
          Length = 380

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 53/170 (31%), Positives = 81/170 (47%)
 Frame = +1

Query: 511  EGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADY 690
            EG D   VI+  +G+P     F +P     A +  +   K + Y+P+ G+P+ R AIA+ 
Sbjct: 27   EGTD---VINFSLGEPD----FDTPKNICDAAAKAMYEGKTH-YAPSAGIPELRAAIAEK 78

Query: 691  LSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVR 870
            L  +   +V+  DV VT G  QAI   +      G   LL  P +  Y  C  F      
Sbjct: 79   LKTENHLEVTEKDVLVTPGAKQAIFEIMMGALDDGDRALLFDPAWVTYDACIRFSGANTV 138

Query: 871  YYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            +   +PE+ +  D N  E + D+ T  +V+ +PGNP G V+  +  Q IA
Sbjct: 139  WVPTVPERGFLPD-NFAEYINDK-TKLIVVNSPGNPTGGVFGKKTLQCIA 186



>pir|D96806|D96806 probable aminotransferase, 101422-99564 [imported]
            - Arabidopsis thaliana>gb:AE005173_895289 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC010704_1537035 Arabidopsis thaliana
            chromosome 1 BAC T5M16 genomic sequence, complete
            sequence.
          Length = 440

 Score = 64.3 bits (155), Expect = 4e-09
 Identities = 47/163 (28%), Positives = 76/163 (46%), Gaps = 1/163 (0%)
 Frame = +1

Query: 535  ISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEK 714
            I+LG G P     F  P   ++A    +   K N Y+   G+PQ   AIA     D    
Sbjct: 82   INLGQGFPN----FDGPDFVKEAAIQAIKDGK-NQYARGYGIPQLNSAIAARFREDTGLV 136

Query: 715  VSAD-DVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPE 891
            V  + +V VT+GCT+AI  A+  L  PG  ++L  P +  Y    +    +V+   L P 
Sbjct: 137  VDPEKEVTVTSGCTEAIAAAMLGLINPGDEVILFAPFYDSYEATLSMAGAKVKGITLRPP 196

Query: 892  KAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
              + + L  +++     T A+++  P NP G ++T +  + IA
Sbjct: 197  D-FSIPLEELKAAVTNKTRAILMNTPHNPTGKMFTREELETIA 238



>gb:AE017280_426240 Bacillus cereus ATCC 10987, section 17 of 18 of
            the complete genome.>gb:AE017194_1064659 Bacillus cereus
            ATCC 10987, complete genome.
          Length = 396

 Score = 63.9 bits (154), Expect = 5e-09
 Identities = 49/167 (29%), Positives = 79/167 (47%), Gaps = 2/167 (1%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
            K VISLG+G+P     F +P   +QA   +L    +  Y+   GL + R+ IA YL +  
Sbjct: 29   KGVISLGVGEPD----FVTPWNVRQACIRSLEQ-GYTSYTANAGLLELRQEIAKYLKKQF 83

Query: 706  PEKVSA-DDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYA-LCAAFRHLEVRYYD 879
                   D++ VT G +QA++ A+  +  P   +L+  P F  YA L      + V    
Sbjct: 84   AVSYDPNDEIIVTVGASQALDVAMRAIINPDDEVLIIEPSFVSYAPLVTLAGGVPVPVAT 143

Query: 880  LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
             L E  ++V    +E+     T A+++ +P NP G +      +EIA
Sbjct: 144  TL-ENEFKVQPEQIEAAITAKTKAILLCSPNNPTGAMLNKSELEEIA 189



>gb:AY714840_1189319 Uncultured archaeon GZfos26D6 clone GZfos26D6,
           *** SEQUENCING IN PROGRESS ***.
          Length = 269

 Score = 63.5 bits (153), Expect = 6e-09
 Identities = 52/178 (29%), Positives = 81/178 (45%)
 Frame = +1

Query: 457 NITIKGILGLLMANIEGSEGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFN 636
           NI I GI        E   GD      +LG+G+P   +  H    A QA+    +SY  N
Sbjct: 11  NIEISGI----RKAFEALSGD----FFNLGLGEPDFDTPEHVKIAAMQALKSGFTSYTSN 62

Query: 637 GYSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPR 816
                 G+ + R+AI+  L RD     S D++ VT+G ++A+  A+  +   G  +L+P 
Sbjct: 63  K-----GIDELREAISAKLYRDNNLAFSPDEMIVTSGASEALHIAIHSVVERGDEVLIPN 117

Query: 817 PGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNV 990
           PGF  +A  A     E +   +     + +   AV+      T A++I +P NP G V
Sbjct: 118 PGFVSFA--ALTELAEGKPIGVPLSDDFSISAEAVKEKITDKTKALIINSPANPTGAV 173



>gb:BX957222_844325 Methanococcus maripaludis S2 complete genome;
            segment 4/5.
          Length = 375

 Score = 63.5 bits (153), Expect = 6e-09
 Identities = 47/179 (26%), Positives = 86/179 (48%), Gaps = 8/179 (4%)
 Frame = +1

Query: 505  GSEGDDSKKV--------ISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGL 660
            G+E  + +K+        I+LG+G+P     F +P    +A    L + K + Y P  G+
Sbjct: 8    GTEQSEIRKIFNMATENSINLGIGEPD----FDTPKNIVEAAKLALDAGKTH-YVPNAGI 62

Query: 661  PQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYAL 840
             +   AI++ L +D    +S  ++  T G ++A+  +L  L   G  +L+P PGF  Y  
Sbjct: 63   LELTSAISEKLKKDNNLDISQKNIVTTCGASEALMLSLFTLVNRGEEVLVPDPGFVSYKG 122

Query: 841  CAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
                   ++   DL  +  + +DL +V++     T  +V+ +P NP G+V T +  + I
Sbjct: 123  LTELCEGKMVPIDL--DDKFRIDLESVKNSITDKTKCIVLNSPSNPTGSVMTKEELKGI 179



>gb:AY596297_634631 Haloarcula marismortui ATCC 43049 chromosome I,
            complete sequence.
          Length = 373

 Score = 63.5 bits (153), Expect = 6e-09
 Identities = 49/170 (28%), Positives = 80/170 (47%), Gaps = 1/170 (0%)
 Frame = +1

Query: 514  GDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYL 693
            G+D+   I+LG+G P     F +P  A++A  + + + K + Y+   G  + R+AIA   
Sbjct: 24   GEDA---INLGLGQPD----FPTPEHAREAAVEAIQAGKVDAYTSNKGTEELREAIAAKH 76

Query: 694  SRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRY 873
             RD   +V   D+  T+G ++A+  AL      G  ++ P PGF  Y    A  HL    
Sbjct: 77   ERDNDLEVDPGDIIATSGGSEALHIALEAHVDAGQEVIFPDPGFVSY---DALTHLAGGT 133

Query: 874  YDLLP-EKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
               +P  +   +    VE     +T A V+ +P NP G V + +  +E A
Sbjct: 134  PRPVPLREDLTMAPETVEEAITDDTAAFVVNSPANPTGAVQSPEDMREFA 183



>gb:CP000009_863504 Gluconobacter oxydans 621H, complete genome.
          Length = 408

 Score = 63.2 bits (152), Expect = 8e-09
 Identities = 48/171 (28%), Positives = 77/171 (45%), Gaps = 3/171 (1%)
 Frame = +1

Query: 514  GDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYL 693
            GDD   +I LGMG+P +      PA   Q + +T+ + + +GYS + G+P  RKA+A+Y 
Sbjct: 30   GDD---IIDLGMGNPDSAP----PAHVVQKLIETVGNPRAHGYSVSRGIPGLRKAMANYY 82

Query: 694  SRDLPEKVSAD---DVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLE 864
             R     VS D   +V  T G  + +    + +  PG  IL+P P +PI+          
Sbjct: 83   ERRF--NVSLDPETEVIATLGSKEGLANLAAAITSPGDTILVPNPSYPIHQFGFIIAGAS 140

Query: 865  VRYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            VR     P++     L      +     A+++  P NP   V      +E+
Sbjct: 141  VRSIPATPDEDMLRALERAVRHSVPKPTALIVNFPSNPTAFVANLDFYKEL 191



>gb:CP000001_855226 Bacillus cereus ZK, complete genome.
          Length = 396

 Score = 63.2 bits (152), Expect = 8e-09
 Identities = 48/167 (28%), Positives = 79/167 (47%), Gaps = 2/167 (1%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
            K VISLG+G+P     F +P   +QA   ++    +  Y+   GL + R+ IA YL +  
Sbjct: 29   KGVISLGVGEPD----FVTPWNVRQACIRSIEQ-GYTSYTANAGLLELRQEIAKYLKKQF 83

Query: 706  PEKVSA-DDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYA-LCAAFRHLEVRYYD 879
                   D++ VT G +QA++ A+  +  P   +L+  P F  YA L      + V    
Sbjct: 84   AVSYDPNDEIIVTVGASQALDVAMRAIINPDDEVLIIEPSFVSYAPLVTLAGGVPVPVAT 143

Query: 880  LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
             L E  ++V    +E+     T A+++ +P NP G +      +EIA
Sbjct: 144  TL-ENEFKVQPEQIEAAITAKTKAILLCSPNNPTGAMLNKSELEEIA 189



>gb:BA000036_720571 Corynebacterium glutamicum ATCC 13032 DNA,
            complete genome.
          Length = 419

 Score = 63.2 bits (152), Expect = 8e-09
 Identities = 41/167 (24%), Positives = 75/167 (44%), Gaps = 1/167 (0%)
 Frame = +1

Query: 520  DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGL-PQTRKAIADYLS 696
            D   ++ L  G+P  +  F +P +  + +   L + +  GYS + G+ P  R  +  Y  
Sbjct: 45   DGHNILKLNTGNPAVFG-FDAPDVIMRDMIANLPTSQ--GYSTSKGIIPARRAVVTRYEV 101

Query: 697  RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
                     DDV++  G ++ I      L   G  +L+P P +P++    +    +  +Y
Sbjct: 102  VPGFPHFDVDDVFLGNGVSELITMTTQALLNDGDEVLIPAPDYPLWTAATSLAGGKPVHY 161

Query: 877  DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
                E  W   +  ++S   + T A+V+INP NP G VY  +  ++I
Sbjct: 162  LCDEEDDWNPSIEDIKSKISEKTKAIVVINPNNPTGAVYPRRVLEQI 208



>gb:AY238317_601446 Corynebacterium glutamicum aminotransferase-like
            protein Cg3149 gene, complete cds.>gb:BX927156_834380
            Corynebacterium glutamicum ATCC 13032, IS fingerprint
            type 4-5, complete genome; segment
            9/10.>gb:AX063839_1458833 Sequence 121 from Patent
            WO0100843.>gb:AX064213_1459020 Sequence 495 from Patent
            WO0100843.
          Length = 437

 Score = 63.2 bits (152), Expect = 8e-09
 Identities = 41/167 (24%), Positives = 75/167 (44%), Gaps = 1/167 (0%)
 Frame = +1

Query: 520  DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGL-PQTRKAIADYLS 696
            D   ++ L  G+P  +  F +P +  + +   L + +  GYS + G+ P  R  +  Y  
Sbjct: 63   DGHNILKLNTGNPAVFG-FDAPDVIMRDMIANLPTSQ--GYSTSKGIIPARRAVVTRYEV 119

Query: 697  RDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
                     DDV++  G ++ I      L   G  +L+P P +P++    +    +  +Y
Sbjct: 120  VPGFPHFDVDDVFLGNGVSELITMTTQALLNDGDEVLIPAPDYPLWTAATSLAGGKPVHY 179

Query: 877  DLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
                E  W   +  ++S   + T A+V+INP NP G VY  +  ++I
Sbjct: 180  LCDEEDDWNPSIEDIKSKISEKTKAIVVINPNNPTGAVYPRRVLEQI 226



>gb:AE017039_385047 Bacillus anthracis str. Ames section 16 of 18 of
            the complete genome.>gb:AE017225_410141 Bacillus
            anthracis str. Sterne, complete
            genome.>gb:AE017334_454894 Bacillus anthracis str. 'Ames
            Ancestor', complete genome.>gb:AE017355_465898 Bacillus
            thuringiensis serovar konkukian str. 97-27, complete
            genome.>gb:AE016879_1014752 Bacillus anthracis str. Ames
            complete genome.
          Length = 396

 Score = 63.2 bits (152), Expect = 8e-09
 Identities = 48/167 (28%), Positives = 79/167 (47%), Gaps = 2/167 (1%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
            K VISLG+G+P     F +P   +QA   ++    +  Y+   GL + R+ IA YL +  
Sbjct: 29   KGVISLGVGEPD----FVTPWNVRQACIRSIEQ-GYTSYTANAGLLELRQEIAKYLKKQF 83

Query: 706  PEKVSA-DDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYA-LCAAFRHLEVRYYD 879
                   D++ VT G +QA++ A+  +  P   +L+  P F  YA L      + V    
Sbjct: 84   AVSYDPNDEIIVTVGASQALDVAMRAIINPDDEVLIIEPSFVSYAPLVTLAGGVPVPVAT 143

Query: 880  LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
             L E  ++V    +E+     T A+++ +P NP G +      +EIA
Sbjct: 144  TL-ENEFKVQPEQIEAAITAKTKAILLCSPNNPTGAMLNKSELEEIA 189



>pir|T36548|T36548 probable transaminase (EC 2.6.1.-) SCH10.36
            [similarity] - Streptomyces
            coelicolor>gb:SCO939117_177330 Streptomyces coelicolor
            A3(2) complete genome; segment 14/29.
          Length = 396

 Score = 63.2 bits (152), Expect = 8e-09
 Identities = 51/164 (31%), Positives = 72/164 (43%), Gaps = 2/164 (1%)
 Frame = +1

Query: 535  ISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEK 714
            I+LG G P        P   ++A    L   + N Y P  G+P+ R A+A +  R     
Sbjct: 37   INLGQGFPDT----DGPEEVREAAVRALRDGRGNQYPPGPGVPELRAAVAGHQQRRYGLS 92

Query: 715  VSAD-DVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLP- 888
               D +V VTAG T+AI  AL  L  PG  ++   P +  YA C A          L P 
Sbjct: 93   YDPDTEVLVTAGATEAIAAALLALLEPGDEVVALEPYYDSYAACIAMAGGTRVPVTLRPH 152

Query: 889  EKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            E  + +DL+ +       T  +++  P NP G V T   R E+A
Sbjct: 153  EGTFRLDLDELRDAVTDRTRLLLLNTPHNPTGTVLT---RDELA 193



>pir|D75496|D75496 aspartate transaminase (EC 2.6.1.1) DR0623
            [similarity] - Deinococcus radiodurans (strain
            R1)>gb:AE001920_40900 Deinococcus radiodurans R1 section
            57 of 229 of the complete chromosome
            1.>gb:AE000513_881795 Deinococcus radiodurans R1 complete
            chromosome 1.
          Length = 388

 Score = 63.2 bits (152), Expect = 8e-09
 Identities = 43/163 (26%), Positives = 78/163 (47%)
 Frame = +1

Query: 532  VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
            VIS+ +G+P   +  H  A    A+ +  + Y     +P  G+P+ R+AI+    R+   
Sbjct: 36   VISMSVGEPDFDTPPHVKAAGIAAIEEGKTKY-----TPVSGIPELREAISAKFRRENGL 90

Query: 712  KVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPE 891
              + + V VT+G  QA+  A   L  PG  +L+P P +  Y    A            P+
Sbjct: 91   DYAPNAVTVTSGGKQALFNAFFALLNPGDEVLIPAPHWVSYPEMVALTGAVPVTVPTTPQ 150

Query: 892  KAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            + +++D +A+ +     T  V++ +PGNP G V+  +  + +A
Sbjct: 151  QGFQLDPDALAAAITPRTRMVILNSPGNPTGAVFPPETLRAVA 193



>gb:AP006841_574462 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 394

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 45/159 (28%), Positives = 72/159 (45%), Gaps = 4/159 (2%)
 Frame = +1

Query: 520 DSKKVISLGMGDPTAYSCFHSPALAQ--QAVSDTLSSYKFNGYSPTVGLPQTRKAIADYL 693
           + K VISLG+G P        P   Q  + + +       +GY P VG+P+ RK  AD+ 
Sbjct: 37  EGKDVISLGIGSPDM------PPSEQTIETLCNNAHDPNGHGYQPYVGIPELRKGFADWY 90

Query: 694 SRDLPEKVS-ADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVR 870
            R    +++ A ++    G  + I         PG  +L+P PG+P Y   +     EV 
Sbjct: 91  KRWYGVELNPATEIQPLIGSKEGILHVTLAFVNPGEQVLVPNPGYPTYTSLSKILGAEVV 150

Query: 871 YYDLLPEKAWEVDLNAVESLADQNTIAVVIIN-PGNPCG 984
            Y+L  E  W  D + +E + D + + ++  N P  P G
Sbjct: 151 NYNLKEEDGWMPDFDELEKM-DLSRVKLMWTNYPNMPTG 188



>gb:AE016936_361783 Bacteroides thetaiotaomicron VPI-5482, section 11
            of 21 of the complete genome.>gb:AE015928_988271
            Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 397

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 41/163 (25%), Positives = 78/163 (47%)
 Frame = +1

Query: 532  VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
            VI+L +G+P   +  H    A++A+ D      F+ YSP  G P  R AI + L ++   
Sbjct: 33   VINLSVGEPDFNTPDHIKEAAKKAIDDN-----FSRYSPVPGYPALRNAIVEKLKKENGL 87

Query: 712  KVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPE 891
            + +A  +    G  Q++  A+ +L  PG  +++P P +  Y                  E
Sbjct: 88   EYTAAQISCANGAKQSVCNAILVLVNPGDEVIVPAPYWVSYPEMVKMAEGTPVIVSAGIE 147

Query: 892  KAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            + +++    +E+     T A+++ +P NP G+VY+   ++E+A
Sbjct: 148  QDFKITPKQLEAAITPKTKALILCSPSNPTGSVYS---KEELA 187



>pir|D97193|D97193 PLP-dependent aminotransferase [imported] -
            Clostridium acetobutylicum>gb:AE007738_229696 Clostridium
            acetobutylicum ATCC 824 section 226 of 356 of the
            complete genome.>gb:AE001437_1092651 Clostridium
            acetobutylicum ATCC 824, complete genome.
          Length = 395

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 46/162 (28%), Positives = 76/162 (46%), Gaps = 1/162 (0%)
 Frame = +1

Query: 535  ISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEK 714
            ISL +G P     F  P   ++A+   +   K   Y+   G+ + R  I+ YL R     
Sbjct: 40   ISLTLGQPD----FPVPDKVKRAMVRAIEDNK-TVYTSNAGIDELRNEISKYLKR-FNIN 93

Query: 715  VSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPEK 894
             S D++ +TAG T+ I      L   G  +L+P P FP YA C      EV  Y L   +
Sbjct: 94   YSKDEICITAGGTEGILDIFQALLNKGDKVLVPDPSFPAYASCTKLLEGEVITYGLYGSE 153

Query: 895  AWEVDLNAVES-LADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
             + +D N +E+ + ++    +V+  P NP G V + +  +++
Sbjct: 154  -FSIDFNELENKIKNEKPKFMVLSYPSNPTGTVISKEDNEKL 194



>sp|Q10334|ALAT_SCHPO Putative alanine aminotransferase (EC 2.6.1.2)
           (Glutamic--pyruvic transaminase) (GPT)
           (Glutamic--alanine transaminase).>pir|T37975|T37975
           probable alanine aminotransferase - fission yeast
           (Schizosaccharomyces pombe)>gb:SPBC582_1720282 S.pombe
           chromosome II cosmid c582.
          Length = 505

 Score = 62.8 bits (151), Expect = 1e-08
 Identities = 35/128 (27%), Positives = 60/128 (46%), Gaps = 7/128 (5%)
 Frame = +1

Query: 622 SYKFNGYSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALS-ILAYPGA 798
           S     YS + G+P  R+ +AD++           D+Y+T+G + A    ++ I+A P  
Sbjct: 130 SGSLGAYSASQGIPLVRRHVADFIRARDGFDCEPSDIYLTSGASHAARLIMTLIIARPTD 189

Query: 799 NILLPRPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQ------NTIAVVI 960
            +++P P +P+Y          +  Y L  E  W++D +  +   D+      N    V+
Sbjct: 190 GVMVPAPQYPLYGAQIDLMSGSMVSYSLSEENNWDIDFDQFKKSFDEASKKGINVRLCVV 249

Query: 961 INPGNPCG 984
           INPGNP G
Sbjct: 250 INPGNPTG 257



>gb:AY113694_2512772 Oncorhynchus mykiss tyrosine aminotransferase
           mRNA, partial cds.
          Length = 93

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 31/79 (39%), Positives = 51/79 (64%), Gaps = 1/79 (1%)
 Frame = +1

Query: 526 KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
           K +I+L +GDPT +    +     QA+ D + S K+NGY+P+VG  ++R  +A++ S   
Sbjct: 17  KPMIALSIGDPTVFGNLPTDEKVTQALKDAIDSNKYNGYAPSVGYQKSRDVVANFYS--C 74

Query: 706 PE-KVSADDVYVTAGCTQA 759
           PE  + A+DV +T+GC+QA
Sbjct: 75  PEAPLEAEDVLLTSGCSQA 93



>gb:CP000001_854367 Bacillus cereus ZK, complete genome.
          Length = 387

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 47/169 (27%), Positives = 82/169 (48%), Gaps = 6/169 (3%)
 Frame = +1

Query: 532  VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
            +ISL +G P     F +P+L ++A    ++   +  Y+   GL + RKA  +++  +   
Sbjct: 30   LISLTIGQPD----FPTPSLVKEAAKRAITE-NYTSYTHNAGLLELRKAACNFVKDNYDL 84

Query: 712  KVSAD-DVYVTAGCTQAIETALSILAYPGANILLPRPGF----PIYALCAAFR-HLEVRY 873
              S + +  VT G ++AI+ A   +  PG  ++LP P +    PI  LC A    ++VR 
Sbjct: 85   HYSPETETIVTIGASEAIDVAFRTILEPGTEVILPAPIYPGYEPIIRLCGATPIFIDVR- 143

Query: 874  YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
                 E  + +   A+E+   + T  VV+  P NP G   + +  Q+IA
Sbjct: 144  -----ETGFRLTAEALENAITEKTRCVVLPYPSNPTGVTLSKKELQDIA 187



>gb:AY288521_606405 Methanococcus voltae aspartate
           aminotransferase-like protein, chromosomal segregation
           protein (SMC), and thermonuclease genes, complete cds.
          Length = 440

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 46/160 (28%), Positives = 77/160 (48%), Gaps = 3/160 (1%)
 Frame = +1

Query: 526 KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
           KK+I   +GDP A      P   ++ VS++    K  GY PT GL +TR+ +AD  +   
Sbjct: 32  KKIIWENIGDPIAKG-EQMPEWIKEIVSESTLENKTYGYCPTQGLLETREFLADLNNSKN 90

Query: 706 PEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALC-AAFRHLEVRYYDL 882
             ++++DD+    G   AI T +  L      ++ P P +  ++     + +     Y L
Sbjct: 91  GAQITSDDMIFFNGLGDAI-TNIYGLMRKECRVIGPTPAYSTHSSAEGLYSNSSPVMYSL 149

Query: 883 LPEKAWEVDLNAVESLADQN--TIAVVIINPGNPCGNVYT 996
             +  W  DL+ +E+    N     +++INPGNP G VY+
Sbjct: 150 DKDNLWYPDLDDLENKVKYNPSVSGILLINPGNPTGAVYS 189



>gb:AE017355_465045 Bacillus thuringiensis serovar konkukian str.
            97-27, complete genome.
          Length = 387

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 47/169 (27%), Positives = 82/169 (48%), Gaps = 6/169 (3%)
 Frame = +1

Query: 532  VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
            +ISL +G P     F +P+L ++A    ++   +  Y+   GL + RKA  +++  +   
Sbjct: 30   LISLTIGQPD----FPTPSLVKEAAKRAITE-NYTSYTHNAGLLELRKAACNFVKDNYDL 84

Query: 712  KVSAD-DVYVTAGCTQAIETALSILAYPGANILLPRPGF----PIYALCAAFR-HLEVRY 873
              S + +  VT G ++AI+ A   +  PG  ++LP P +    PI  LC A    ++VR 
Sbjct: 85   HYSPENETIVTIGASEAIDVAFRTILEPGTEVILPAPIYPGYEPIIRLCGATPIFIDVR- 143

Query: 874  YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
                 E  + +   A+E+   + T  VV+  P NP G   + +  Q+IA
Sbjct: 144  -----ETGFRLTAEALENAITEKTRCVVLPYPSNPTGVTLSKKELQDIA 187



>gb:AE017307_437594 Thermus thermophilus HB27 section 7 of 7 of the
            complete genome.>gb:AE017221_1079572 Thermus thermophilus
            HB27 complete genome.
          Length = 385

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 43/163 (26%), Positives = 76/163 (46%)
 Frame = +1

Query: 532  VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
            +++L  G+P     F +P   ++A    L+  K   Y+P  G+P+ R+A+A+   R+   
Sbjct: 33   LVALTAGEPD----FDTPEHVKEAARRALAQGKTK-YAPPAGIPELREALAEKFRRENGL 87

Query: 712  KVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPE 891
             V+ ++  VT G  QA+      +  PG  +++  P +  Y     F    V   + LPE
Sbjct: 88   SVTPEETIVTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPE 147

Query: 892  KAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            + +  D   V       T A+V+ +P NP G VY  +  + +A
Sbjct: 148  EGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALA 190



>sp|Q56232|AAT_THETH Aspartate aminotransferase (EC 2.6.1.1)
            (Transaminase A) (ASPAT).>pir|JC4537|JC4537 aspartate
            transaminase (EC 2.6.1.1) [validated] - Thermus aquaticus
            (strain HB8)>gb:TTHASPC_198505 Thermus thermophilus AspC
            gene for aspartate aminotransferase, complete
            cds.>gb:AP008226_577503 Thermus thermophilus HB8 genomic
            DNA, complete genome.
          Length = 385

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 43/163 (26%), Positives = 76/163 (46%)
 Frame = +1

Query: 532  VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
            +++L  G+P     F +P   ++A    L+  K   Y+P  G+P+ R+A+A+   R+   
Sbjct: 33   LVALTAGEPD----FDTPEHVKEAARRALAQGKTK-YAPPAGIPELREALAEKFRRENGL 87

Query: 712  KVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPE 891
             V+ ++  VT G  QA+      +  PG  +++  P +  Y     F    V   + LPE
Sbjct: 88   SVTPEETIVTVGGKQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPE 147

Query: 892  KAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            + +  D   V       T A+V+ +P NP G VY  +  + +A
Sbjct: 148  EGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALA 190



>gb:AE016818_1747979 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 458

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 48/174 (27%), Positives = 75/174 (43%), Gaps = 10/174 (5%)
 Frame = +1

Query: 505 GSEGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIA 684
           GS      KV++LG G    +  +  P  A       L +   N Y+PT G P   +A+ 
Sbjct: 62  GSGAGKGMKVLNLGQG----FFSYSPPDFAIAGAQRALENAMNNQYAPTRGRPALVEALL 117

Query: 685 DYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLE 864
             L R +   ++A++V VT G  + I   L+ L  PG  +++  P F  Y          
Sbjct: 118 K-LYRPMYGDLAAENVQVTTGANEGIFACLAGLVNPGDEVIVFEPFFDQYIPNIELLGGV 176

Query: 865 VRYYDLLPEKA----------WEVDLNAVESLADQNTIAVVIINPGNPCGNVYT 996
           VRY  + P             W +D + +    ++ T AV+I +P NP G V+T
Sbjct: 177 VRYVPIRPPAELSKRVTEGTEWVIDYDMLRQTINEKTKAVIINSPHNPIGKVFT 230



>gb:AY084890_1569972 Arabidopsis thaliana clone 120310 mRNA, complete
            sequence.
          Length = 481

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 44/164 (26%), Positives = 78/164 (47%), Gaps = 7/164 (4%)
 Frame = +1

Query: 547  MGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEKVSAD 726
            + DP     F + A+A+     +L+S     YS + GLP  RK +AD++ R        +
Sbjct: 72   LDDPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVADFIERRDGYPSDPE 131

Query: 727  DVYVTAGCTQAIETALS-ILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPEKAWE 903
             +++T G ++ +   L+ ++      IL+P P +P+Y+   +     +  Y L   + W 
Sbjct: 132  LIFLTDGASKGVMQILNCVIRGQKDGILVPVPQYPLYSATISLLGGTLVPYYLEESENWG 191

Query: 904  VDLNAVESLADQ------NTIAVVIINPGNPCGNVYTYQHRQEI 1017
            +D+N +     Q         A+VIINPGNP G   +  + +EI
Sbjct: 192  LDVNNLRQSVAQARSQGITVRAMVIINPGNPTGQCLSEANIREI 235



>gb:AY714814_1188355 Uncultured archaeon GZfos10C7 clone GZfos10C7,
            *** SEQUENCING IN PROGRESS ***, 2 unordered pieces.
          Length = 379

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 44/167 (26%), Positives = 80/167 (47%)
 Frame = +1

Query: 520  DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSR 699
            + K V++  +G+P   +  H    A++A+        +  Y  + G+ + R+AIA  +  
Sbjct: 27   EGKSVLNFSLGEPDFKTPGHICEAAKRALD-----LGYTHYVSSAGVDELREAIAGKIRE 81

Query: 700  DLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYD 879
            +    VSA++V VT G  QAI   +  +   G  ++L  P +  +           ++  
Sbjct: 82   ENEVDVSAENVIVTPGAKQAIYELMMSVLDDGDEVILLDPAWVTFESAVKLAGGNPKWVK 141

Query: 880  LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
             L E   EV+  ++ES   +NT  +VI +P NP G V + + ++EIA
Sbjct: 142  RLEE---EVNYESLESAVSENTKLIVINSPNNPAGYVLSEKEQKEIA 185



>gb:AL935255_551126 Lactobacillus plantarum strain WCFS1 complete
            genome; segment 4/11.
          Length = 395

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 49/171 (28%), Positives = 79/171 (46%), Gaps = 8/171 (4%)
 Frame = +1

Query: 532  VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
            ++ L +G+P   +  H  A A++A+ D  S Y     +   GL + R+A A +       
Sbjct: 33   MVKLTLGEPDFNTPEHVKAAAKKAIDDNYSHY-----TGMAGLLELRQAAAHFQETKYGV 87

Query: 712  KVSADD-VYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYD--- 879
               A+D V VT G T+AI TAL+ +  PG  I++P P FP Y       H +  + D   
Sbjct: 88   HYDAEDQVLVTVGATEAIATALTTICNPGDAIIIPSPIFPAYIPIIQEAHAKPLFMDTGV 147

Query: 880  ----LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
                + P+    VD + + +  D+N   +V+  P NP G  Y     + +A
Sbjct: 148  NDFVITPKM---VD-DFIAAHPDENFKGIVLNYPNNPTGVTYVEDEIKALA 194



>gb:AB121092_14964 Thermus thermophilus gene for aminotransferase,
            complete cds.>gb:AP008226_578397 Thermus thermophilus HB8
            genomic DNA, complete genome.
          Length = 381

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 51/165 (30%), Positives = 81/165 (49%), Gaps = 3/165 (1%)
 Frame = +1

Query: 535  ISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEK 714
            ++LG G P+       P    +AV   L   + + Y+P  GLP  R+A+A+  +      
Sbjct: 28   VNLGQGFPSN----PPPPFLLEAVRRALG--RQDQYAPPAGLPALREALAEEFA------ 75

Query: 715  VSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIY---ALCAAFRHLEVRYYDLL 885
            V  + V VT+G T+A+   L  L  PG  +++  P F +Y   A  A  +   VR  DL 
Sbjct: 76   VEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVR-LDLT 134

Query: 886  PEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            PE  + +DL+A+E      T A+++  P NP G V+  +  + IA
Sbjct: 135  PE-GFRLDLSALEKALTPRTRALLLNTPMNPTGLVFGERELEAIA 178



>pir|G75037|G75037 probable aromatic-amino-acid transaminase (EC
           2.6.1.57) PAB1523 [similarity] - Pyrococcus abyssi
           (strain Orsay)>gb:CNSPAX05_850048 Pyrococcus abyssi
           complete genome; segment 5/6.
          Length = 390

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 42/153 (27%), Positives = 68/153 (44%)
 Frame = +1

Query: 526 KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
           + VISLG+G+P     F +P   ++A    L    +  Y+P  G+ Q R+A+ +Y  +  
Sbjct: 32  ENVISLGIGEPD----FDTPKNIKEACKRALDE-GWTHYTPNAGIQQLREAVVEYYKKFY 86

Query: 706 PEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLL 885
              +  ++V +TAG  +    A   L   G  +L+P P F  Y   A     +     L 
Sbjct: 87  DVDIDVENVIITAGAYEGTYLAFESLLESGDEVLIPDPAFVSYVEDAKLAEAKPVRIPLR 146

Query: 886 PEKAWEVDLNAVESLADQNTIAVVIINPGNPCG 984
            E  +  D + +  L  + T  +VI  P NP G
Sbjct: 147 EENNFMPDPDELLELVTKKTRMIVINYPNNPTG 179



>gb:AY058868_1564404 Arabidopsis thaliana At1g23310/F26F24_4 mRNA,
            complete cds.>gb:BT002643_1636246 Arabidopsis thaliana
            At1g23310/F26F24_4 gene, complete cds.
          Length = 481

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 45/164 (27%), Positives = 83/164 (50%), Gaps = 7/164 (4%)
 Frame = +1

Query: 547  MGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEKVSAD 726
            + DP     F + A+A+     +L+S     YS + GLP  RK +A+++ R      + +
Sbjct: 72   LDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDGYPSNPE 131

Query: 727  DVYVTAGCTQAIETALS-ILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPEKAWE 903
             +++T G ++ +   L+ ++   G  IL+P P +P+Y+   +     +  Y L   + W 
Sbjct: 132  LIFLTDGASKGVMQILNCVIRGNGDGILVPVPQYPLYSATISLLGGTLVPYYLDESENWG 191

Query: 904  VDL-NAVESLADQNT-----IAVVIINPGNPCGNVYTYQHRQEI 1017
            +D+ N  +S+A   +      A+VIINPGNP G   +  + +EI
Sbjct: 192  LDVANLRQSVAQARSQGITVRAMVIINPGNPTGQCLSEANIREI 235



>gb:BA000016_674710 Clostridium perfringens str. 13 DNA, complete
            genome.
          Length = 397

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 40/163 (24%), Positives = 78/163 (47%)
 Frame = +1

Query: 532  VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
            V+S G+G+P     F++P    +A +  +   K   Y+ T G+ + ++AIA  L  D   
Sbjct: 32   VVSFGVGEPD----FNTPKNIIEAATRAMEEGKTK-YTATSGIVELKEAIARKLHDDNGL 86

Query: 712  KVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPE 891
                 ++ ++ G  Q++      +  PG  +++P P +  Y            + +   E
Sbjct: 87   NYGTKNIIISTGAKQSLANVFMAILNPGDEVIIPVPYWVSYPELVKLSDGVPVFIETKKE 146

Query: 892  KAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
              ++V  + ++S+  +NT A+VI +P NP G VY+ +  + IA
Sbjct: 147  NDFKVTYDELKSVLSENTKAIVINSPNNPTGTVYSKKDLEVIA 189



>gb:LILIVR_140513 Listeria ivanovii i-amA, lyrA, i-dapD & i-hipA
            genes, orf1, orfC, orfD & orfF.
          Length = 380

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 42/163 (25%), Positives = 71/163 (43%)
 Frame = +1

Query: 532  VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
            +I L +G+P   +  H    A QA+ D      F  Y+P  G+P+  +A + Y       
Sbjct: 29   MIRLTLGEPDFPTPEHVKQAAIQAIQDN-----FTNYTPNAGMPELLEAASTYFQEKYNL 83

Query: 712  KVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPE 891
            + + +++ VT G T+AI  AL  +  PG  ++LP P +P Y              D   E
Sbjct: 84   EYNTNEIIVTVGATEAISVALQTILEPGDEVILPDPIYPGYEPLITLNKAHPIRID-TTE 142

Query: 892  KAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
              +++    +       T A++I  P NP G   T +   ++A
Sbjct: 143  TNFKLTPTQLRKHITPKTKALIIPYPSNPTGVSLTKEELVDLA 185



>pir|T35706|T35706 probable aspartate transaminase (EC 2.6.1.1)
            SC7H1.11 [similarity] - Streptomyces
            coelicolor>gb:SCO939125_179611 Streptomyces coelicolor
            A3(2) complete genome; segment 22/29.
          Length = 382

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 48/160 (30%), Positives = 70/160 (43%)
 Frame = +1

Query: 535  ISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEK 714
            +SL MG+P   +    P + Q AVS     +    Y+   GL + R A+A  L       
Sbjct: 30   VSLAMGEPDFPT---PPTVVQAAVSALREGHTH--YADQRGLRELRAALAARLPERPGGA 84

Query: 715  VSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPEK 894
              ADDV VT G T A+   +     PG  +++P P + +YA         V +  L P+ 
Sbjct: 85   WDADDVLVTHGATAALAAVVLATVGPGDRVVVPEPAYSLYADLVVLAGGTVDFVPLAPDL 144

Query: 895  AWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQE 1014
             W++D  A    A      ++  NP NP G V    HR+E
Sbjct: 145  HWDLDALAA---ALPGAAMMIFSNPSNPTGIV----HRRE 177



>gb:AF360195_1791149 Arabidopsis thaliana putative alanine
            aminotransferase (At1g23310) mRNA, complete cds.
          Length = 481

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 45/164 (27%), Positives = 82/164 (50%), Gaps = 7/164 (4%)
 Frame = +1

Query: 547  MGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEKVSAD 726
            + DP     F + A+A+     +L+S     YS + GLP  RK +A+++ R        +
Sbjct: 72   LDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDGYPSDPE 131

Query: 727  DVYVTAGCTQAIETALS-ILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPEKAWE 903
             +++T G ++ +   L+ ++   G  IL+P P +P+Y+   +     +  Y L   + W 
Sbjct: 132  LIFLTDGASKGVMQILNCVIRGNGDGILVPVPQYPLYSATISLLGGTLVPYYLDESENWG 191

Query: 904  VDL-NAVESLADQNT-----IAVVIINPGNPCGNVYTYQHRQEI 1017
            +D+ N  +S+A   +      A+VIINPGNP G   +  + +EI
Sbjct: 192  LDVANLRQSVAQARSQGITVRAMVIINPGNPTGQCLSEANIREI 235



>gb:AX481975_1469522 Sequence 1 from Patent
           WO02055712.>gb:AY029173_1934459 Homo sapiens alanine
           aminotransferase 2 (GPT2) mRNA, complete
           cds.>gb:BC062555_1985924 Homo sapiens glutamic pyruvate
           transaminase (alanine aminotransferase) 2, mRNA (cDNA
           clone MGC:71171 IMAGE:6429257), complete cds.
          Length = 523

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 62/231 (26%), Positives = 101/231 (43%), Gaps = 20/231 (8%)
 Frame = +1

Query: 358 LLNLDSLNLSHFLQKIVIETEKKQTRGEIETPTNITIKG-ILGLLMANIEGSEGDDSKKV 534
           +L L+S+N      +  +        GEIE      IK     ++ ANI  ++    + +
Sbjct: 47  ILTLESMNPQVKAVEYAVRGPIVLKAGEIELELQRGIKKPFTEVIRANIGDAQAMGQQPI 106

Query: 535 ISLG--MGDPTAYSCFHSPALAQQA------VSDTLSSYKFNGYSPTVGLPQTRKAIADY 690
             L   M   T  +   SP+  + A      +           YS + G+   R+ +A Y
Sbjct: 107 TFLRQVMALCTYPNLLDSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAY 166

Query: 691 LSR-DLPEKVSADDVYVTAGCTQAIETALSILAYPGAN----ILLPRPGFPIY-ALCAAF 852
           ++R D       D++Y+T G +  I T L IL   G      +++P P +P+Y A+ +  
Sbjct: 167 ITRRDGGVPADPDNIYLTTGASDGISTILKILVSGGGKSRTGVMIPIPQYPLYSAVISEL 226

Query: 853 RHLEVRYYDLLPEKAWEVDLN----AVESLADQNTIAVV-IINPGNPCGNV 990
             ++V YY L  E  W +++N    AV+   D     V+ IINPGNP G V
Sbjct: 227 DAIQVNYY-LDEENCWALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQV 276



>gb:AX370365_1466386 Sequence 1 from Patent
           WO0208400.>gb:AX370367_1466387 Sequence 3 from Patent
           WO0208400.
          Length = 523

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 62/231 (26%), Positives = 101/231 (43%), Gaps = 20/231 (8%)
 Frame = +1

Query: 358 LLNLDSLNLSHFLQKIVIETEKKQTRGEIETPTNITIKG-ILGLLMANIEGSEGDDSKKV 534
           +L L+S+N      +  +        GEIE      IK     ++ ANI  ++    + +
Sbjct: 47  ILTLESMNPQVKAVEYAVRGPIVLKAGEIELELQRGIKKPFTEVIRANIGDAQAMGQQPI 106

Query: 535 ISLG--MGDPTAYSCFHSPALAQQA------VSDTLSSYKFNGYSPTVGLPQTRKAIADY 690
             L   M   T  +   SP+  + A      +           YS + G+   R+ +A Y
Sbjct: 107 TFLRQVMALCTYPNLLDSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAY 166

Query: 691 LSR-DLPEKVSADDVYVTAGCTQAIETALSILAYPGAN----ILLPRPGFPIY-ALCAAF 852
           ++R D       D++Y+T G +  I T L IL   G      +++P P +P+Y A+ +  
Sbjct: 167 ITRRDGGVPADPDNIYLTTGASDGISTILKILVSGGGKSRTGVMIPIPQYPLYSAVISEL 226

Query: 853 RHLEVRYYDLLPEKAWEVDLN----AVESLADQNTIAVV-IINPGNPCGNV 990
             ++V YY L  E  W +++N    AV+   D     V+ IINPGNP G V
Sbjct: 227 DAIQVNYY-LDEENCWALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQV 276



>gb:BA000013_672805 Mesorhizobium loti MAFF303099 pMLa DNA, cpmplete
           genome.
          Length = 415

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 34/120 (28%), Positives = 60/120 (50%)
 Frame = +1

Query: 634 NGYSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLP 813
           N Y+  +GL   RKA+A+ L+       + +D+ +TAG  QA+  A   +  PG  +++ 
Sbjct: 63  NRYTDAIGLTLLRKAVAEKLAAQTHVGWNLEDIVITAGAKQALLNAALAVLDPGDEVIII 122

Query: 814 RPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVY 993
           RP +P +A        +  + D  P   +  ++ AV     Q T A+++ +P NP G +Y
Sbjct: 123 RPSWPTFASQILLAGAKPVFVDSRP-STYIPNIGAVRDALTQRTKAIIVNSPNNPTGIIY 181



>pir|F95179|F95179 aspartate aminotransferase [imported] -
           Streptococcus pneumoniae (strain
           TIGR4)>gb:AE007449_226692 Streptococcus pneumoniae TIGR4
           section 132 of 194 of the complete
           genome.>gb:AE005672_1104460 Streptococcus pneumoniae
           TIGR4, complete genome.
          Length = 395

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 37/159 (23%), Positives = 73/159 (45%)
 Frame = +1

Query: 520 DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSR 699
           + + ++SL +G+P     F +P   Q A   ++   + + Y+ T GLP+ + A+  Y  R
Sbjct: 28  EGRDILSLTLGEPD----FTTPKNIQDAAIASIRDGRASFYTVTSGLPELKAAVNSYFER 83

Query: 700 DLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYD 879
                V+++ V V AG   ++ T    +  PG  +++P P +  Y            +  
Sbjct: 84  FYGYSVASNQVTVAAGAKYSLYTFFMAVVNPGDEVIIPTPYWVSYGDQVKMAEGVPVFVS 143

Query: 880 LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYT 996
              +  ++V +  +E+     T  +V+ +P NP G +YT
Sbjct: 144 AKEDNHFKVTVEQLEAARTDKTKVLVLNSPSNPTGMIYT 182



>pir|B86367|B86367 protein F26F24.16 [imported] - Arabidopsis
            thaliana>gb:AE005172_891282 Arabidopsis thaliana
            chromosome 1, top arm complete
            sequence.>gb:AC005292_1532425 Genomic sequence for
            Arabidopsis thaliana BAC F26F24 from chromosome I,
            complete sequence.>gb:AY056379_1563687 Arabidopsis
            thaliana At1g23310/F26F24_4 mRNA, complete
            cds.>gb:AY150373_1584938 Arabidopsis thaliana putative
            alanine aminotransferase (At1g23310) mRNA, complete
            cds.>gb:AF479639_1803541 Arabidopsis thaliana
            glutamate:glyoxylate aminotransferase 1 (GGT1) mRNA,
            complete cds.
          Length = 481

 Score = 61.2 bits (147), Expect = 3e-08
 Identities = 45/164 (27%), Positives = 82/164 (50%), Gaps = 7/164 (4%)
 Frame = +1

Query: 547  MGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEKVSAD 726
            + DP     F + A+A+     +L+S     YS + GLP  RK +A+++ R        +
Sbjct: 72   LDDPNVGMLFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIQRRDGYPSDPE 131

Query: 727  DVYVTAGCTQAIETALS-ILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPEKAWE 903
             +++T G ++ +   L+ ++   G  IL+P P +P+Y+   +     +  Y L   + W 
Sbjct: 132  LIFLTDGASKGVMQILNCVIRGNGDGILVPVPQYPLYSATISLLGGTLVPYYLDESENWG 191

Query: 904  VDL-NAVESLADQNT-----IAVVIINPGNPCGNVYTYQHRQEI 1017
            +D+ N  +S+A   +      A+VIINPGNP G   +  + +EI
Sbjct: 192  LDVANLRQSVAQARSQGITVRAMVIINPGNPTGQCLSEANIREI 235



>gb:AY206503_2518587 Sparus aurata mitochondrial alanine
            aminotransferase mRNA, complete cds.
          Length = 554

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 43/137 (31%), Positives = 70/137 (51%), Gaps = 11/137 (8%)
 Frame = +1

Query: 640  YSPTVGLPQTRKAIADYLSR-DLPEKVSADDVYVTAGCTQAIETALSILAY-PGAN---I 804
            YS + G+   R  +A Y  R D       D++Y+T G +  I T L +L    GA    I
Sbjct: 181  YSASQGIDSVRHDVARYTERRDGGVPCDPDNIYLTTGASDGIVTMLKLLVCGEGATRTGI 240

Query: 805  LLPRPGFPIY-ALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQ-----NTIAVVIIN 966
            ++  P +P+Y A  A    +++ YY L  +K W +D++ ++   D+     N  A+ IIN
Sbjct: 241  MISIPQYPLYSAALAELGAVQINYY-LNEQKCWSLDISELQRSLDEARQHCNPRALCIIN 299

Query: 967  PGNPCGNVYTYQHRQEI 1017
            PGNP G V + Q  +++
Sbjct: 300  PGNPTGQVQSRQCIEDV 316



>gb:BA000012_668270 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 394

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 42/155 (27%), Positives = 67/155 (43%)
 Frame = +1

Query: 526 KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
           + +++LG+G P   +  H    A +A+ D       +GY+P  GL  TR+A+        
Sbjct: 31  RDIVNLGIGQPDFKTPQHIVEAAIKALRDG-----HHGYTPANGLLATREAVVRRTLTTT 85

Query: 706 PEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLL 885
             +VS + V +  G    +  A+ +   PGA IL P PGFPIY     F         + 
Sbjct: 86  GVEVSPEAVMILPGGKPTMFAAILMFGEPGAEILYPDPGFPIYRSMIEFTGAAPIPVPMR 145

Query: 886 PEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNV 990
            E  +        +L    T  +++ +P NP G V
Sbjct: 146 EENGFAFSAEETLALITSKTRLLILNSPANPTGGV 180



>gb:AP006841_571121 Bacteroides fragilis YCH46 DNA, complete genome.
          Length = 397

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 41/163 (25%), Positives = 77/163 (47%)
 Frame = +1

Query: 532  VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
            VI+L +G+P   +  H    A++AV D      F+ YSP  G P  R AI + L ++   
Sbjct: 33   VINLSVGEPDFNTPDHIKEAAKKAVDDN-----FSRYSPVPGYPALRNAIVEKLKKENGL 87

Query: 712  KVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPE 891
            + +A  +    G  Q++   + +L  PG  +++P P +  Y                  E
Sbjct: 88   EYTAAQISCANGAKQSVCNTIMVLVNPGDEVIVPAPYWVSYPEMVKLAEGTPVIVTAGIE 147

Query: 892  KAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            + +++    +E+     T A+++ +P NP G+VY+   ++E+A
Sbjct: 148  QDFKITPAQLEAAITPKTKALILCSPSNPTGSVYS---KEELA 187



>gb:AP006618_557020 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 392

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 46/156 (29%), Positives = 75/156 (48%), Gaps = 2/156 (1%)
 Frame = +1

Query: 529 KVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLP 708
           + ++LG G P          +A++A++D +     N Y P  G+P  R+AIA   +R   
Sbjct: 30  EAVNLGQGFPDTDGPAGMLEVARRAIADGV-----NQYPPGRGMPVLRRAIAADRARRYG 84

Query: 709 EKVSAD-DVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLL 885
            +   D +V VT G T+AI  AL  L  PG  ++L  P +  YA   A      R   L+
Sbjct: 85  TEYDPDTEVLVTVGATEAISAALLGLVEPGQEVVLIEPYYDSYAAAVALAGAHRRTAHLV 144

Query: 886 PE-KAWEVDLNAVESLADQNTIAVVIINPGNPCGNV 990
            +   + +DL+++ +     T  +V+ +P NP G V
Sbjct: 145 ADGDRFVLDLDSLRAAVTPRTRMLVVNSPHNPTGTV 180



>gb:AE010808_266737 Methanosarcina acetivorans str. C2A, section 153
           of 534 of the complete genome.>gb:AE010299_907296
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 370

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 42/152 (27%), Positives = 73/152 (48%)
 Frame = +1

Query: 535 ISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEK 714
           I+LG+G P   +  H    A +A+++      F GY+   G+P+ R+A++     +    
Sbjct: 30  INLGLGQPDFDTPVHIKTAAIEAINEG-----FTGYTVGPGIPELREALSQKFLEENGFS 84

Query: 715 VSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPEK 894
           VS  ++ VT+G ++A+  AL+ L   G  +L+  PGF  Y       + +V    L  + 
Sbjct: 85  VSPQEIIVTSGASEALTIALAALLNVGDEVLISNPGFVSYNALTEILNGKVVSVPLAEDL 144

Query: 895 AWEVDLNAVESLADQNTIAVVIINPGNPCGNV 990
             + D  AV       T A+++ +P NP G V
Sbjct: 145 TMKPD--AVLERITPKTKALILNSPSNPTGAV 174



>sp|O14209|YDT4_SCHPO Hypothetical aminotransferase C6B12.04c (EC
            2.6.1.-).>pir|T39011|T39011 kynurenine-oxoglutarate
            transaminase (EC 2.6.1.7) / glutamine-phenylpyruvate
            transaminase (EC 2.6.1.64) SPAC6B12.04c [similarity] -
            fission yeast  (Schizosaccharomyces
            pombe)>gb:SPAC6B12_1718232 S.pombe chromosome I cosmid
            c6B12.
          Length = 421

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 38/160 (23%), Positives = 69/160 (43%), Gaps = 11/160 (6%)
 Frame = +1

Query: 574  FHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEKVSAD-DVYVTAGC 750
            ++ P     A   ++     N YS T G P  RKA+++  S      ++ D ++ VTAG 
Sbjct: 44   YNPPKFVLDAAKKSIDEVACNQYSHTRGRPSLRKALSEAYSPYFKRTLNPDTEIVVTAGA 103

Query: 751  TQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPEK----------AW 900
             +   +  +    PG  +++  P F  Y            Y  ++P +          AW
Sbjct: 104  NEGFFSVFAAFLNPGDEVIVMEPFFDQYISNITMNGGVPVYVPIIPPEEGSVKPVSAGAW 163

Query: 901  EVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            ++D+N + +   + T  +VI  P NP G +++ +   EIA
Sbjct: 164  KLDMNKLRNAITEKTKMIVINTPHNPLGKIFSEEELNEIA 203



>gb:BA000030_702404 Streptomyces avermitilis MA-4680 genomic DNA,
            complete genome.
          Length = 398

 Score = 60.5 bits (145), Expect = 5e-08
 Identities = 49/170 (28%), Positives = 71/170 (41%), Gaps = 4/170 (2%)
 Frame = +1

Query: 523  SKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRD 702
            S   I+LG G P        P   ++A    L   + N Y P  G+P+ R AIA +  R 
Sbjct: 33   STGAINLGQGFPDT----DGPEEIREAAVRALRDGRGNQYPPGPGVPELRTAIAAHQQRR 88

Query: 703  LPEKVSAD-DVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAF---RHLEVR 870
                   D +V VTAG T+AI   L  L  PG  ++   P +  YA C A      + V 
Sbjct: 89   YGLTYDPDTEVLVTAGATEAIAATLLALLEPGDEVIAFEPYYDSYAACIAMAGGTRVPVT 148

Query: 871  YYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
                  +  + +DL+ +       T  +++  P NP G V T +    IA
Sbjct: 149  LRPHPEDGRFRLDLDELRDAVTDRTRLLLVNTPHNPTGTVLTREELTAIA 198



>gb:AE017229_411493 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 3 of 16 of the complete
           genome.>gb:AE016958_1054897 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 393

 Score = 60.5 bits (145), Expect = 5e-08
 Identities = 45/154 (29%), Positives = 73/154 (47%), Gaps = 2/154 (1%)
 Frame = +1

Query: 535 ISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEK 714
           ++LG G P           AQ+A++D +     N Y P +G+   R AIA    R    +
Sbjct: 27  VNLGQGFPDEDGPAEMLKAAQEAIADGV-----NQYPPGIGIAPLRHAIAAQRHRRYGIE 81

Query: 715 VSAD-DVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPE 891
              D +V VT G T+AI +A+  L  PG+ +LL  P +  Y+   A    +     L+P 
Sbjct: 82  YDPDTEVLVTVGATEAIASAVIGLVEPGSEVLLIEPFYDSYSPVIAMASAQRVAVPLVPH 141

Query: 892 -KAWEVDLNAVESLADQNTIAVVIINPGNPCGNV 990
            + + +D +A+       T A+++ +P NP G V
Sbjct: 142 GRGFALDADALRRAVTPRTRALIVNSPHNPTGTV 175



>gb:AE017037_384188 Bacillus anthracis str. Ames section 14 of 18 of
            the complete genome.>gb:AE017225_409295 Bacillus
            anthracis str. Sterne, complete
            genome.>gb:AE017334_454035 Bacillus anthracis str. 'Ames
            Ancestor', complete genome.>gb:AE016879_1013893 Bacillus
            anthracis str. Ames complete genome.
          Length = 387

 Score = 60.5 bits (145), Expect = 5e-08
 Identities = 47/169 (27%), Positives = 82/169 (48%), Gaps = 6/169 (3%)
 Frame = +1

Query: 532  VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
            +ISL +G     S F +P+L ++A    ++   +  Y+   GL + RKA  +++  +   
Sbjct: 30   LISLTIGQ----SDFPTPSLVKEAAKRAITE-NYTSYTHNAGLLELRKAACNFVKDNYDL 84

Query: 712  KVSAD-DVYVTAGCTQAIETALSILAYPGANILLPRPGF----PIYALCAAFR-HLEVRY 873
              S + +  VT G ++AI+ A   +  PG  ++LP P +    PI  LC A    ++VR 
Sbjct: 85   HYSPETETIVTIGASEAIDVAFRTILEPGTEVILPAPIYPGYEPIIRLCGATPIFIDVR- 143

Query: 874  YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
                 E  + +   A+E+   + T  VV+  P NP G   + +  Q+IA
Sbjct: 144  -----ETGFRLTAEALENAITEKTRCVVLPYPSNPTGVTLSKKELQDIA 187



>gb:CP000027_79735 Dehalococcoides ethenogenes 195, complete genome.
          Length = 388

 Score = 60.5 bits (145), Expect = 5e-08
 Identities = 47/156 (30%), Positives = 70/156 (44%), Gaps = 1/156 (0%)
 Frame = +1

Query: 526 KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
           ++VIS  +GDP   +  H  A   +A  D  +    + Y  T GLP  RKA+A++  +  
Sbjct: 30  EEVISFAIGDPDLPTPKHILAELCKAAEDPAN----HRYPETEGLPVLRKAMAEWYEKRF 85

Query: 706 PEKVSAD-DVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDL 882
             K++ D +V    G  + I  A      PG   L+P P +P+YA+ +     EV Y  L
Sbjct: 86  GVKLNPDTEVLPLIGSKEGIGHAAWCFLDPGDVALVPDPAYPVYAISSQLAGAEVFYMPL 145

Query: 883 LPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNV 990
             E  +  D NA+          + I  P NP G V
Sbjct: 146 NKENNFLPDFNAIPQDVLSKAKILWINYPNNPTGAV 181



>pir|G72655|G72655 aspartate transaminase (EC 2.6.1.1) APE0674
            [similarity] - Aeropyrum pernix (strain
            K1)>gb:BA000002_651391 Aeropyrum pernix K1 DNA, complete
            genome.
          Length = 405

 Score = 60.5 bits (145), Expect = 5e-08
 Identities = 43/170 (25%), Positives = 78/170 (45%), Gaps = 3/170 (1%)
 Frame = +1

Query: 520  DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFN---GYSPTVGLPQTRKAIADY 690
            + + VI L  G P     F  P   ++ ++  L    F     Y+PT G    R+AIA+ 
Sbjct: 34   EGRDVILLSTGQPG----FLPPTFLRERLAQALLDEGFKRLYSYTPTPGYADVREAIAED 89

Query: 691  LSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVR 870
            L+     ++  DD+ VTAG  +A+   LS +  PG  ++L  P +  Y     +    V 
Sbjct: 90   LAALGGPRMEPDDILVTAGGQEAMFATLSTILEPGDKVILMDPTYFGYRPIVEYLGGRVE 149

Query: 871  YYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            +    P   ++ D   ++    ++  AVV+++P NP G + + +  + +A
Sbjct: 150  WVRAPPSLGFQPDEERLKEAFTRDVKAVVLVSPDNPTGRLLSTESAKLVA 199



>pir|C84268|C84268 aspartate aminotransferase [imported] -
           Halobacterium sp. NRC-1>gb:AE005042_62671 Halobacterium
           sp. NRC-1 section 73 of 170 of the complete
           genome.>gb:AE004437_887590 Halobacterium sp. NRC-1
           complete genome.
          Length = 391

 Score = 60.5 bits (145), Expect = 5e-08
 Identities = 43/157 (27%), Positives = 74/157 (47%)
 Frame = +1

Query: 520 DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSR 699
           D   VI + +G+P     F  PA A +A  D L +   + Y+ + G    R AI+ Y + 
Sbjct: 32  DRADVIHMEVGEPD----FAPPAAATEAAVDALRAGD-DDYTTSRGRRSLRDAISGYYAA 86

Query: 700 DLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYD 879
           +    V A+ + VT G + A+ T L     PG+ ++L  P +  Y          VR   
Sbjct: 87  EYGVSVPAERIVVTPGSSPALLTVLLATVDPGSAVVLSDPHYACYPNFVRLADGVVRTVG 146

Query: 880 LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNV 990
           L P+  ++  ++  ++    +T A+++ +PGNP G V
Sbjct: 147 LAPDAGFQPAVSDYDAAIGDDTAAMLLNSPGNPTGAV 183



>pir|H96729|H96729 probable alanine aminotransferase F5A18.24 -
            Arabidopsis thaliana>gb:AE005173_894642 Arabidopsis
            thaliana chromosome 1, bottom arm complete
            sequence.>gb:AC010796_1537117 Arabidopsis thaliana
            chromosome 1 BAC F24J13 genomic sequence, complete
            sequence.>gb:AC011663_1537330 Arabidopsis thaliana
            chromosome 1 BAC F5A18 genomic sequence, complete
            sequence.>gb:AY035130_1559900 Arabidopsis thaliana
            putative alanine aminotransferase (At1g70580) mRNA,
            complete cds.>gb:AY062982_1565570 Arabidopsis thaliana
            putative alanine aminotransferase (At1g70580) mRNA,
            complete cds.>gb:AF479640_1803542 Arabidopsis thaliana
            glutamate:glyoxylate aminotransferase 2 (GGT2) mRNA,
            complete cds.
          Length = 481

 Score = 60.5 bits (145), Expect = 5e-08
 Identities = 43/164 (26%), Positives = 78/164 (47%), Gaps = 7/164 (4%)
 Frame = +1

Query: 547  MGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEKVSAD 726
            + DP     F + A+A+     +L+S     YS + GLP  RK +A+++ R        +
Sbjct: 72   LDDPNVGMIFPADAIARAKHYLSLTSGGLGAYSDSRGLPGVRKEVAEFIERRDGYPSDPE 131

Query: 727  DVYVTAGCTQAIETALS-ILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPEKAWE 903
             +++T G ++ +   L+ ++      IL+P P +P+Y+   +     +  Y L   + W 
Sbjct: 132  LIFLTDGASKGVMQILNCVIRGQKDGILVPVPQYPLYSATISLLGGTLVPYYLEESENWG 191

Query: 904  VDLNAVESLADQ------NTIAVVIINPGNPCGNVYTYQHRQEI 1017
            +D+N +     Q         A+VIINPGNP G   +  + +EI
Sbjct: 192  LDVNNLRQSVAQARSQGITVRAMVIINPGNPTGQCLSEANIREI 235



>gb:AK094971_1914277 Homo sapiens cDNA FLJ37652 fis, clone
           BRHIP2009685, moderately similar to ALANINE
           AMINOTRANSFERASE (EC 2.6.1.2).
          Length = 423

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 43/128 (33%), Positives = 67/128 (52%), Gaps = 11/128 (8%)
 Frame = +1

Query: 640 YSPTVGLPQTRKAIADYLSR-DLPEKVSADDVYVTAGCTQAIETALSILAYPGAN----I 804
           YS + G+   R+ +A Y++R D       D++Y+T G +  I T L IL   G      +
Sbjct: 50  YSASQGVNCIREDVAAYITRRDGGVPADPDNIYLTTGASDGISTILKILVSGGGKSRTGV 109

Query: 805 LLPRPGFPIY-ALCAAFRHLEVRYYDLLPEKAWEVDLN----AVESLADQNTIAVV-IIN 966
           ++P P +P+Y A+ +    ++V YY L  E  W +++N    AV+   D     V+ IIN
Sbjct: 110 MIPIPQYPLYSAVISELDAIQVNYY-LDEENCWALNVNELRRAVQEAKDHCDPKVLCIIN 168

Query: 967 PGNPCGNV 990
           PGNP G V
Sbjct: 169 PGNPTGQV 176



>gb:BA000043_737612 Geobacillus kaustophilus HTA426 DNA, complete
            genome.
          Length = 385

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 40/167 (23%), Positives = 73/167 (43%)
 Frame = +1

Query: 520  DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSR 699
            D   ++SL +G P   +  H  A AQ+A++   ++Y  N      GL + R+A   +++ 
Sbjct: 26   DRPGLVSLTIGQPDFPTPDHVKAAAQEAIAADFTTYTANA-----GLLELRQAACQFVAD 80

Query: 700  DLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYD 879
                + + D+V  T G +QA++     +   G  +LLP P +P Y         +  Y D
Sbjct: 81   KYGLRYTPDEVIATVGASQALDITFRTILEEGTEVLLPAPVYPGYEPLIRLCGAKPVYID 140

Query: 880  LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
              P   + +    +     + T  +V+  P NP G   + +  + IA
Sbjct: 141  TRP-NGFRLSAELIAPYLTEKTRCLVLPYPSNPTGTALSAEELENIA 186



>gb:AE017333_448214 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_858025 Bacillus licheniformis ATCC
           14580, complete genome.>gb:AX954741_1484261 Sequence 207
           from Patent WO03093453.
          Length = 394

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 41/155 (26%), Positives = 72/155 (46%)
 Frame = +1

Query: 532 VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
           VI LG G+P     F++P    +A   +++      Y+P+ GL   + +I D   RD   
Sbjct: 32  VIGLGAGEPD----FNTPEHIIEAAVRSMNE-GHTKYTPSGGLAALKDSIRDKFKRDQGI 86

Query: 712 KVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPE 891
           + S  +V V  G   A+ T   +L   G  +++P P +  Y         +  + + L E
Sbjct: 87  EYSQSEVIVCTGAKHALYTLFQVLLDEGDEVIIPTPYWVSYPEQVKLAGGKPVFVEGLEE 146

Query: 892 KAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYT 996
            ++++    +E    + T AV+I +P NP G +YT
Sbjct: 147 NSFKISPEQLEKAVTEKTKAVIINSPSNPTGMMYT 181



>gb:AE017277_425261 Bacillus cereus ATCC 10987, section 14 of 18 of
            the complete genome.>gb:AE017194_1063680 Bacillus cereus
            ATCC 10987, complete genome.
          Length = 387

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 47/172 (27%), Positives = 84/172 (48%), Gaps = 10/172 (5%)
 Frame = +1

Query: 532  VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRD--- 702
            +ISL +G P     F +P+L ++A    ++   +  Y+   GL + RKA  +++  +   
Sbjct: 30   LISLTIGQPD----FPTPSLVKEAAKRAITE-NYTSYTHNAGLLELRKAACNFVKDNYDL 84

Query: 703  --LPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGF----PIYALCAAFR-HL 861
              LPE    ++  VT G ++AI+ A   +  PG  ++LP P +    PI  LC A    +
Sbjct: 85   HYLPE----NETIVTIGASEAIDVAFRTILEPGTEVILPAPIYPGYEPIIRLCGATPVFI 140

Query: 862  EVRYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            +VR      E  + +  +A+++   + T  VV+  P NP G   + +  Q+I
Sbjct: 141  DVR------ETGFRLTADALKNAITEKTRCVVLPYPSNPTGVTLSKEELQDI 186



>gb:AE016941_363086 Bacteroides thetaiotaomicron VPI-5482, section
           16 of 21 of the complete genome.>gb:AE015928_989574
           Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 383

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 47/187 (25%), Positives = 80/187 (42%)
 Frame = +1

Query: 424 KQTRGEIETPTNITIKGILGLLMANIEGSEGDDSKKVISLGMGDPTAYSCFHSPALAQQA 603
           K T  ++E  T+  +  +L    AN    +G D   VI L +G+P     F  PA   +A
Sbjct: 2   KHTNPQVEQMTSFIVMDVLE--RANELQKQGVD---VIHLEVGEPD----FDVPACVAEA 52

Query: 604 VSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSIL 783
                  +    Y+ ++G P+ R+ IA +  R+    V  D + VT+G + +I   L +L
Sbjct: 53  AKAAYDRH-LTHYTHSLGDPELRREIAAFYQREYGVTVDPDCIVVTSGSSPSILLVLMLL 111

Query: 784 AYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIAVVII 963
               + ++L  PG+  Y         +     L  E   + D+ A+      +T  + I 
Sbjct: 112 CNSDSEVILSNPGYACYRNFVLAAQAKPVLVPLSEENGLQYDIEAIRKCVTPHTAGIFIN 171

Query: 964 NPGNPCG 984
           +P NP G
Sbjct: 172 SPMNPTG 178



>gb:AE016859_350416 Pseudomonas syringae pv. tomato str. DC3000
            section 4 of 21 of the complete
            genome.>gb:AE016853_1035591 Pseudomonas syringae pv.
            tomato str. DC3000 complete genome.
          Length = 390

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 49/179 (27%), Positives = 83/179 (46%)
 Frame = +1

Query: 484  LLMANIEGSEGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLP 663
            L  AN   + G D   VI L +G+P   +        Q A++D  + Y     +   GLP
Sbjct: 21   LARANELQAAGHD---VIHLEIGEPDFITAEPIIKAGQAALADGKTRY-----TAARGLP 72

Query: 664  QTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALC 843
            Q R+AIA + ++     +    + VT G + A+  A S+L  PG + LL  PG+P     
Sbjct: 73   QLREAIAGFYAQRYQLDIDPQRILVTPGGSGALLLASSLLVDPGKHWLLADPGYPCNRHF 132

Query: 844  AAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
                  E +   + P++ +++    V S  + N++  ++ +P NP G + T   R E+A
Sbjct: 133  LRLIEGEAQLVPVGPQERYQLTPELVASHWNPNSVGALVASPANPTGTLLT---RDELA 188



>pir|AD1558|AD1558 aminotransferases (to B. subtilis PatA protein)
            homolog lin1005 [imported] - Listeria innocua (strain
            Clip11262)>gb:AL596167_538350 Listeria innocua Clip11262
            complete genome, segment 5/12.
          Length = 381

 Score = 60.1 bits (144), Expect = 7e-08
 Identities = 42/163 (25%), Positives = 71/163 (43%)
 Frame = +1

Query: 532  VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
            +I L +G+P     F +P   +QA    +    F  Y+P  G+P+  +A + Y       
Sbjct: 30   MIRLTLGEPD----FPTPEHVKQAAITAIQE-NFTNYTPNAGMPELLEAASSYFEEKYDL 84

Query: 712  KVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPE 891
              S  ++ VT G T+AI  AL  +  PG  ++LP P +P Y              D   E
Sbjct: 85   TYSNKEIIVTVGATEAISVALQTILEPGDEVILPDPIYPGYEPLIKLNKARPVKVD-TTE 143

Query: 892  KAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
              +++    + +     T A++I  P NP G   + Q  +++A
Sbjct: 144  SNFKLTPEQLRAHITPKTKALIIPYPSNPTGVSLSKQELRDLA 186



>gb:SAG766846_170098 Streptococcus agalactiae NEM316 complete genome,
            segment 4.>gb:AE014216_305860 Streptococcus agalactiae
            2603V/R section 26 of 100 of the complete
            genome.>gb:AE009948_935973 Streptococcus agalactiae
            2603V/R complete genome.
          Length = 397

 Score = 59.7 bits (143), Expect = 9e-08
 Identities = 37/164 (22%), Positives = 75/164 (45%)
 Frame = +1

Query: 526  KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
            + ++SL +G+P     F +P   QQA  + ++  + + Y+P+ GLP+ + AI  Y  R  
Sbjct: 31   RDILSLTLGEPD----FATPKNIQQAAIEAITDGRASFYTPSSGLPELKSAINAYFERFY 86

Query: 706  PEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLL 885
               +  + V V  G    + T    +  PG  +++P P +  YA        +  +    
Sbjct: 87   GYSLKPNQVVVGTGAKFILYTFFMTVLNPGDEVIIPTPYWVSYADQIKMAEGKPVFVTAK 146

Query: 886  PEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
                ++V +  +E++    T  +++ +P NP G +Y  +  + I
Sbjct: 147  EVNHFKVTVEQLEAVRTDKTKVILLNSPSNPTGMIYKAEELEAI 190



>pir|F98046|F98046 aspartate transaminase (EC 2.6.1.1) [imported] -
           Streptococcus pneumoniae (strain R6)>gb:AE008509_237719
           Streptococcus pneumoniae R6 section 125 of 184 of the
           complete genome.>gb:AE007317_943877 Streptococcus
           pneumoniae R6, complete genome.
          Length = 395

 Score = 59.7 bits (143), Expect = 9e-08
 Identities = 36/159 (22%), Positives = 72/159 (45%)
 Frame = +1

Query: 520 DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSR 699
           + + ++SL +G+P     F +P   Q A   ++   + + Y+ T GLP+ +  +  Y  R
Sbjct: 28  EGRDILSLTLGEPD----FTTPKNIQDAAIASIRDGRASFYTVTSGLPELKAVVNSYFER 83

Query: 700 DLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYD 879
                V+++ V V AG   ++ T    +  PG  +++P P +  Y            +  
Sbjct: 84  FYGYSVASNQVTVAAGAKYSLYTFFMAVVNPGDEVIIPTPYWVSYGDQVKMAEGVPVFVS 143

Query: 880 LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYT 996
              +  ++V +  +E+     T  +V+ +P NP G +YT
Sbjct: 144 AKEDNHFKVTVEQLEAARTDKTKVLVLNSPSNPTGMIYT 182



>gb:AE013479_292698 Methanosarcina mazei strain Goe1, section 261 of
           379 of the complete genome.>gb:AE008384_966807
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 399

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 41/152 (26%), Positives = 77/152 (50%)
 Frame = +1

Query: 535 ISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEK 714
           I+LG+G P   +  H  A A +A+++      F GY+   G+P+ R+A++     +    
Sbjct: 59  INLGLGQPDFDTPDHIKAAAIKAINEG-----FTGYTAGPGIPELREALSQKFKEENCFS 113

Query: 715 VSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPEK 894
           VS  ++ VT+G ++A+  AL+ L   G  +L+  PGF  Y       + +V    L  + 
Sbjct: 114 VSPQEIIVTSGASEALTIALTALLNRGDEVLISNPGFVSYNALTEMLYGKVVNVPLGEDL 173

Query: 895 AWEVDLNAVESLADQNTIAVVIINPGNPCGNV 990
             + + + +E +  + T A+++ +P NP G V
Sbjct: 174 TMKPE-DVLERITPK-TKAIILNSPSNPTGAV 203



>gb:RSTAT5_2138368 Rat TAT gene for tyrosine aminotransferase (EC
            2.6.1.5).
          Length = 196

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 23/44 (52%), Positives = 34/44 (77%)
 Frame = +1

Query: 886  PEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
            PEK+WE+DL  +ESL D+ T  +V+ NP NPCG+V++ +H Q+I
Sbjct: 1    PEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKI 44



>gb:CR382130_1662559 Yarrowia lipolytica chromosome D of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 496

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 34/120 (28%), Positives = 60/120 (50%), Gaps = 5/120 (4%)
 Frame = +1

Query: 640 YSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGAN--ILLP 813
           YS + G+   R ++A+++ +      SA D+Y+T G + A+   L+ LA    +   ++P
Sbjct: 131 YSSSQGVTTVRNSVANFIQKRDGYAASASDIYLTTGASNAVTFLLTTLARGDGSDGFMIP 190

Query: 814 RPGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTI---AVVIINPGNPCG 984
            P +P+Y      ++     Y L   K W  ++ A+    + +     AVV+INPGNP G
Sbjct: 191 IPQYPLYTATLTLQNSNPVPYYLDEAKEWGTNMAALNDAVESSKHKLKAVVVINPGNPTG 250



>gb:BA000016_674947 Clostridium perfringens str. 13 DNA, complete
            genome.
          Length = 380

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 43/185 (23%), Positives = 87/185 (47%), Gaps = 2/185 (1%)
 Frame = +1

Query: 469  KGILGLLMANIEGSEGDDSK--KVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGY 642
            K ++G+ ++ I     +  K  + ISL +G P     F  P   ++A+   +   K   Y
Sbjct: 3    KNVIGIEISGIRKFYNEVVKFPEAISLTLGQPD----FPVPEKVKEAMIRAIEEGKTT-Y 57

Query: 643  SPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPG 822
            +   G+ + R+ I+  L  +     S D++ +T G ++ +  A++ L  PG  +L+P   
Sbjct: 58   TANAGIVELREEISSLLKNNFDIDFSKDEIIITVGGSEGLYAAMTALLNPGEKVLVPSIA 117

Query: 823  FPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQ 1002
            +P Y   +     EV  YDL   + + V++ +++    +    +V+  P NP G + + +
Sbjct: 118  YPAYESISKIIGCEVINYDL--NEDFSVNIESLKEGIKEGGKLLVLSYPCNPTGALLSKK 175

Query: 1003 HRQEI 1017
             R E+
Sbjct: 176  SRDEL 180



>gb:BA000012_670543 Mesorhizobium loti MAFF303099 DNA, complete
            genome.
          Length = 396

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 40/134 (29%), Positives = 64/134 (47%), Gaps = 5/134 (3%)
 Frame = +1

Query: 634  NGYSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLP 813
            N Y+ TVG+ + R+A+A  +S D  +   A++V VT+G  QA+  A  +L  PG  +++P
Sbjct: 60   NRYTDTVGMVELREALARKISLDTGQIWKAEEVAVTSGAKQALFNAAMVLLNPGDEVIIP 119

Query: 814  RP---GFPIYALCAAFR--HLEVRYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNP 978
             P    FP   L A      ++ R    +P          ++    + T A+V+  P NP
Sbjct: 120  APYWTTFPAQVLIAGGTPVFVDTRSNGYVPRP------EHIKEAVTERTRAIVVNTPSNP 173

Query: 979  CGNVYTYQHRQEIA 1020
             G VY  +    IA
Sbjct: 174  AGAVYDVETLMAIA 187



>gb:AL935254_550794 Lactobacillus plantarum strain WCFS1 complete
            genome; segment 3/11.
          Length = 543

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 48/180 (26%), Positives = 86/180 (47%), Gaps = 3/180 (1%)
 Frame = +1

Query: 490  MANIEGSEGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQT 669
            +ANI G        ++ L +G+P     F++P   +QA  +++ + + + Y+P+ G    
Sbjct: 31   IANIPG--------IVRLTLGEPD----FNTPEHVKQAAIESIEADESH-YAPSNGTLAL 77

Query: 670  RKAIADYLSRDLPEKVS-ADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCA 846
            R A A++L+         A +V +TAG T  I TAL+ +  PG  +L+P P FP+Y    
Sbjct: 78   RTAAAEFLAAKYDVHYDPASEVIITAGATGGIYTALTSILNPGDEVLIPTPIFPLYIAIV 137

Query: 847  AFRHLEVRYYDLLPEKAWEVDLNAVES--LADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
                    + D   +  + +  + +++   A   T AVV+  P NP G  Y +   + +A
Sbjct: 138  KLSGATPVFMD-TSDNGFVLSPDQLQTTLAAHPKTKAVVLNFPSNPTGVTYRHDDLKALA 196



>gb:SAAJ5198_169319 Streptomyces alboniger stgA, stgU and stgR
           genes.>gb:SAN6517_171737 Streptomyces anulatus stgA,
           stgU and stgR genes.
          Length = 402

 Score = 58.9 bits (141), Expect = 2e-07
 Identities = 41/147 (27%), Positives = 70/147 (47%), Gaps = 1/147 (0%)
 Frame = +1

Query: 532 VISLGMGDPTAYSCFHSPALAQQAVSDTLSSY-KFNGYSPTVGLPQTRKAIADYLSRDLP 708
           V+ L  G+P  +  F +P   ++ V D +    + +GY+ + G+   R+A+A        
Sbjct: 34  VLRLNTGNPALFG-FEAP---EEIVQDMIRMLPQAHGYTDSRGVLSARRAVAQRYQALGL 89

Query: 709 EKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLP 888
           ++VS DDV++  G ++ +  A+  L   G  IL+P P FP++         +  +Y    
Sbjct: 90  DEVSVDDVFLGNGVSELVTMAVQALLEDGDEILIPAPDFPLWTAVTTLSGGKAVHYVCDE 149

Query: 889 EKAWEVDLNAVESLADQNTIAVVIINP 969
              W  DL+ + S     T AV IINP
Sbjct: 150 AADWYPDLDDMASKITDQTKAVEIINP 176



>gb:BT007934_2150866 Synthetic construct Homo sapiens
           glutamic-pyruvate transaminase (alanine
           aminotransferase) mRNA, partial cds.
          Length = 497

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 41/144 (28%), Positives = 69/144 (47%), Gaps = 11/144 (7%)
 Frame = +1

Query: 598 QAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSR-DLPEKVSADDVYVTAGCTQAIETAL 774
           + +      +    YS + G+   R+ +A Y+ R D       ++V+++ G + AI T L
Sbjct: 109 ERILQACGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVL 168

Query: 775 SILA----YPGANILLPRPGFPIY-ALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQ 939
            +L     +    +L+P P +P+Y A  A    ++V YY L  E+AW +D+  +     Q
Sbjct: 169 KLLVAGEGHTRTGVLIPIPQYPLYSATLAELGAVQVDYY-LDEERAWALDVAELHRALGQ 227

Query: 940 -----NTIAVVIINPGNPCGNVYT 996
                   A+ +INPGNP G V T
Sbjct: 228 ARDHCRPRALCVINPGNPTGQVQT 251



>gb:HUMAAT_2028934 Human mRNA for alanine aminotransferase.
          Length = 493

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 41/144 (28%), Positives = 69/144 (47%), Gaps = 11/144 (7%)
 Frame = +1

Query: 598 QAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSR-DLPEKVSADDVYVTAGCTQAIETAL 774
           + +      +    YS + G+   R+ +A Y+ R D       ++V+++ G + AI T L
Sbjct: 106 ERILQACGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVL 165

Query: 775 SILA----YPGANILLPRPGFPIY-ALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQ 939
            +L     +    +L+P P +P+Y A  A    ++V YY L  E+AW +D+  +     Q
Sbjct: 166 KLLVAGEGHTRTGVLIPIPQYPLYSATLAELGAVQVDYY-LDEERAWALDVAELHRALGQ 224

Query: 940 -----NTIAVVIINPGNPCGNVYT 996
                   A+ +INPGNP G V T
Sbjct: 225 ARDHCRPRALCVINPGNPTGQVQT 248



>gb:BC018207_1976467 Homo sapiens glutamic-pyruvate transaminase
           (alanine aminotransferase), mRNA (cDNA clone MGC:17068
           IMAGE:4179699), complete cds.>gb:BT006992_1990430 Homo
           sapiens glutamic-pyruvate transaminase (alanine
           aminotransferase) mRNA, complete
           cds.>gb:HSU70732_2025821 Human glutamate pyruvate
           transaminase (GPT) gene, complete cds.
          Length = 496

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 41/144 (28%), Positives = 69/144 (47%), Gaps = 11/144 (7%)
 Frame = +1

Query: 598 QAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSR-DLPEKVSADDVYVTAGCTQAIETAL 774
           + +      +    YS + G+   R+ +A Y+ R D       ++V+++ G + AI T L
Sbjct: 109 ERILQACGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVL 168

Query: 775 SILA----YPGANILLPRPGFPIY-ALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQ 939
            +L     +    +L+P P +P+Y A  A    ++V YY L  E+AW +D+  +     Q
Sbjct: 169 KLLVAGEGHTRTGVLIPIPQYPLYSATLAELGAVQVDYY-LDEERAWALDVAELHRALGQ 227

Query: 940 -----NTIAVVIINPGNPCGNVYT 996
                   A+ +INPGNP G V T
Sbjct: 228 ARDHCRPRALCVINPGNPTGQVQT 251



>gb:AE016820_1750038 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome VII, complete sequence.
          Length = 521

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 37/133 (27%), Positives = 65/133 (48%), Gaps = 7/133 (5%)
 Frame = +1

Query: 640  YSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAY-PGANILLPR 816
            YS + G+   R+ +A ++ R      + D+VY+TAG + A+   LS     P   +L+P 
Sbjct: 151  YSASQGVKGYRRTVAQFIERRDGIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPI 210

Query: 817  PGFPIYALCAAFRHLEVRYYDLLPEKAWEVDLNAVESL---ADQNTIA---VVIINPGNP 978
            P +P+Y       +     Y L     W  + + +E +   + +  IA   +V+INPGNP
Sbjct: 211  PQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNP 270

Query: 979  CGNVYTYQHRQEI 1017
             G+V + +  + I
Sbjct: 271  TGSVLSVKDMEAI 283



>gb:BA000045_743191 Gloeobacter violaceus PCC 7421 DNA, complete
            genome.
          Length = 392

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 52/169 (30%), Positives = 77/169 (45%), Gaps = 2/169 (1%)
 Frame = +1

Query: 520  DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSR 699
            D    ++L  G P     F +PA  ++A    +++ + N Y    GL Q R+AIA   +R
Sbjct: 29   DELGALNLAQGLPD----FAAPAFLKEAAQRAIAADR-NQYCDPWGLAQLREAIAAKCTR 83

Query: 700  DLPEKVS-ADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYY 876
            D    V  A  V V  G T+ I  AL  L  PG  +++  P +  Y    A    + RY 
Sbjct: 84   DNALAVDPATQVTVCCGATEGINLALMALLDPGDEVVVFSPFYENYRPNLATVEAKPRYV 143

Query: 877  DLLPEKAWEVDLNAVE-SLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
             L     W VD   +E + A     AV++ NP NP G V++ Q  + +A
Sbjct: 144  PLSAPD-WRVDEAVLERAFAGTAPRAVIVNNPANPTGKVWSRQELELVA 191



>gb:BA000043_739505 Geobacillus kaustophilus HTA426 DNA, complete
            genome.
          Length = 390

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 45/167 (26%), Positives = 76/167 (45%), Gaps = 4/167 (2%)
 Frame = +1

Query: 532  VISLGMGDP---TAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRD 702
            VISLG+G+P   T++S   +  L+ +          +  Y+   GL + R+ IA YL R 
Sbjct: 35   VISLGVGEPDFVTSWSIREASILSLEQ--------GYTSYTANAGLLELRQEIAAYLRRK 86

Query: 703  LPEKVSAD-DVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYD 879
                   + ++ VT G +QAI+ AL  +  PG  +++  P F  Y         +     
Sbjct: 87   FHVDYCPETEILVTVGASQAIDLALRAIINPGDEVIIVEPSFVAYEPLVVLAGGKPVAVH 146

Query: 880  LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
               E  ++++   +E    + T AV+I +P NP G V +    + IA
Sbjct: 147  TSGEDKFQLNPVHLERAITERTKAVIICSPNNPTGTVQSRTELEAIA 193



>gb:AY596297_632657 Haloarcula marismortui ATCC 43049 chromosome I,
            complete sequence.
          Length = 381

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 44/169 (26%), Positives = 79/169 (46%), Gaps = 1/169 (0%)
 Frame = +1

Query: 517  DDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLS 696
            ++   +ISLG+G+P     F +P  A++A   +L   +   Y+   G  + R+ IADY +
Sbjct: 25   EEMDDIISLGVGEPD----FSAPWSAREAAIASLERGQ-TSYTANRGKRELRERIADYEA 79

Query: 697  RDLPEKVSADD-VYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRY 873
                 +   D+ + VTAG ++ ++ A   L  PG +I + +P +  Y   A F  ++V  
Sbjct: 80   ATHNLQYDPDEEILVTAGASEGLDLAFRALLNPGDSIAIAQPCYVSYVPGATFAGIDVID 139

Query: 874  YDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
                 E  +++    +ES       A+V   P NP G   T +   ++A
Sbjct: 140  VPTRAEDEFKLTQEVLESSGAAEADALVYCFPNNPTGATMTAEEMADVA 188



>gb:AE017320_441465 Desulfovibrio vulgaris subsp. vulgaris str.
           Hildenborough, section 12 of 12 of the complete
           genome.>gb:AE017285_1074626 Desulfovibrio vulgaris
           subsp. vulgaris str. Hildenborough, complete genome.
          Length = 390

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 39/156 (25%), Positives = 70/156 (44%)
 Frame = +1

Query: 529 KVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLP 708
           KV+SL +G+P   +  H    A++A+ +      F  Y+P  G+ + R+A+A Y  R   
Sbjct: 31  KVVSLAVGEPDFGTPAHICEAAKRAIDE-----GFTRYTPVPGIIELREAVAGYFGRCYG 85

Query: 709 EKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLP 888
            +  A+   VT G  QA+      L  PG  +L+P P +  Y            +     
Sbjct: 86  VEAPAEATIVTNGGKQALYNLFQALLNPGDEVLVPAPYWVSYPALVQLAEGVPVFVPSPA 145

Query: 889 EKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYT 996
           E+ +++    +++     T  +++ +P NP G  YT
Sbjct: 146 ERGFKITPAELDAHRTPRTRVLLLNSPSNPTGACYT 181



>gb:AE016932_360844 Bacteroides thetaiotaomicron VPI-5482, section 7
            of 21 of the complete genome.>gb:AE015928_987332
            Bacteroides thetaiotaomicron VPI-5482, complete genome.
          Length = 399

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 34/127 (26%), Positives = 64/127 (50%), Gaps = 1/127 (0%)
 Frame = +1

Query: 640  YSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRP 819
            YSP+ G    R+ +  Y ++     ++ADD+ +T+G ++A+  +      PG  I++P P
Sbjct: 63   YSPSAGNRSYREKLVGYYAK-FNINLTADDIIITSGGSEAVLFSFLSCLNPGDEIIVPEP 121

Query: 820  GFPIYALCAAFRHLEVRYYDLLPEKAWEVD-LNAVESLADQNTIAVVIINPGNPCGNVYT 996
             +  Y   A     ++R      E+ + +  +   E L ++ T A++I NP NP G +YT
Sbjct: 122  AYANYMAFAISAGAKIRTIATTIEEGFSLPKVEKFEELINERTKAILICNPNNPTGYLYT 181

Query: 997  YQHRQEI 1017
             +   +I
Sbjct: 182  RREMNQI 188



>gb:AE014295_311995 Bifidobacterium longum NCC2705, complete genome.
          Length = 444

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 50/167 (29%), Positives = 77/167 (46%), Gaps = 5/167 (2%)
 Frame = +1

Query: 535  ISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEK 714
            ISL +G+P+A +  H  A A +A     + Y     +  +G+P+ RKA+ADY +R     
Sbjct: 59   ISLTVGEPSATAAPHIVAAACEAAQAGRTRY-----TNVLGVPEYRKAVADYSARVKGLT 113

Query: 715  VSAD-DVYVTAGCTQAIETALSILAYPGANILLPRPGFPIY----ALCAAFRHLEVRYYD 879
               + ++    G T  +  AL  +   G  +++P P F  Y     LC   R + V    
Sbjct: 114  YDPETEIQAVDGATIGLFLALKAVVGTGDEVIIPSPFFTSYDAEVMLCGG-RPVTVA--- 169

Query: 880  LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
            L PE    V+   +E+     T AV+I +PGNP G V +      IA
Sbjct: 170  LRPEHGMRVNAADIEAAITPRTRAVIINSPGNPTGAVTSAAELARIA 216



>pir|E97124|E97124 aspartate Aminotransferase [imported] - Clostridium
            acetobutylicum>gb:AE007691_229145 Clostridium
            acetobutylicum ATCC 824 section 179 of 356 of the
            complete genome.>gb:AE001437_1092100 Clostridium
            acetobutylicum ATCC 824, complete genome.
          Length = 398

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 41/163 (25%), Positives = 70/163 (42%)
 Frame = +1

Query: 532  VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
            VI  G G P     F++P   + A    + +  +  Y+P  G+ + + AI D   RD   
Sbjct: 32   VIGFGAGQPD----FNTPKNIRDAAIYAIEN-GYTKYTPVSGIKELKMAICDKFKRDNNL 86

Query: 712  KVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLLPE 891
              S  ++ V+ G  Q +    S L  PG  ++L  P +  Y              +   E
Sbjct: 87   NYSLSNIIVSTGAKQCLSDTFSALLNPGDEVILSAPYWVTYPELIKLNDGISVIINTTEE 146

Query: 892  KAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
              +++ ++ +E+     T A++I +P NP G VYT    + IA
Sbjct: 147  NHFKLSVDDLENAYTSKTKAILINSPSNPTGTVYTETELKAIA 189



>pir|C69672|C69672 probable aspartate transaminase (EC 2.6.1.-) patA
            [similarity] - Bacillus subtilis>gb:BSUB0008_753365
            Bacillus subtilis complete genome (section 8 of 21): from
            1410943 to 1602922.
          Length = 392

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 42/167 (25%), Positives = 74/167 (44%), Gaps = 4/167 (2%)
 Frame = +1

Query: 532  VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
            VISL +G P  ++  H  A A++A+ + ++SY     +P  G  + R+A+  Y+ +    
Sbjct: 30   VISLTIGQPDFFTPHHVKAAAKKAIDENVTSY-----TPNAGYLELRQAVQLYMKKKADF 84

Query: 712  KVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYA----LCAAFRHLEVRYYD 879
               A+   +     QAI+ A   +  PG  +++P P +P Y     LC A   +      
Sbjct: 85   NYDAESEIIITTGAQAIDAAFRTILSPGDEVIMPGPIYPGYEPIINLCGAKPVIVD---- 140

Query: 880  LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
                  +++    +E     NT  VV+  P NP G   + +  + IA
Sbjct: 141  -TTSHGFKLTARLIEDALTPNTKCVVLPYPSNPTGVTLSEEELKSIA 186



>sp|P16524|PATA_BACSU Putative aminotransferase A (EC
            2.6.1.-).>gb:BS16829KB_750026 Bacillus subtilis 29kB DNA
            fragment from ykwC gene to cse15 gene.
          Length = 392

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 42/167 (25%), Positives = 74/167 (44%), Gaps = 4/167 (2%)
 Frame = +1

Query: 532  VISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPE 711
            VISL +G P  ++  H  A A++A+ + ++SY     +P  G  + R+A+  Y+ +    
Sbjct: 30   VISLTIGQPDFFTPHHVKAAAKKAIDENVTSY-----TPNAGYLELRQAVQLYMKKKADF 84

Query: 712  KVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYA----LCAAFRHLEVRYYD 879
               A+   +     QAI+ A   +  PG  +++P P +P Y     LC A   +      
Sbjct: 85   NYDAESEIIITTGAQAIDAAFRTILSPGDEVIMPGPIYPGYEPIINLCGAKPVIVD---- 140

Query: 880  LLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEIA 1020
                  +++    +E     NT  VV+  P NP G   + +  + IA
Sbjct: 141  -TTSHGFKLTARLIEDALTPNTKCVVLPYPSNPTGVTLSEEELKSIA 186



>sp|P24298|ALAT_HUMAN Alanine aminotransferase (EC 2.6.1.2)
           (Glutamic--pyruvic transaminase) (GPT)
           (Glutamic--alanine transaminase).
          Length = 495

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 41/144 (28%), Positives = 69/144 (47%), Gaps = 11/144 (7%)
 Frame = +1

Query: 598 QAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSR-DLPEKVSADDVYVTAGCTQAIETAL 774
           + +      +    YS + G+   R+ +A Y+ R D       ++V+++ G + AI T L
Sbjct: 108 ERILQACGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVL 167

Query: 775 SILA----YPGANILLPRPGFPIY-ALCAAFRHLEVRYYDLLPEKAWEVDLNAVESLADQ 939
            +L     +    +L+P P +P+Y A  A    ++V YY L  E+AW +D+  +     Q
Sbjct: 168 KLLVAGEGHTRTGVLIPIPQYPLYSATLAELGAVQVDYY-LDEERAWALDVAELHRALGQ 226

Query: 940 -----NTIAVVIINPGNPCGNVYT 996
                   A+ +INPGNP G V T
Sbjct: 227 ARDHCRPRALCVINPGNPTGQVQT 250



>gb:AL935257_551506 Lactobacillus plantarum strain WCFS1 complete
           genome; segment 6/11.
          Length = 401

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 46/162 (28%), Positives = 78/162 (48%), Gaps = 3/162 (1%)
 Frame = +1

Query: 520 DSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSR 699
           D   VI+LG+G+P     F +P   +QA  D++ + + + Y+P  GLP  ++AI+  +  
Sbjct: 30  DGVDVINLGIGEPD----FQTPDNIKQAAIDSIQNGQASFYTPATGLPALKQAISQRIEA 85

Query: 700 DLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYA---LCAAFRHLEVR 870
           D       + + VT G   A+ T   ++  P   +LLP P +  Y+     A    +EV 
Sbjct: 86  DHHYHFDPNQIVVTDGAKMALFTLFQVILNPDDEVLLPVPYWVSYSEQVKLAGGVPVEVS 145

Query: 871 YYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYT 996
             + L  +    DL A  +     T A+V+ +P NP G V++
Sbjct: 146 TDEQL--RFTTADLEAQRT---PKTKALVLNSPQNPSGLVFS 182



>gb:AE017002_376481 Bacillus cereus ATCC 14579 section 5 of 18 of the
            complete genome.>gb:AE016877_1016731 Bacillus cereus ATCC
            14579 complete genome.
          Length = 395

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 41/170 (24%), Positives = 75/170 (44%)
 Frame = +1

Query: 508  SEGDDSKKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIAD 687
            +EG D   VI LG G+P   +  H    A +A+ +  + Y     +PT GL   ++ I  
Sbjct: 27   AEGHD---VIGLGAGEPDFNTPEHIMDAAHKAMLEGHTKY-----TPTGGLQSLKQEIVK 78

Query: 688  YLSRDLPEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEV 867
              +RD        ++ V  G   A+ T   +L   G  +++P P +  Y         + 
Sbjct: 79   KFTRDQGIAYDPSEIIVCNGAKHALYTLFQVLLDEGDEVIIPTPYWVSYPEQVKLAGGKP 138

Query: 868  RYYDLLPEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVYTYQHRQEI 1017
             Y + L +  +++    +     + T AV+I +P NP G +Y+ +  Q++
Sbjct: 139  VYVEGLEDNEYKITAKQLREAITEKTKAVIINSPSNPTGMIYSKEELQQL 188



>gb:AE014145_303937 Streptococcus pyogenes MGAS315, section 10 of 37
           of the complete genome.>gb:BA000034_714319 Streptococcus
           pyogenes SSI-1 DNA, complete genome.>gb:AE014074_927116
           Streptococcus pyogenes MGAS315, complete genome.
          Length = 397

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 37/156 (23%), Positives = 71/156 (45%)
 Frame = +1

Query: 526 KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
           + V++L +G+P  ++  H    A +++ +  +S+    Y+   GLP+ + AIA YL    
Sbjct: 31  RDVLNLTLGEPDFFTPKHIQDKAIESIQNGTASF----YTNASGLPELKAAIATYLKNQY 86

Query: 706 PEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLL 885
              +S D +    G    +      +  PG  +L+P P +  Y+        +  +   L
Sbjct: 87  GYHLSPDQIVAGTGAKFILYAFFMAVLNPGDQVLIPTPYWVSYSDQVKMAEGQPIFVQGL 146

Query: 886 PEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVY 993
            E  ++V ++ +E      T  V+I +P NP G +Y
Sbjct: 147 EENQFKVTVDQLERARTSKTKVVLINSPSNPTGMIY 182



>gb:AE010004_258268 Streptococcus pyogenes strain MGAS8232, section
           52 of 173 of the complete genome.>gb:CP000003_860482
           Streptococcus pyogenes MGAS10394, complete
           genome.>gb:AE009949_904650 Streptococcus pyogenes strain
           MGAS8232, complete genome.
          Length = 397

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 37/156 (23%), Positives = 71/156 (45%)
 Frame = +1

Query: 526 KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
           + V++L +G+P  ++  H    A +++ +  +S+    Y+   GLP+ + AIA YL    
Sbjct: 31  RDVLNLTLGEPDFFTPKHIQDKAIESIQNGTASF----YTNASGLPELKAAIATYLKNQY 86

Query: 706 PEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLL 885
              +S D +    G    +      +  PG  +L+P P +  Y+        +  +   L
Sbjct: 87  GYHLSPDQIVAGTGAKFILYAFFMAVLNPGDQVLIPTPYWVSYSDQVKMAEGQPIFVQGL 146

Query: 886 PEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVY 993
            E  ++V ++ +E      T  V+I +P NP G +Y
Sbjct: 147 EENQFKVTVDQLERARTSKTKVVLINSPSNPTGMIY 182



>gb:AE006519_219738 Streptococcus pyogenes M1 GAS, section 48 of 167
           of the complete genome.>gb:AE004092_1105584
           Streptococcus pyogenes M1 GAS, complete genome.
          Length = 397

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 37/156 (23%), Positives = 71/156 (45%)
 Frame = +1

Query: 526 KKVISLGMGDPTAYSCFHSPALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDL 705
           + V++L +G+P  ++  H    A +++ +  +S+    Y+   GLP+ + AIA YL    
Sbjct: 31  RDVLNLTLGEPDFFTPKHIQDKAIESIQNGTASF----YTNASGLPELKAAIATYLKNQY 86

Query: 706 PEKVSADDVYVTAGCTQAIETALSILAYPGANILLPRPGFPIYALCAAFRHLEVRYYDLL 885
              +S D +    G    +      +  PG  +L+P P +  Y+        +  +   L
Sbjct: 87  GYHLSPDQIVAGTGAKFILYAFFMAVLNPGDQVLIPTPYWVSYSDQVKMAEGQPIFVQGL 146

Query: 886 PEKAWEVDLNAVESLADQNTIAVVIINPGNPCGNVY 993
            E  ++V ++ +E      T  V+I +P NP G +Y
Sbjct: 147 EENQFKVTVDQLERARTSKTKVVLINSPSNPTGMIY 182



>gb:CR522870_100292 Desulfotalea psychrophila LSv54 chromosome.
          Length = 445

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 45/139 (32%), Positives = 65/139 (46%), Gaps = 3/139 (2%)
 Frame = +1

Query: 586 ALAQQAVSDTLSSYKFNGYSPTVGLPQTRKAIADYLSRDLPEKVSADDVYVTAGCTQAIE 765
           AL  +AV D  S     GYSPT G+  TR+ IA   ++    ++SA+D+    G   AI 
Sbjct: 66  ALVAEAVQDDASY----GYSPTKGVLATRRFIAAETNKKGAVQISAEDIIFFNGLGDAIS 121

Query: 766 TALSILAYPGANILLPRPGFPIYALC-AAFRHLEVRYYDLLPEKAWEVDLNAVESLADQN 942
                L    A +L+P P +  ++   AA    +   Y L P   W  D+  +E     N
Sbjct: 122 KIFGFLKRT-ARVLVPTPSYTTHSSAEAAHSGDKPLTYKLDPHNDWYPDIADIERRVKYN 180

Query: 943 TI--AVVIINPGNPCGNVY 993
            +   ++IINP NP G VY
Sbjct: 181 PMVAGILIINPDNPTGAVY 199


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,035,962,569
Number of Sequences: 1806583
Number of extensions: 21171867
Number of successful extensions: 52581
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 50298
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 52099
length of database: 581,917,975
effective HSP length: 125
effective length of database: 356,095,100
effective search space used: 76204351400
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)