BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig4801
         (431 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY080790_1568492 Arabidopsis thaliana unknown protein (At1g04...   166   1e-40   
pir|T00954|T00954 hypothetical protein F20D22.4 - Arabidopsis th...   159   1e-38   Arabidopsis thaliana [mouse-ear cress]
gb:CQ815190_1453516 Sequence 1 from Patent EP1422238.>gb:AX13400...    97   7e-20   
gb:LMU73845_1388908 Leishmania major protein antigen LmSTI1 mRNA...    97   7e-20   
gb:BC064232_2553785 Xenopus tropicalis hypothetical protein MGC7...    96   2e-19   
gb:BC046709_2549698 Xenopus laevis stress-induced-phosphoprotein...    95   5e-19   
gb:AF506290_2498574 Xenopus laevis stress-induced phosphoprotein...    95   5e-19   
gb:AC084406_1733631 Oryza sativa chromosome 3 BAC OSJNBa0067E01 ...    94   8e-19   
gb:OSJN00020_1693413 Oryza sativa genomic DNA, chromosome 4, BAC...    92   2e-18   
gb:AP005291_1849977 Oryza sativa (japonica cultivar-group) genom...    91   7e-18   
pir|S56658|S56658 stress-induced protein sti1 - soybean                90   1e-17   Glycine max [soybeans]
sp|Q43468|STIP_SOYBN|STIP_SOYBN Heat shock protein STI (Stress inducible pr...    90   1e-17   Glycine max [soybeans]
gb:AC084406_1733626 Oryza sativa chromosome 3 BAC OSJNBa0067E01 ...    90   2e-17   
gb:AF107772_1241864 Trypanosoma cruzi TcSTI1 (STI1) mRNA, comple...    90   2e-17   
gb:AF512999_1807387 Medicago sativa TPR1 (tpr1) mRNA, complete cds.    89   2e-17   
gb:AY140001_1582442 Arabidopsis thaliana stress-induced protein ...    89   2e-17   
gb:ACU89984_1208397 Acanthamoeba castellanii transformation-sens...    89   2e-17   
pir|T48150|T48150 stress-induced protein sti1-like protein - Ara...    89   2e-17   Arabidopsis thaliana [mouse-ear cress]
gb:BT015924_1642542 Arabidopsis thaliana At1g62740 gene, complet...    89   3e-17   
gb:BT005735_1638667 Arabidopsis thaliana clone RAFL15-47-M19 (R2...    89   3e-17   
gb:BC085642_2564520 Danio rerio zgc:92133, mRNA (cDNA clone MGC:...    89   3e-17   
gb:AF039202_2051899 Cricetulus griseus Hsp70/Hsp90 organizing pr...    88   5e-17   
gb:AC084406_1733628 Oryza sativa chromosome 3 BAC OSJNBa0067E01 ...    88   5e-17   
gb:AE014134_1126843 Drosophila melanogaster chromosome 2L, compl...    88   5e-17   
gb:BC078016_2560659 Xenopus laevis stress-induced-phosphoprotein...    88   6e-17   
gb:BC061529_2104511 Rattus norvegicus stress-induced-phosphoprot...    88   6e-17   
gb:BC003794_2089349 Mus musculus stress-induced phosphoprotein 1...    88   6e-17   
gb:AF056198_1237041 Drosophila melanogaster Hsp70/Hsp90 organizi...    88   6e-17   
gb:AK088494_1175440 Mus musculus 2 days neonate thymus thymic ce...    88   6e-17   
sp|P31948|IEFS_HUMAN|IEFS_HUMAN Stress-induced-phosphoprotein 1 (STI1) (Hsp...    88   6e-17   Homo sapiens [man]
gb:AK075988_1171149 Mus musculus 10 days embryo whole body cDNA,...    87   8e-17   
gb:AB061261_1522022 Solanum tuberosum mRNA for ankyrin-like prot...    87   1e-16   
gb:AC084406_1733625 Oryza sativa chromosome 3 BAC OSJNBa0067E01 ...    86   3e-16   
gb:AC079736_1732778 Oryza sativa (japonica cultivar-group) chrom...    86   3e-16   
pir|H86257|H86257 protein F5O11.2 [imported] - Arabidopsis thali...    85   4e-16   Arabidopsis thaliana [mouse-ear cress]
gb:AE017341_1753929 Cryptococcus neoformans var. neoformans JEC2...    84   9e-16   
gb:AC079736_1732775 Oryza sativa (japonica cultivar-group) chrom...    84   9e-16   
gb:AC084406_1733624 Oryza sativa chromosome 3 BAC OSJNBa0067E01 ...    82   3e-15   
pir|T03899|T03899 hypothetical protein R09E12.3 - Caenorhabditis...    82   3e-15   Caenorhabditis elegans [roundworm]
gb:AJ720539_2502726 Gallus gallus mRNA for hypothetical protein,...    82   4e-15   
gb:BC074276_2557789 Xenopus laevis MGC84046 protein, mRNA (cDNA ...    80   9e-15   
gb:AC084406_1733623 Oryza sativa chromosome 3 BAC OSJNBa0067E01 ...    80   9e-15   
gb:AC084818_1733853 Oryza sativa (japonica cultivar-group) chrom...    80   2e-14   
gb:CR382129_1661682 Yarrowia lipolytica chromosome C of strain C...    80   2e-14   
gb:AE005173_893941 Arabidopsis thaliana chromosome 1, bottom arm...    79   2e-14   
gb:BC074059_2557588 Danio rerio zgc:92462, mRNA (cDNA clone MGC:...    79   3e-14   
gb:AB026295_1516945 Oryza sativa (japonica cultivar-group) genom...    79   3e-14   
gb:AE014296_1135346 Drosophila melanogaster chromosome 3L, compl...    79   3e-14   
gb:AF368280_2064284 Rattus norvegicus small glutamine rich prote...    79   4e-14   
gb:AK049820_1168982 Mus musculus adult male hippocampus cDNA, RI...    79   4e-14   
gb:AY365188_1602859 Nicotiana benthamiana isolate Nb#62 unknown ...    78   5e-14   
gb:AP003282_1827222 Oryza sativa (japonica cultivar-group) genom...    78   6e-14   
gb:AP005317_1850512 Oryza sativa (japonica cultivar-group) genom...    77   8e-14   
gb:AC079736_1732781 Oryza sativa (japonica cultivar-group) chrom...    77   8e-14   
sp|Q96EQ0|SGTB_HUMAN|SGTB_HUMAN Small glutamine-rich tetratricopeptide repe...    77   1e-13   Homo sapiens [man]
gb:ATAC011437_1543283 Arabidopsis thaliana chromosome III BAC F7...    77   1e-13   
gb:AC079736_1732780 Oryza sativa (japonica cultivar-group) chrom...    75   3e-13   
gb:PFACAM_1393654 P.falciparum calmodulin gene, complete cds.          75   5e-13   
gb:AE014187_938790 Plasmodium falciparum 3D7 chromosome 14 compl...    75   5e-13   
pir|A45594|A45594 ORF 5' of calmodulin gene - malaria parasite (...    75   5e-13   Plasmodium falciparum
sp|P25407|YCA1_PLAFA|YCA1_PLAFA Hypothetical protein in calmodulin 5'region...    75   5e-13   Plasmodium falciparum
gb:HS45P1_1998748 Human DNA sequence from clone RP6-45P1 on chro...    74   7e-13   
gb:AP005317_1850508 Oryza sativa (japonica cultivar-group) genom...    74   7e-13   
gb:BC045972_2549486 Danio rerio zgc:56178, mRNA (cDNA clone MGC:...    74   9e-13   
gb:BC056415_1985311 Homo sapiens hypothetical protein FLJ21908, ...    74   9e-13   
gb:AK025561_1910326 Homo sapiens cDNA: FLJ21908 fis, clone HEP03...    74   9e-13   
gb:AC084406_1733629 Oryza sativa chromosome 3 BAC OSJNBa0067E01 ...    74   1e-12   
gb:AY182777_1587883 Lycopersicon esculentum type 5 protein serin...    74   1e-12   
gb:AY150041_1584918 Lycopersicon esculentum type 5 serine/threon...    74   1e-12   
gb:BC068804_2555304 Xenopus laevis hypothetical protein MGC81394...    73   2e-12   
gb:AP005317_1850511 Oryza sativa (japonica cultivar-group) genom...    73   2e-12   
gb:AK009765_1155341 Mus musculus adult male tongue cDNA, RIKEN f...    73   2e-12   
gb:BC088960_2566010 Xenopus laevis hypothetical LOC496358, mRNA ...    73   2e-12   
gb:CR382124_1656385 Kluyveromyces lactis strain NRRL Y-1140 chro...    72   3e-12   
gb:BC079414_2107527 Rattus norvegicus similar to RIKEN cDNA 2310...    72   3e-12   
gb:AP005012_1847269 Oryza sativa (japonica cultivar-group) genom...    72   3e-12   
gb:AP004999_1847035 Oryza sativa (japonica cultivar-group) genom...    72   3e-12   
gb:PPP5C_2039892 Human serine-threonine phosphatase (PP5) mRNA, ...    72   4e-12   
gb:HSRNAPPP5_2020084 H.sapiens mRNA for protein phosphatase 5.         72   4e-12   
gb:BC000750_1967000 Homo sapiens protein phosphatase 5, catalyti...    72   4e-12   
gb:AP005563_1854112 Oryza sativa (japonica cultivar-group) genom...    72   4e-12   
gb:CR859667_1183773 Pongo pygmaeus mRNA; cDNA DKFZp459E169 (from...    72   4e-12   
pir|S52570|S52570 phosphoprotein phosphatase (EC 3.1.3.16) 5 [va...    72   4e-12   Homo sapiens [man]
sp|Q9USI5|STI1_SCHPO|STI1_SCHPO Heat shock protein sti1 homolog.>pir|T41531...    72   4e-12   Schizosaccharomyces pombe
sp|P53041|PPP5_HUMAN|PPP5_HUMAN Serine/threonine protein phosphatase 5 (EC ...    72   4e-12   Homo sapiens [man]
gb:AC087797_1734175 Oryza sativa chromosome 3 BAC OSJNBb0022E02 ...    71   6e-12   
gb:AY182779_1587886 Arabidopsis thaliana type 5 protein serine/t...    71   6e-12   
gb:AC006931_1534828 Arabidopsis thaliana chromosome 2 clone F7D1...    71   6e-12   
pir|E84858|E84858 phosphoprotein phosphatase (EC 3.1.3.16) At2g4...    71   6e-12   Arabidopsis thaliana [mouse-ear cress]
gb:AJ721018_2503205 Gallus gallus mRNA for hypothetical protein,...    71   7e-12   
gb:AJ720031_2502218 Gallus gallus mRNA for hypothetical protein,...    71   7e-12   
gb:RNU12203_2136861 Rattus norvegicus phosphoprotein phosphatase...    70   1e-11   
gb:MMU12204_2118321 Mus musculus phosphoprotein phosphatase mRNA...    70   1e-11   
gb:BC078786_2106945 Rattus norvegicus protein phosphatase 5, cat...    70   1e-11   
sp|P53042|PPP5_RAT|PPP5_RAT Serine/threonine protein phosphatase 5 (EC 3....    70   1e-11   Rattus norvegicus [brown rat]
gb:BC071463_2556203 Danio rerio zgc:56411, mRNA (cDNA clone MGC:...    70   1e-11   
gb:BC068702_2555205 Xenopus laevis hypothetical protein MGC81126...    70   1e-11   
gb:BC049428_2550237 Danio rerio zgc:56411, mRNA (cDNA clone MGC:...    70   1e-11   
pir|T51996|T51996 hypothetical protein stil+ - fission yeast  (S...    70   1e-11   Schizosaccharomyces pombe
sp|Q60676|PPP5_MOUSE|PPP5_MOUSE Serine/threonine protein phosphatase 5 (EC ...    70   1e-11   Mus musculus [mouse]
gb:BC072155_2556415 Xenopus laevis hypothetical protein MGC80137...    69   2e-11   
gb:BC064275_2553826 Xenopus tropicalis hypothetical protein LOC3...    69   2e-11   
gb:AF179282_1774760 Pisum sativum Toc64 (toc64) mRNA, complete c...    69   2e-11   
gb:AE017341_1754111 Cryptococcus neoformans var. neoformans JEC2...    69   2e-11   
gb:CR382136_1669321 Debaryomyces hansenii chromosome D of strain...    69   3e-11   
pir|A55346|A55346 phosphoprotein phosphatase (EC 3.1.3.16) PPT [...    69   3e-11   Rattus norvegicus [brown rat]
gb:CR382137_1670042 Debaryomyces hansenii chromosome E of strain...    69   4e-11   
pir|T40391|T40391 phosphoprotein phosphatase (EC 3.1.3.16) SPBC3...    69   4e-11   Schizosaccharomyces pombe
gb:CR382131_1664511 Yarrowia lipolytica chromosome E of strain C...    68   5e-11   
gb:CR382126_1659415 Kluyveromyces lactis strain NRRL Y-1140 chro...    68   5e-11   
gb:AK079168_1172617 Mus musculus 12 days embryo embryonic body b...    68   5e-11   
gb:AK039966_1165531 Mus musculus 0 day neonate thymus cDNA, RIKE...    68   5e-11   
sp|O70593|SGTA_RAT|SGTA_RAT Small glutamine-rich tetratricopeptide repeat...    68   5e-11   Rattus norvegicus [brown rat]
sp|Q8BJU0|SGTA_MOUSE|SGTA_MOUSE Small glutamine-rich tetratricopeptide repe...    68   5e-11   Mus musculus [mouse]
gb:AP005828_1858612 Oryza sativa (japonica cultivar-group) genom...    68   6e-11   
gb:AE016818_1747925 Ashbya gossypii (= Eremothecium gossypii) AT...    68   6e-11   
gb:AY496564_1609114 Physcomitrella patens chloroplast Toc64-2 mR...    68   6e-11   
pir|T16689|T16689 hypothetical protein R05F9.10 - Caenorhabditis...    68   6e-11   Caenorhabditis elegans [roundworm]
gb:BC085453_2564401 Danio rerio zgc:101838, mRNA (cDNA clone MGC...    67   8e-11   
gb:AY464141_2533929 Gallus gallus EKN1 mRNA, complete cds.             67   1e-10   
gb:AY323828_2083490 Mus musculus cytoplasmic CAR retention prote...    67   1e-10   
gb:AB101661_2048339 Rattus norvegicus tpr mRNA for PP5-TPR varia...    67   1e-10   
gb:AP005828_1858614 Oryza sativa (japonica cultivar-group) genom...    67   1e-10   
gb:AP005603_1854701 Oryza sativa (japonica cultivar-group) genom...    67   1e-10   
gb:CR382129_1661697 Yarrowia lipolytica chromosome C of strain C...    67   1e-10   
gb:AK077715_1172026 Mus musculus 8 days embryo whole body cDNA, ...    67   1e-10   
gb:AK076032_1171182 Mus musculus 10 days embryo whole body cDNA,...    67   1e-10   
sp|Q9QYI3|DJC7_MOUSE|DJC7_MOUSE DnaJ homolog subfamily C member 7 (Tetratri...    67   1e-10   Mus musculus [mouse]
gb:AP002897_1823660 Oryza sativa (japonica cultivar-group) genom...    67   1e-10   
gb:AC097280_1736614 Oryza sativa chromosome 3 BAC OSJNBb0111B07 ...    67   1e-10   
gb:AB028861_2044520 Mus musculus mRNA for mDj11, complete cds.         66   2e-10   
gb:BC045536_1983567 Homo sapiens, clone IMAGE:4825300, mRNA, par...    66   2e-10   
gb:BC000942_1967148 Homo sapiens tetratricopeptide repeat domain...    66   2e-10   
gb:AY847013_1965059 Cercopithecus aethiops kidney fibroblast sma...    66   2e-10   
gb:AC135918_1742825 Oryza sativa (japonica cultivar-group) chrom...    66   2e-10   
gb:AY496563_1609113 Physcomitrella patens chloroplast Toc64-1 mR...    66   2e-10   
gb:AY144442_1583538 Sorghum bicolor BAC 95A23/98N8.1 Rph region,...    66   2e-10   
gb:ATH319538_1552500 Arabidopsis thaliana partial mRNA for stil-...    66   2e-10   
pir|S61991|S61991 hypothetical protein YOR007c - yeast (Saccharo...    66   2e-10   Saccharomyces cerevisiae [brewer's yeast]
pir|T08782|T08782 hypothetical protein DKFZp586N1020.1 - human (...    66   2e-10   Homo sapiens [man]
sp|P15705|STI1_YEAST|STI1_YEAST Heat shock protein STI1.>pir|A32567|A32567 ...    66   2e-10   Saccharomyces cerevisiae [brewer's yeast]
sp|O43765|SGTA_HUMAN|SGTA_HUMAN Small glutamine-rich tetratricopeptide repe...    66   2e-10   Homo sapiens [man]
gb:BC080162_2561592 Xenopus tropicalis ppp5c-prov protein, mRNA ...    66   2e-10   
gb:BC082093_2108320 Rattus norvegicus tetratricopeptide repeat d...    66   2e-10   
gb:BT019637_2151463 Synthetic construct Homo sapiens tetratricop...    65   3e-10   
gb:AK011875_1156638 Mus musculus 10 days embryo whole body cDNA,...    65   3e-10   
sp|Q99614|TTC1_HUMAN|TTC1_HUMAN Tetratricopeptide repeat protein 1 (TPR rep...    65   3e-10   Homo sapiens [man]
gb:AB178470_2049693 Rattus norvegicus CCRP mRNA for cytoplasmic ...    65   4e-10   
gb:AX888164_1483617 Sequence 4027 from Patent EP1033401.               65   4e-10   
gb:CEY39B6A_1369835 Caenorhabditis elegans YAC Y39B6A, complete ...    65   4e-10   
pir|T45058|T45058 phosphoprotein phosphatase (EC 3.1.3.16) Y39B6...    65   4e-10   Caenorhabditis elegans [roundworm]
gb:BC073033_2556946 Xenopus laevis protein phosphatase 5, mRNA (...    65   5e-10   
gb:BC067176_2554649 Danio rerio zgc:55741, mRNA (cDNA clone MGC:...    65   5e-10   
gb:BC048062_2550023 Danio rerio zgc:55741, mRNA (cDNA clone MGC:...    65   5e-10   
gb:AF018263_2468871 Xenopus laevis protein phosphatase 5 (PP5) m...    65   5e-10   
gb:AE016816_1746696 Ashbya gossypii (= Eremothecium gossypii) AT...    65   5e-10   
gb:OSJN00076_1694423 Oryza sativa genomic DNA, chromosome 4, BAC...    65   5e-10   
gb:OSA245900_1692394 Oryza sativa chromosome 4 BAC q3037-207F1 c...    65   5e-10   
gb:CR380954_1651414 Candida glabrata strain CBS138 chromosome H ...    65   5e-10   
gb:AY274387_1315133 Drosophila melanogaster strain Canton-S Hsp7...    65   5e-10   
gb:AY274385_1315131 Drosophila melanogaster strain Z(H)1 isolate...    65   5e-10   
gb:AY274384_1315130 Drosophila simulans strain DSR isolate 3 Hsp...    65   5e-10   
gb:AY274383_1315129 Drosophila simulans strain DSR isolate 2 Hsp...    65   5e-10   
gb:AY274382_1315128 Drosophila simulans strain DSR isolate 1 Hsp...    65   5e-10   
gb:BC033772_1981046 Homo sapiens DnaJ (Hsp40) homolog, subfamily...    64   7e-10   
gb:CR382122_1655276 Kluyveromyces lactis strain NRRL Y-1140 chro...    64   7e-10   
gb:CR380951_1650053 Candida glabrata strain CBS138 chromosome E ...    64   7e-10   
sp|Q99615|DJC7_HUMAN|DJC7_HUMAN DnaJ homolog subfamily C member 7 (Tetratri...    64   7e-10   Homo sapiens [man]
gb:AP004999_1847033 Oryza sativa (japonica cultivar-group) genom...    64   9e-10   
gb:AP002745_1822731 Oryza sativa (japonica cultivar-group) genom...    64   9e-10   
gb:ATT5E8_1556137 Arabidopsis thaliana DNA chromosome 5, BAC clo...    64   9e-10   
gb:BC049337_2550192 Danio rerio translocase of outer mitochondri...    64   1e-09   
gb:AL929108_2504775 Zebrafish DNA sequence from clone CH211-239J...    64   1e-09   
gb:AE016815_1746366 Ashbya gossypii (= Eremothecium gossypii) AT...    64   1e-09   
gb:AY274381_1315127 Drosophila yakuba strain 0261.0 Hsp70/Hsp90 ...    64   1e-09   
sp|Q95LY5|TTCC_MACFA|TTCC_MACFA Tetratricopeptide repeat protein 12 (TPR re...    64   1e-09   Macaca fascicularis [crab eating macaque]
gb:AE017343_1755930 Cryptococcus neoformans var. neoformans JEC2...    63   2e-09   
gb:AE014134_1129523 Drosophila melanogaster chromosome 2L, compl...    63   2e-09   
gb:AP006062_1860740 Oryza sativa (japonica cultivar-group) genom...    63   2e-09   
gb:CR859815_1183917 Pongo pygmaeus mRNA; cDNA DKFZp469O1034 (fro...    63   2e-09   
gb:AE014188_968208 Plasmodium falciparum 3D7 chromosome 12, comp...    63   2e-09   
pir|T37851|T37851 hypothetical protein SPAC17G6.19c - fission ye...    63   2e-09   Schizosaccharomyces pombe
gb:BC051775_2550443 Danio rerio zgc:56076, mRNA (cDNA clone MGC:...    62   3e-09   
gb:AY428510_2532322 Danio rerio EKN1 mRNA, complete cds.>gb:BC06...    62   3e-09   
gb:BC057207_2102679 Mus musculus tetratricopeptide repeat domain...    62   3e-09   
gb:AB008516_2043414 Mus musculus mRNA for mtprd, complete cds.         62   3e-09   
gb:BC032355_1980421 Homo sapiens tetratricopeptide repeat domain...    62   3e-09   
gb:AK000542_1907989 Homo sapiens cDNA FLJ20535 fis, clone KAT11013.    62   3e-09   
gb:AF439974_1800032 Hordeum vulgare SGT1 (SGT1) mRNA, complete cds.    62   3e-09   
gb:AK088273_1175301 Mus musculus 2 days neonate thymus thymic ce...    62   3e-09   
gb:AK053765_1170561 Mus musculus 0 day neonate eyeball cDNA, RIK...    62   3e-09   
pir|JW0059|JW0059 mtprd protein - mouse                                62   3e-09   Mus musculus [mouse]
sp|Q9H892|TTCC_HUMAN|TTCC_HUMAN Tetratricopeptide repeat protein 12 (TPR re...    62   3e-09   Homo sapiens [man]
gb:BC068391_2555077 Danio rerio zgc:85806, mRNA (cDNA clone MGC:...    62   3e-09   
gb:AY144442_1583536 Sorghum bicolor BAC 95A23/98N8.1 Rph region,...    62   3e-09   
gb:AB019230_1514151 Arabidopsis thaliana genomic DNA, chromosome...    62   3e-09   
gb:AE014297_1138737 Drosophila melanogaster chromosome 3R, compl...    62   3e-09   
gb:BC059538_2552515 Danio rerio translocase of outer mitochondri...    62   5e-09   
gb:AJ720999_2503186 Gallus gallus mRNA for hypothetical protein,...    62   5e-09   
gb:AC098598_1736783 Oryza sativa (japonica cultivar-group) chrom...    62   5e-09   
gb:SPBC543_1720230 S.pombe chromosome II cosmid c543.                  62   5e-09   
gb:CR382128_1660617 Yarrowia lipolytica chromosome B of strain C...    62   5e-09   
gb:CR382121_1654574 Kluyveromyces lactis strain NRRL Y-1140 chro...    62   5e-09   
gb:BT001725_1356498 Drosophila melanogaster RE69804 full insert ...    62   5e-09   
gb:AY052144_1290738 Drosophila melanogaster SD10334 full length ...    62   5e-09   
gb:AE014297_1138414 Drosophila melanogaster chromosome 3R, compl...    62   5e-09   
gb:AE014134_1129407 Drosophila melanogaster chromosome 2L, compl...    62   5e-09   
gb:AE014134_1129406 Drosophila melanogaster chromosome 2L, compl...    62   5e-09   
gb:BA000040_729568 Bradyrhizobium japonicum USDA 110 DNA, comple...    62   5e-09   
gb:AY428506_2084918 Rattus norvegicus EKN1 mRNA, complete cds.>g...    61   6e-09   
gb:AK122356_2069021 Mus musculus mRNA for mKIAA0719 protein.           61   6e-09   
gb:AB162856_2049387 Rattus norvegicus mRNA for TOM70, complete cds.    61   6e-09   
gb:CR382134_1667198 Debaryomyces hansenii chromosome B of strain...    61   6e-09   
gb:AY144974_1583765 Saccharomyces castellii clone Contig1491 TOM...    61   6e-09   
gb:AK083586_1174011 Mus musculus 9 days embryo whole body cDNA, ...    61   6e-09   
gb:AK076457_1171399 Mus musculus 0 day neonate head cDNA, RIKEN ...    61   6e-09   
sp|Q8BW49|TTCC_MOUSE|TTCC_MOUSE Tetratricopeptide repeat protein 12 (TPR re...    61   6e-09   Mus musculus [mouse]
gb:AP005317_1850502 Oryza sativa (japonica cultivar-group) genom...    61   8e-09   
gb:BT004630_1637664 Arabidopsis thaliana At4g08320 gene, complet...    61   8e-09   
pir|T14186|T14186 hypothetical protein T28D5.10 - Arabidopsis th...    61   8e-09   Arabidopsis thaliana [mouse-ear cress]
pir|E85082|E85082 hypothetical protein AT4g08320 [imported] - Ar...    61   8e-09   Arabidopsis thaliana [mouse-ear cress]
pir|T46576|T46576 phosphoprotein phosphatase (EC 3.1.3.16) ppt-1...    61   8e-09   Neurospora crassa
sp|P38825|YHR7_YEAST|YHR7_YEAST Hypothetical 71.9 kDa protein in ERP5-ORC6 ...    61   8e-09   Saccharomyces cerevisiae [brewer's yeast]
sp|Q863A4|DYX1_PONPY|DYX1_PONPY Dyslexia susceptibility 1 candidate gene 1 ...    61   8e-09   Pongo pygmaeus [orang utan]
sp|Q863A7|DYX1_PANTR|DYX1_PANTR Dyslexia susceptibility 1 candidate gene 1 ...    61   8e-09   Pan troglodytes
sp|Q863A6|DYX1_PANPA|DYX1_PANPA Dyslexia susceptibility 1 candidate gene 1 ...    61   8e-09   Pan paniscus [bonobo]
sp|Q8WXU2|DYX1_HUMAN|DYX1_HUMAN Dyslexia susceptibility 1 candidate gene 1 ...    61   8e-09   Homo sapiens [man]
sp|Q863A5|DYX1_GORGO|DYX1_GORGO Dyslexia susceptibility 1 candidate gene 1 ...    61   8e-09   Gorilla gorilla gorilla [lowland gorilla]
gb:BC075517_2558618 Xenopus tropicalis DnaJ (Hsp40) homolog, sub...    60   1e-08   
gb:BC065555_1986884 Homo sapiens translocase of outer mitochondr...    60   1e-08   
gb:AB018262_1864905 Homo sapiens mRNA for KIAA0719 protein, part...    60   1e-08   
gb:AP004119_1837859 Oryza sativa (japonica cultivar-group) genom...    60   1e-08   
gb:AF192467_1775516 Oryza sativa Sgt1 (Sgt1) mRNA, complete cds.       60   1e-08   
gb:BT003919_1637044 Arabidopsis thaliana clone RAFL15-17-L17 (R2...    60   1e-08   
pir|T45682|T45682 hypothetical protein F14P22.210 - Arabidopsis ...    60   1e-08   Arabidopsis thaliana [mouse-ear cress]
sp|O94826|OM70_HUMAN|OM70_HUMAN Mitochondrial precursor proteins import rec...    60   1e-08   Homo sapiens [man]
gb:AY464142_2085482 Mus musculus EKN1 splice variant mRNA, compl...    60   1e-08   
gb:AY428507_2084919 Mus musculus EKN1 mRNA, complete cds, altern...    60   1e-08   
gb:D83327_1994975 Homo sapiens DCRR1 mRNA, partial cds.                60   1e-08   
gb:BC063033_1986085 Homo sapiens tetratricopeptide repeat domain...    60   1e-08   
gb:AF039689_1878196 Homo sapiens antigen NY-CO-7 (NY-CO-7) mRNA,...    60   1e-08   
gb:AE006464_1875625 Homo sapiens 16p13.3 sequence section 3 of 8...    60   1e-08   
gb:AY144871_1583662 Saccharomyces bayanus clone Contig2068 TOM71...    60   1e-08   
gb:AB013395_1512162 Arabidopsis thaliana genomic DNA, chromosome...    60   1e-08   
gb:AK005832_1153253 Mus musculus adult male testis cDNA, RIKEN f...    60   1e-08   
gb:AK004464_1152361 Mus musculus 18-day embryo whole body cDNA, ...    60   1e-08   
gb:AK002752_1151419 Mus musculus adult male kidney cDNA, RIKEN f...    60   1e-08   
sp|P53804|TTC3_HUMAN|TTC3_HUMAN Tetratricopeptide repeat protein 3 (TPR rep...    60   1e-08   Homo sapiens [man]
sp|Q8R368|DYX1_MOUSE|DYX1_MOUSE Dyslexia susceptibility 1 candidate gene 1 ...    60   1e-08   Mus musculus [mouse]
gb:AP005563_1854107 Oryza sativa (japonica cultivar-group) genom...    60   2e-08   
sp|Q9CZW5|OM70_MOUSE|OM70_MOUSE Mitochondrial precursor proteins import rec...    60   2e-08   Mus musculus [mouse]
gb:D84295_1995028 Human mRNA for possible protein TPRDII, comple...    59   2e-08   
gb:AP000370_1819760 Arabidopsis thaliana genomic DNA, chromosome...    59   2e-08   
pir|F69210|F69210 conserved hypothetical protein MTH83 - Methano...    59   2e-08   Methanothermobacter thermautotrophicus str. Delta H
gb:BC003601_1968914 Homo sapiens DnaJ (Hsp40) homolog, subfamily...    59   3e-08   
gb:AF539468_1906406 Homo sapiens ST13-like tumor suppressor mRNA...    59   3e-08   
gb:AE017344_1756112 Cryptococcus neoformans var. neoformans JEC2...    59   3e-08   
gb:BT015327_1642155 Arabidopsis thaliana At1g78120 gene, complet...    59   3e-08   
gb:AE016959_1023341 Oryza sativa (japonica cultivar-group) chrom...    59   3e-08   
pir|S75709|S75709 hypothetical protein sll0886 - Synechocystis s...    59   3e-08   Synechocystis sp. PCC 6803
pir|D96810|D96810 hypothetical protein T11I11.6 [imported] - Ara...    59   3e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AF129085_1885311 Homo sapiens carboxy terminus of Hsp70-inter...    59   4e-08   
pir|AF2421|AF2421 hypothetical protein all4926 [imported] - Nost...    59   4e-08   Nostoc sp. PCC 7120
gb:BC079409_2107522 Rattus norvegicus tetratricopeptide repeat d...    58   5e-08   
gb:CR380950_1649867 Candida glabrata strain CBS138 chromosome D ...    58   5e-08   
gb:AY145026_1583817 Saccharomyces kluyveri clone Contig1574 TOM7...    58   5e-08   
gb:AE005173_893233 Arabidopsis thaliana chromosome 1, bottom arm...    58   5e-08   
gb:AC007087_1535216 Arabidopsis thaliana chromosome 2 clone F14N...    58   7e-08   
gb:AE010877_267283 Methanosarcina acetivorans str. C2A, section ...    58   7e-08   
pir|F84855|F84855 hypothetical protein At2g42580 [imported] - Ar...    58   7e-08   Arabidopsis thaliana [mouse-ear cress]
gb:HS001866_1996406 Homo Sapiens mRNA, partial cDNA sequence for...    57   9e-08   
gb:AJ620883_1812325 Brassica oleracea mRNA for SGT1-like protein...    57   9e-08   
gb:AE017352_1759651 Cryptococcus neoformans var. neoformans JEC2...    57   9e-08   
pir|AF1917|AF1917 hypothetical protein all0889 [imported] - Nost...    57   9e-08   Nostoc sp. PCC 7120
gb:SCDNAPPT1_1707793 S.cerevisiae DNA for protein phosphatase T ...    57   1e-07   
gb:CR380958_1653631 Candida glabrata strain CBS138 chromosome L ...    57   1e-07   
gb:AY336496_1320726 Schistosoma japonicum small glutamine-rich t...    57   1e-07   
sp|P53043|PPT1_YEAST|PPT1_YEAST Serine/threonine protein phosphatase T (EC ...    57   1e-07   Saccharomyces cerevisiae [brewer's yeast]
gb:AY059803_1564647 Arabidopsis thaliana HSP associated protein ...    57   1e-07   
gb:AE017261_419864 Picrophilus torridus DSM 9790, complete genome.     57   1e-07   
gb:AE010481_263587 Fusobacterium nucleatum subsp. nucleatum ATCC...    57   1e-07   
pir|T50013|T50013 hypothetical protein T31P16.80 - Arabidopsis t...    57   1e-07   
pir|T04562|T04562 hypothetical protein T12H17.60 - Arabidopsis t...    57   1e-07   
gb:BC082515_2562750 Xenopus tropicalis MGC89261 protein, mRNA (c...    56   2e-07   
gb:BC077575_2560279 Xenopus laevis dyslexia susceptibility 1 can...    56   2e-07   
gb:AY428509_2532321 Xenopus laevis EKN1 mRNA, complete cds.            56   2e-07   
gb:BC083794_2108862 Rattus norvegicus cDNA clone MGC:94792 IMAGE...    56   2e-07   
gb:HSU28918_2023191 Human progesterone receptor-associated p48 p...    56   2e-07   
gb:AK091777_1913560 Homo sapiens cDNA FLJ34458 fis, clone HLUNG2...    56   2e-07   
gb:AF439975_1800033 Arabidopsis thaliana SGT1a (SGT1a) mRNA, com...    56   2e-07   
gb:AY569436_1615493 Nicotiana benthamiana protein serine/threoni...    56   2e-07   
gb:CR857330_1181574 Pongo pygmaeus mRNA; cDNA DKFZp469F2432 (fro...    56   2e-07   
gb:AE017150_1029778 Trypanosoma brucei chromosome 2, complete se...    56   2e-07   
pir|T05589|T05589 hypothetical protein F9D16.40 - Arabidopsis th...    56   2e-07   
sp|P50502|ST13_HUMAN|ST13_HUMAN Hsc70-interacting protein (Hip) (Putative t...    56   2e-07   
gb:BC088814_2565906 Xenopus tropicalis hypothetical LOC496977, m...    56   2e-07   
gb:AJ719784_2501971 Gallus gallus mRNA for hypothetical protein,...    56   2e-07   
gb:AJ620882_1812324 Brassica oleracea mRNA for SGT1-like protein...    56   2e-07   
gb:AF494083_1805139 Nicotiana benthamiana SGT1 mRNA, complete cds.     56   2e-07   
gb:CNS07EGI_1374504 chromosome IX of strain GB-M1 of Encephalito...    56   2e-07   
gb:AE013478_292678 Methanosarcina mazei strain Goe1, section 260...    56   2e-07   
pir|B69196|B69196 conserved hypothetical protein MTH72 - Methano...    56   2e-07   
gb:AP005321_1850596 Oryza sativa (japonica cultivar-group) genom...    55   3e-07   
gb:AP003215_1825373 Oryza sativa (japonica cultivar-group) genom...    55   3e-07   
gb:AE016814_1745912 Ashbya gossypii (= Eremothecium gossypii) AT...    55   3e-07   
gb:AC104705_1737730 Oryza sativa (japonica cultivar-group) chrom...    55   3e-07   
gb:CR380954_1651379 Candida glabrata strain CBS138 chromosome H ...    55   3e-07   
gb:AK011384_1156369 Mus musculus 10 days embryo whole body cDNA,...    55   3e-07   
gb:AE014134_1128610 Drosophila melanogaster chromosome 2L, compl...    55   3e-07   
gb:BT007511_2150443 Synthetic construct Homo sapiens tetratricop...    55   4e-07   
gb:BC085828_2109388 Rattus norvegicus sperm associated antigen 1...    55   4e-07   
gb:BC013766_2091906 Mus musculus DnaJ (Hsp40) homolog, subfamily...    55   4e-07   
gb:AL139244_1920456 Human DNA sequence from clone RP5-1043G4 on ...    55   4e-07   
gb:AL139244_1920454 Human DNA sequence from clone RP5-1043G4 on ...    55   4e-07   
gb:AY899199_1632046 Nicotiana benthamiana SGT1 mRNA, complete cds.     55   4e-07   
gb:BT020758_1436116 Bos taurus tetratricopeptide repeat domain 4...    55   4e-07   
gb:CR926478_1185635 Pongo pygmaeus mRNA; cDNA DKFZp468E057 (from...    55   4e-07   
gb:AY223080_1176545 Schistosoma japonicum clone ZZD1296 mRNA seq...    55   4e-07   
gb:AK016522_1158757 Mus musculus adult male testis cDNA, RIKEN f...    55   4e-07   
gb:AE017150_1030006 Trypanosoma brucei chromosome 2, complete se...    55   4e-07   
gb:AE016959_1023172 Oryza sativa (japonica cultivar-group) chrom...    55   4e-07   
gb:AE010832_266962 Methanosarcina acetivorans str. C2A, section ...    55   4e-07   
pir|AC2388|AC2388 hypothetical protein all4659 [imported] - Nost...    55   4e-07   
sp|O95801|TTC4_HUMAN|TTC4_HUMAN Tetratricopeptide repeat protein 4 (My044 p...    55   4e-07   
sp|P50503|ST13_RAT|ST13_RAT Hsc70-interacting protein (Hip) (Putative tum...    55   4e-07   
sp|Q99L47|ST13_MOUSE|ST13_MOUSE Hsc70-interacting protein (Hip) (Putative t...    55   4e-07   
gb:BC049406_2550218 Danio rerio zgc:77731, mRNA (cDNA clone MGC:...    55   6e-07   
gb:AY428508_2532320 Xenopus tropicalis dev-stage embryo EKN1 mRN...    55   6e-07   
gb:AE017252_417064 Treponema denticola ATCC 35405, section 7 of ...    55   6e-07   
pir|A56534|A56534 interferon-induced double-stranded RNA-activat...    55   6e-07   
pir|JC4775|JC4775 interferon-induced double-stranded RNA-activat...    55   6e-07   
gb:AF512499_1905578 Homo sapiens FAM10A5 mRNA, complete cds.           54   7e-07   
gb:CR382139_1672180 Debaryomyces hansenii chromosome G of strain...    54   7e-07   
gb:CR382128_1660759 Yarrowia lipolytica chromosome B of strain C...    54   7e-07   
gb:CR858975_1183115 Pongo pygmaeus mRNA; cDNA DKFZp468E125 (from...    54   7e-07   
gb:AE017247_415482 Treponema denticola ATCC 35405, section 2 of ...    54   7e-07   
gb:BC044037_2548443 Xenopus laevis DnaJ (Hsp40) homolog, subfami...    54   9e-07   
gb:AF295376_2485596 Danio rerio interferon-inducible double stra...    54   9e-07   
gb:AF073887_1880948 Homo sapiens tetratricopeptide repeat protei...    54   9e-07   
gb:CR382134_1667211 Debaryomyces hansenii chromosome B of strain...    54   9e-07   
pir|F97870|F97870 O-linked GlcNAc transferase homolog RC1366 [im...    54   9e-07   
gb:BC077246_2559963 Xenopus laevis MGC79131 protein, mRNA (cDNA ...    54   1e-06   
gb:AF311312_1896251 Homo sapiens infertility-related sperm prote...    54   1e-06   
gb:BA000011_664485 Thermoplasma volcanium GSS1 DNA, complete gen...    54   1e-06   
gb:AF516180_1807489 Nicotiana benthamiana SGT1-like protein (SGT...    53   2e-06   
gb:BT015811_1642429 Arabidopsis thaliana At1g56440 gene, complet...    53   2e-06   
pir|T34141|T34141 hypothetical protein C33H5.8 - Caenorhabditis ...    53   2e-06   
gb:AB087254_2047853 Mus musculus Tomm34a, Tomm34b gene for trans...    53   2e-06   
gb:AB087254_2047852 Mus musculus Tomm34a, Tomm34b gene for trans...    53   2e-06   
gb:AB014736_1864655 Homo sapiens mRNA for SMAP-1b, complete cds....    53   2e-06   
gb:AB014729_1864648 Homo sapiens mRNA for SMAP-1, complete cds.        53   2e-06   
gb:AP005317_1850509 Oryza sativa (japonica cultivar-group) genom...    53   2e-06   
gb:AF516181_1807490 Nicotiana benthamiana SGT1-like protein (SGT...    53   2e-06   
gb:BT003221_1356732 Drosophila melanogaster RE03224 full insert ...    53   2e-06   
gb:AY428511_1326002 Ciona intestinalis EKN1 mRNA, complete cds.        53   2e-06   
gb:AK011786_1156594 Mus musculus 10 days embryo whole body cDNA,...    53   2e-06   
gb:AE013599_1133737 Drosophila melanogaster chromosome 2R, compl...    53   2e-06   
gb:AE013519_293050 Methanosarcina mazei strain Goe1, section 301...    53   2e-06   
gb:AE012956_287534 Chlorobium tepidum TLS section 177 of 194 of ...    53   2e-06   
pir|AE1884|AE1884 hypothetical protein alr0622 [imported] - Nost...    53   2e-06   
sp|Q9CYG7|OM34_MOUSE|OM34_MOUSE Mitochondrial import receptor subunit TOM34...    53   2e-06   
gb:BC077200_2559918 Xenopus laevis MGC78939 protein, mRNA (cDNA ...    52   3e-06   
gb:AE016817_1747614 Ashbya gossypii (= Eremothecium gossypii) AT...    52   3e-06   
gb:CR382129_1661378 Yarrowia lipolytica chromosome C of strain C...    52   3e-06   
gb:AC116963_1206827 Dictyostelium discoideum chromosome 2 map 46...    52   3e-06   
gb:AK088684_1175555 Mus musculus 2 days neonate thymus thymic ce...    52   3e-06   
gb:AK012652_1157082 Mus musculus 10, 11 days embryo whole body c...    52   3e-06   
pir|C48583|C48583 stress-inducible protein STI1 homolog - Leishm...    52   3e-06   
pir|AF2277|AF2277 serine/threonine kinase [imported] - Nostoc sp...    52   3e-06   
sp|Q8R3H9|TTC4_MOUSE|TTC4_MOUSE Tetratricopeptide repeat protein 4.>gb:BC02...    52   3e-06   
gb:BC075506_2558607 Xenopus tropicalis MGC89381 protein, mRNA (c...    52   4e-06   
gb:BC070700_2555671 Xenopus laevis hypothetical protein LOC43183...    52   4e-06   
gb:BC059994_2552774 Xenopus laevis Translocase of outer mitochon...    52   4e-06   
gb:BC034833_2097748 Mus musculus WD and tetratricopeptide repeat...    52   4e-06   
gb:AY036906_1560066 Vitis labrusca Hsp70 interacting protein/thi...    52   4e-06   
gb:AX370532_1466395 Sequence 51 from Patent WO0196371.                 52   4e-06   
gb:AE014292_310513 Brucella suis 1330 chromosome II, complete se...    52   4e-06   
pir|AE3551|AE3551 tetratricopeptide repeat family protein BMEII0...    52   4e-06   
pir|D97031|D97031 TPR-repeat-containing protein [imported] - Clo...    52   4e-06   
sp|Q80ZK9|WDT1_MOUSE|WDT1_MOUSE WD and tetratricopeptide repeats protein 1....    52   4e-06   
sp|P07213|OM70_YEAST|OM70_YEAST Mitochondrial precursor proteins import rec...    52   4e-06   
gb:BC065443_2554000 Danio rerio zgc:77731, mRNA (cDNA clone MGC:...    52   5e-06   
gb:ATH344539_1552517 Arabidopsis thaliana partial mRNA for tetra...    52   5e-06   
gb:AE014297_1139887 Drosophila melanogaster chromosome 3R, compl...    52   5e-06   
gb:AE010982_268141 Methanosarcina acetivorans str. C2A, section ...    52   5e-06   
gb:BC046313_2099160 Mus musculus sperm associated antigen 1, mRN...    51   6e-06   
gb:CR382136_1669000 Debaryomyces hansenii chromosome D of strain...    51   6e-06   
gb:BX572605_803529 Rhodopseudomonas palustris CGA009 complete ge...    51   6e-06   
gb:BX572601_802087 Rhodopseudomonas palustris CGA009 complete ge...    51   6e-06   
gb:AE013241_290508 Methanosarcina mazei strain Goe1, section 23 ...    51   6e-06   
pir|JC7111|JC7111 tetratricopeptide repeat-containing protein - ...    51   6e-06   
gb:BC004717_2089733 Mus musculus expressed sequence AW538196, mR...    51   8e-06   
gb:AY084415_1569505 Arabidopsis thaliana clone 107806 mRNA, comp...    51   8e-06   
gb:AY064251_1566061 Arabidopsis thaliana tetratricoredoxin mRNA,...    51   8e-06   
gb:AB019230_1514143 Arabidopsis thaliana genomic DNA, chromosome...    51   8e-06   
gb:AX886245_1481698 Sequence 2108 from Patent EP1033401.               51   8e-06   
gb:BT011560_1358028 Drosophila melanogaster AT19681 full insert ...    51   8e-06   
gb:AK047292_1168064 Mus musculus 10 days neonate cerebellum cDNA...    51   8e-06   
gb:AK028912_1161235 Mus musculus 10 days neonate skin cDNA, RIKE...    51   8e-06   
gb:AE013599_1130250 Drosophila melanogaster chromosome 2R, compl...    51   8e-06   
pir|T13017|T13017 hypothetical protein F8L21.50 - Arabidopsis th...    51   8e-06   
gb:NC2E4_1688511 Neurospora crassa DNA linkage group V Cosmid co...    50   1e-05   
gb:AY144872_1583663 Saccharomyces bayanus clone Contig3082+185 T...    50   1e-05   
gb:AC084153_1205268 Caenorhabditis elegans cosmid Y22D7AL, compl...    50   1e-05   
gb:AP008231_581819 Synechococcus elongatus PCC 6301 DNA, complet...    50   1e-05   
pir|S74806|S74806 hypothetical protein sll1628 - Synechocystis s...    50   1e-05   
pir|E69078|E69078 conserved hypothetical protein MTH1585 - Metha...    50   1e-05   
gb:AK095201_1914310 Homo sapiens cDNA FLJ37882 fis, clone BRSTN2...    50   1e-05   
gb:SCOMPMI1_1708959 Yeast gene for 70kd mitochondrial outer memb...    50   1e-05   
gb:BT001981_1635584 Arabidopsis thaliana expressed protein (At1g...    50   1e-05   
gb:AY085998_1571059 Arabidopsis thaliana clone 205719 mRNA, comp...    50   1e-05   
gb:AY062588_1565244 Arabidopsis thaliana Unknown protein (At2g41...    50   1e-05   
gb:ATT2L20_1555747 Arabidopsis thaliana DNA chromosome 5, BAC cl...    50   1e-05   
gb:AE013595_293672 Methanosarcina mazei strain Goe1, section 377...    50   1e-05   
pir|S75648|S75648 hypothetical protein sll1882 - Synechocystis s...    50   1e-05   
pir|T00808|T00808 hypothetical protein At2g41520 [imported] - Ar...    50   1e-05   
pir|T38535|T38535 probable translocation protein - fission yeast...    50   1e-05   
gb:AF181253_2058057 Mus musculus skin TPR-containing protein inv...    50   2e-05   
gb:AY144973_1583764 Saccharomyces castellii clone Contig1571 TOM...    50   2e-05   
gb:AY093038_1574992 Arabidopsis thaliana unknown protein (At1g62...    50   2e-05   
gb:ATU62745_1557133 Arabidopsis thaliana putative cytoskeletal p...    50   2e-05   
gb:AY118413_1300135 Drosophila melanogaster RE66761 full insert ...    50   2e-05   
gb:AF305085_1260700 Trypanosoma brucei serine/threonine protein ...    50   2e-05   
gb:AK032601_1162988 Mus musculus adult male olfactory brain cDNA...    50   2e-05   
gb:AE014134_1128840 Drosophila melanogaster chromosome 2L, compl...    50   2e-05   
gb:BA000045_744163 Gloeobacter violaceus PCC 7421 DNA, complete ...    50   2e-05   
gb:AE013529_293131 Methanosarcina mazei strain Goe1, section 311...    50   2e-05   
gb:AE010880_267309 Methanosarcina acetivorans str. C2A, section ...    50   2e-05   
pir|T01449|T01449 cytoskeletal protein homolog F24O1.11 - Arabid...    50   2e-05   
gb:AL590640_1929756 Human DNA sequence from clone RP11-40H20 on ...    49   2e-05   
gb:AL590640_1929755 Human DNA sequence from clone RP11-40H20 on ...    49   2e-05   
gb:AB028960_1865816 Homo sapiens mRNA for KIAA1037 protein, part...    49   2e-05   
gb:AY268950_1594024 Chamaecyparis nootkatensis ABI3-interacting ...    49   2e-05   
gb:AX880853_1478443 Sequence 15758 from Patent EP1074617.>gb:AK0...    49   2e-05   
gb:AX880139_1478143 Sequence 15044 from Patent EP1074617.              49   2e-05   
gb:AX877410_1476988 Sequence 12315 from Patent EP1074617.>gb:AK0...    49   2e-05   
gb:AX370534_1466396 Sequence 53 from Patent WO0196371.                 49   2e-05   
gb:BT011142_1357749 Drosophila melanogaster GM02532 full insert ...    49   2e-05   
gb:CR859034_1183174 Pongo pygmaeus mRNA; cDNA DKFZp468P242 (from...    49   2e-05   
gb:BA000040_732840 Bradyrhizobium japonicum USDA 110 DNA, comple...    49   2e-05   
gb:AE017249_416173 Treponema denticola ATCC 35405, section 4 of ...    49   2e-05   
gb:AE010918_267638 Methanosarcina acetivorans str. C2A, section ...    49   2e-05   
sp|Q8N5D0|WDT1_HUMAN|WDT1_HUMAN WD and tetratricopeptide repeats protein 1....    49   2e-05   
sp|Q15785|OM34_HUMAN|OM34_HUMAN Mitochondrial import receptor subunit TOM34...    49   2e-05   
gb:BC079980_2561418 Xenopus laevis MGC80931 protein, mRNA (cDNA ...    49   3e-05   
gb:BC063322_2553522 Danio rerio suppression of tumorigenicity 13...    49   3e-05   
gb:HSU58970_2025074 Human putative outer mitochondrial membrane ...    49   3e-05   
gb:AF110494_1768817 Neurospora crassa mitochondrial precursor pr...    49   3e-05   
gb:AY458642_619689 Uncultured bacterium 560 clone EBAC750-16D01 ...    49   3e-05   
gb:AP006840_568908 Symbiobacterium thermophilum DNA, complete ge...    49   3e-05   
gb:AP006627_563906 Bacillus clausii KSM-K16 DNA, complete genome.      49   3e-05   
pir|E69190|E69190 conserved hypothetical protein MTH68 - Methano...    49   3e-05   
sp|P23231|OM70_NEUCR|OM70_NEUCR Mitochondrial precursor proteins import rec...    49   3e-05   
gb:BC080138_2561569 Xenopus tropicalis CMYA4 protein, mRNA (cDNA...    49   4e-05   
gb:BC062564_1985932 Homo sapiens dyslexia susceptibility 1 candi...    49   4e-05   
gb:S59774_1704324 riboflavin biosynthesis...STI1 stress-inducibl...    49   4e-05   
gb:AY274367_1315113 Drosophila simulans strain sim3 Hsc-70-inter...    49   4e-05   
pir|T37805|T37805 hypothetical protein SPAC17A2.04c - fission ye...    49   4e-05   
sp|P33313|CNS1_YEAST|CNS1_YEAST Cyclophilin seven suppressor 1 (STI1 stress...    49   4e-05   
gb:AJ720971_2503158 Gallus gallus mRNA for hypothetical protein,...    48   5e-05   
gb:AE017344_1756421 Cryptococcus neoformans var. neoformans JEC2...    48   5e-05   
gb:CR380958_1653246 Candida glabrata strain CBS138 chromosome L ...    48   5e-05   
gb:AY123078_1579946 Griffithsia japonica translocase mRNA, parti...    48   5e-05   
gb:AF145622_1244681 Drosophila melanogaster clone GH04245 BcDNA....    48   5e-05   
gb:AE013599_1130127 Drosophila melanogaster chromosome 2R, compl...    48   5e-05   
gb:AE011147_269586 Methanosarcina acetivorans str. C2A, section ...    48   5e-05   
gb:AY458650_620274 Uncultured bacterium 583 clone EBAC750-10A10 ...    48   7e-05   
gb:AE010806_266716 Methanosarcina acetivorans str. C2A, section ...    48   7e-05   
pir|T39019|T39019 probable mitochondrial precursor protein impor...    48   7e-05   
gb:BC048884_2550059 Danio rerio zgc:55684, mRNA (cDNA clone MGC:...    47   9e-05   
gb:AY274378_1315124 Drosophila melanogaster strain XCPA112 Hsc-7...    47   9e-05   
gb:AY059458_1292059 Drosophila melanogaster SD07783 full length ...    47   9e-05   
gb:AE013599_1132567 Drosophila melanogaster chromosome 2R, compl...    47   9e-05   
gb:AE016994_374116 Chlamydophila caviae GPIC section 1 of 4 of t...    47   9e-05   
gb:AE011082_268995 Methanosarcina acetivorans str. C2A, section ...    47   9e-05   
gb:AE010880_267307 Methanosarcina acetivorans str. C2A, section ...    47   9e-05   
gb:SME591792_186875 Sinorhizobium meliloti 1021 complete chromos...    47   9e-05   
pir|H96950|H96950 TPR-repeat-containing protein [imported] - Clo...    47   9e-05   
gb:BC051126_2550404 Danio rerio zgc:56362, mRNA (cDNA clone MGC:...    47   1e-04   
gb:AF539794_1906426 Homo sapiens striated muscle UNC45 (UNC45) m...    47   1e-04   
gb:AE017343_1755430 Cryptococcus neoformans var. neoformans JEC2...    47   1e-04   
gb:ATAC016829_1543645 Arabidopsis thaliana chromosome III BAC T6...    47   1e-04   
gb:AB022219_1515124 Arabidopsis thaliana genomic DNA, chromosome...    47   1e-04   
gb:AY274371_1315117 Drosophila melanogaster strain XCPA7 Hsc-70-...    47   1e-04   
gb:AY274369_1315115 Drosophila melanogaster strain Oregon R Hsc-...    47   1e-04   
gb:AE014298_1124207 Drosophila melanogaster chromosome X, comple...    47   1e-04   
gb:AE016961_367783 Coxiella burnetii strain RSA 493, section 2 o...    47   1e-04   
gb:BC084585_2108985 Mus musculus cardiomyopathy associated 4, mR...    47   2e-04   
gb:AF539793_2067864 Mus musculus striated muscle UNC45 (Unc45) m...    47   2e-04   
gb:AP005725_1856627 Oryza sativa (japonica cultivar-group) genom...    47   2e-04   
gb:AB117794_1200540 Anthocidaris crassispina oad-bp58 mRNA for o...    47   2e-04   
gb:AK081821_1173393 Mus musculus 16 days embryo head cDNA, RIKEN...    47   2e-04   
gb:AK052294_1169969 Mus musculus 13 days embryo heart cDNA, RIKE...    47   2e-04   
gb:AE014297_1141622 Drosophila melanogaster chromosome 3R, compl...    47   2e-04   
gb:BA000040_733883 Bradyrhizobium japonicum USDA 110 DNA, comple...    47   2e-04   
pir|AD2191|AD2191 hypothetical protein all3083 [imported] - Nost...    47   2e-04   
pir|E96950|E96950 TPR-repeat-containing protein [imported] - Clo...    47   2e-04   
gb:AP005873_1859424 Oryza sativa (japonica cultivar-group) genom...    46   2e-04   
gb:AP004837_1845751 Oryza sativa (japonica cultivar-group) genom...    46   2e-04   
gb:OSJN00002_1693080 Oryza sativa genomic DNA, chromosome 4, BAC...    46   2e-04   


>gb:AY080790_1568492 Arabidopsis thaliana unknown protein
           (At1g04190) mRNA, complete cds.>gb:AY114043_1578454
           Arabidopsis thaliana unknown protein (At1g04190) mRNA,
           complete cds.
          Length = 328

 Score =  166 bits (421), Expect = 1e-40
 Identities = 83/112 (74%), Positives = 96/112 (85%)
 Frame = +2

Query: 95  GKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHL 274
           GK T G    + E SLK++GNEFFKAGN+LKAAALYTQAIK DPSN TLYSNRAAAFL L
Sbjct: 6   GKATNG---GEAEKSLKEKGNEFFKAGNFLKAAALYTQAIKLDPSNATLYSNRAAAFLSL 62

Query: 275 VKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           VKL+KALADAE TI L P WEKGYFRKGC+LEAME+Y++AL AF++AL++NP
Sbjct: 63  VKLSKALADAETTIKLNPQWEKGYFRKGCVLEAMEKYEDALAAFEMALQYNP 114



>pir|T00954|T00954 hypothetical protein F20D22.4 - Arabidopsis
           thaliana>gb:AE005172_889437 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:F20D22_1677742 Arabidopsis thaliana
           chromosome 1 BAC F20D22 sequence, complete sequence.
          Length = 358

 Score =  159 bits (403), Expect = 1e-38
 Identities = 83/119 (69%), Positives = 96/119 (80%), Gaps = 7/119 (5%)
 Frame = +2

Query: 95  GKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHL 274
           GK T G    + E SLK++GNEFFKAGN+LKAAALYTQAIK DPSN TLYSNRAAAFL L
Sbjct: 6   GKATNG---GEAEKSLKEKGNEFFKAGNFLKAAALYTQAIKLDPSNATLYSNRAAAFLSL 62

Query: 275 VKLNKALADAEMTISLKPDWEK-------GYFRKGCILEAMERYDEALDAFQIALKHNP 430
           VKL+KALADAE TI L P WEK       GYFRKGC+LEAME+Y++AL AF++AL++NP
Sbjct: 63  VKLSKALADAETTIKLNPQWEKVKSIHDNGYFRKGCVLEAMEKYEDALAAFEMALQYNP 121



>gb:CQ815190_1453516 Sequence 1 from Patent
           EP1422238.>gb:AX134002_1461803 Sequence 1 from Patent
           EP1113073.
          Length = 546

 Score = 97.4 bits (241), Expect = 7e-20
 Identities = 46/97 (47%), Positives = 65/97 (67%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK++GNE F AG Y++A   +++AI+ D  N  LYSNR+A F  + K   AL DA+  IS
Sbjct: 6   LKNKGNEEFSAGRYVEAVNYFSKAIQLDEQNSVLYSNRSACFAAMQKYKDALDDADKCIS 65

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           +KP+W KGY R+G  L  M RYD+A+ A++  LK +P
Sbjct: 66  IKPNWAKGYVRRGAALHGMRRYDDAIAAYEKGLKVDP 102



 Score = 93.2 bits (230), Expect = 1e-18
 Identities = 47/96 (48%), Positives = 64/96 (66%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           KD+GN++FK   + +A A YT+AIK++P+  T YSNRAAA++ L   N AL DAE  I L
Sbjct: 362 KDEGNQYFKEDKFPEAVAAYTEAIKRNPAEHTSYSNRAAAYIKLGAFNDALKDAEKCIEL 421

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           KPD+ KGY RKG      ++Y+ AL A+   LK +P
Sbjct: 422 KPDFVKGYARKGHAYFWTKQYNRALQAYDEGLKVDP 457



 Score = 41.2 bits (95), Expect = 0.006
 Identities = 26/105 (24%), Positives = 49/105 (46%), Gaps = 7/105 (6%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           K  ++LK++GN+ + +  + +A   Y +A  KDP+N     N +A +      +K +A+ 
Sbjct: 221 KEALALKEEGNKLYLSKKFEEALTKYQEAQVKDPNNTLYILNVSAVYFEQGDYDKCIAEC 280

Query: 305 EMTISLKPDWEKGY-------FRKGCILEAMERYDEALDAFQIAL 418
           E  I    +    Y        R    L+   +Y+ A+D ++ AL
Sbjct: 281 EHGIEHGRENHCDYTIIAKLMTRNALCLQRQRKYEAAIDLYKRAL 325



>gb:LMU73845_1388908 Leishmania major protein antigen LmSTI1 mRNA,
           partial cds.
          Length = 545

 Score = 97.4 bits (241), Expect = 7e-20
 Identities = 46/97 (47%), Positives = 65/97 (67%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK++GNE F AG Y++A   +++AI+ D  N  LYSNR+A F  + K   AL DA+  IS
Sbjct: 5   LKNKGNEEFSAGRYVEAVNYFSKAIQLDEQNSVLYSNRSACFAAMQKYKDALDDADKCIS 64

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           +KP+W KGY R+G  L  M RYD+A+ A++  LK +P
Sbjct: 65  IKPNWAKGYVRRGAALHGMRRYDDAIAAYEKGLKVDP 101



 Score = 93.2 bits (230), Expect = 1e-18
 Identities = 47/96 (48%), Positives = 64/96 (66%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           KD+GN++FK   + +A A YT+AIK++P+  T YSNRAAA++ L   N AL DAE  I L
Sbjct: 361 KDEGNQYFKEDKFPEAVAAYTEAIKRNPAEHTSYSNRAAAYIKLGAFNDALKDAEKCIEL 420

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           KPD+ KGY RKG      ++Y+ AL A+   LK +P
Sbjct: 421 KPDFVKGYARKGHAYFWTKQYNRALQAYDEGLKVDP 456



 Score = 41.2 bits (95), Expect = 0.006
 Identities = 26/105 (24%), Positives = 49/105 (46%), Gaps = 7/105 (6%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           K  ++LK++GN+ + +  + +A   Y +A  KDP+N     N +A +      +K +A+ 
Sbjct: 220 KEALALKEEGNKLYLSKKFEEALTKYQEAQVKDPNNTLYILNVSAVYFEQGDYDKCIAEC 279

Query: 305 EMTISLKPDWEKGY-------FRKGCILEAMERYDEALDAFQIAL 418
           E  I    +    Y        R    L+   +Y+ A+D ++ AL
Sbjct: 280 EHGIEHGRENHCDYTIIAKLMTRNALCLQRQRKYEAAIDLYKRAL 324



>gb:BC064232_2553785 Xenopus tropicalis hypothetical protein
           MGC76181, mRNA (cDNA clone MGC:76181 IMAGE:5335741),
           complete cds.
          Length = 543

 Score = 96.3 bits (238), Expect = 2e-19
 Identities = 46/98 (46%), Positives = 62/98 (63%)
 Frame = +2

Query: 137 SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTI 316
           +LK++GN+   AG+  +A   YT+AIK DP N  LYSNR+AAF    +  KAL D   T+
Sbjct: 6   ALKEKGNKALSAGDLDEAVKCYTEAIKLDPKNHVLYSNRSAAFAKKKEFTKALEDGGKTV 65

Query: 317 SLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            LKPDW KGY RK   LE + R++EA   ++  L+H P
Sbjct: 66  ELKPDWGKGYSRKAAALEFLNRFEEAKKTYEEGLRHEP 103



 Score = 87.4 bits (215), Expect = 8e-17
 Identities = 43/93 (46%), Positives = 63/93 (67%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K +GNE F+ G+Y +A   YT+AIK++P++  LYSNRAA +  L++   AL D E  I L
Sbjct: 364 KSKGNESFQKGDYPQAMKHYTEAIKRNPNDAKLYSNRAACYTKLLEFQLALKDCEECIRL 423

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
           +P + KGY RK   LEAM+ Y +A+D +Q A++
Sbjct: 424 EPKFIKGYTRKAAALEAMKDYSKAMDVYQKAME 456



 Score = 37.7 bits (86), Expect = 0.070
 Identities = 30/99 (30%), Positives = 45/99 (45%), Gaps = 7/99 (7%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K+ GNE +K  ++  A   Y QA + DP+N T  +N+AA +      NK     E  I +
Sbjct: 229 KELGNEAYKKKDFETALKHYGQAQELDPTNMTYITNQAAVYFEQGDYNKCRELCEKAIEV 288

Query: 323 ----KPDWE---KGYFRKGCILEAMERYDEALDAFQIAL 418
               + D+    K Y R G      E+  EA+  F  +L
Sbjct: 289 GRENREDYRQIAKAYARIGNSYFKEEKNKEAIHFFNKSL 327



>gb:BC046709_2549698 Xenopus laevis stress-induced-phosphoprotein 1
           (Hsp70/Hsp90-organizing protein), mRNA (cDNA clone
           MGC:53256 IMAGE:5543683), complete cds.
          Length = 543

 Score = 94.7 bits (234), Expect = 5e-19
 Identities = 45/98 (45%), Positives = 61/98 (62%)
 Frame = +2

Query: 137 SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTI 316
           +LK++GN+   AGN  +A   YT+AIK DP N  LYSNR+AA+    +  KAL D   T+
Sbjct: 6   ALKEKGNKALSAGNLDEAVKCYTEAIKLDPKNHVLYSNRSAAYAKKKEFTKALEDGSKTV 65

Query: 317 SLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            LK DW KGY RK   LE + R++EA   ++  L+H P
Sbjct: 66  ELKADWGKGYSRKAAALEFLNRFEEAKKTYEEGLRHEP 103



 Score = 84.0 bits (206), Expect = 9e-16
 Identities = 41/93 (44%), Positives = 65/93 (69%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K++GNE F+ G+Y +A   Y++AIK++P++  LYSNRAA +  L++   A+ D E  I L
Sbjct: 364 KNKGNESFQKGDYPQAMKHYSEAIKRNPNDAKLYSNRAACYTKLLEFLLAVKDCEECIRL 423

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
           +P + KGY RK   LEAM+ + +A+DA+Q A++
Sbjct: 424 EPSFIKGYTRKAAALEAMKDFTKAMDAYQKAME 456



 Score = 37.7 bits (86), Expect = 0.070
 Identities = 29/99 (29%), Positives = 46/99 (46%), Gaps = 7/99 (7%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K+ GNE +K  ++  A   Y QA + DP+N T  +N+AA +  +   +K     E  I +
Sbjct: 229 KELGNEAYKKKDFETALKHYGQARELDPANMTYITNQAAVYFEMGDYSKCRELCEKAIEV 288

Query: 323 ----KPDWE---KGYFRKGCILEAMERYDEALDAFQIAL 418
               + D+    K Y R G      E+  EA+  F  +L
Sbjct: 289 GRENREDYRLIAKAYARIGNSYFKEEKNKEAIQFFNKSL 327



>gb:AF506290_2498574 Xenopus laevis stress-induced phosphoprotein
           STI1 mRNA, complete cds.
          Length = 543

 Score = 94.7 bits (234), Expect = 5e-19
 Identities = 45/98 (45%), Positives = 61/98 (62%)
 Frame = +2

Query: 137 SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTI 316
           +LK++GN+   AGN  +A   YT+AIK DP N  LYSNR+AA+    +  KAL D   T+
Sbjct: 6   ALKEKGNKALSAGNLDEAVKCYTEAIKLDPKNHVLYSNRSAAYAKKKEFTKALEDGSKTV 65

Query: 317 SLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            LK DW KGY RK   LE + R++EA   ++  L+H P
Sbjct: 66  ELKADWGKGYSRKAAALEFLNRFEEAKKTYEEGLRHEP 103



 Score = 84.0 bits (206), Expect = 9e-16
 Identities = 41/93 (44%), Positives = 65/93 (69%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K++GNE F+ G+Y +A   Y++AIK++P++  LYSNRAA +  L++   A+ D E  I L
Sbjct: 364 KNKGNESFQKGDYPQAMKHYSEAIKRNPNDAKLYSNRAACYTKLLEFLLAVKDCEECIRL 423

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
           +P + KGY RK   LEAM+ + +A+DA+Q A++
Sbjct: 424 EPSFIKGYTRKAAALEAMKDFTKAMDAYQKAME 456



 Score = 39.3 bits (90), Expect = 0.024
 Identities = 31/105 (29%), Positives = 48/105 (45%), Gaps = 7/105 (6%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           KR    K+ GNE +K  ++  A   Y QA + DP+N T  +N+AA +  +   +K     
Sbjct: 223 KRAQKEKELGNEAYKKKDFETALKHYGQARELDPANMTYITNQAAVYFEMGDYSKCRELC 282

Query: 305 EMTISL----KPDWE---KGYFRKGCILEAMERYDEALDAFQIAL 418
           E  I +    + D+    K Y R G      E+  EA+  F  +L
Sbjct: 283 EKAIEVGRENREDYRLIAKAYARIGNSYFKEEKNKEAIQFFNKSL 327



>gb:AC084406_1733631 Oryza sativa chromosome 3 BAC OSJNBa0067E01
           genomic sequence, complete sequence.
          Length = 485

 Score = 94.0 bits (232), Expect = 8e-19
 Identities = 47/105 (44%), Positives = 63/105 (60%)
 Frame = +2

Query: 116 SDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKAL 295
           SD  R+  LK  G + F+ G+Y  A   YT+A+K DP++ TLYSNR+   L      +AL
Sbjct: 351 SDGDRKSKLKLHGGKAFEEGDYAGAIIFYTEAMKLDPADATLYSNRSLCHLRSGAAQEAL 410

Query: 296 ADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            DA   I LKP+W KG++RKGC   A++ Y+EA  AF    K NP
Sbjct: 411 LDANDCIKLKPEWTKGHYRKGCAHMALKEYEEACTAFMAGTKLNP 455



>gb:OSJN00020_1693413 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0091D06, complete sequence.
          Length = 746

 Score = 92.4 bits (228), Expect = 2e-18
 Identities = 46/107 (42%), Positives = 65/107 (60%)
 Frame = +2

Query: 110 GDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNK 289
           GD D    +     GNEFFK   Y +A   Y++A++++P +P +YSNRAA +  L  + +
Sbjct: 556 GDEDETLILVHSCAGNEFFKQQKYPEAVKHYSEALRRNPKDPRVYSNRAACYTKLGAMPE 615

Query: 290 ALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            L DAE  I L P + KGY RKG I   M+ YD+AL+ +Q  LKH+P
Sbjct: 616 GLKDAEKCIELDPTFSKGYTRKGAIQFFMKEYDKALETYQAGLKHDP 662



 Score = 73.9 bits (180), Expect = 9e-13
 Identities = 41/96 (42%), Positives = 56/96 (58%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K +GN  F AG + +AAA +T AI   P N  LYSNR+AA+  L +  +ALADAE T++L
Sbjct: 169 KAKGNAAFSAGRFEEAAAHFTDAIALAPDNHVLYSNRSAAYASLHRYPEALADAERTVAL 228

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           +PDW KG  R G     +     A+ A++  L   P
Sbjct: 229 RPDWAKGCSRLGAARLGLGDAAGAVAAYEKGLALEP 264



 Score = 37.7 bits (86), Expect = 0.070
 Identities = 28/103 (27%), Positives = 53/103 (51%), Gaps = 11/103 (10%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTI-- 316
           K+ GN  +K  ++  A   YT+A++ D  + +  +NRAA +L + K ++ + D +  +  
Sbjct: 414 KEAGNAAYKK-DFETAIQHYTKAMELDDEDVSYLTNRAAVYLEMGKYDECINDCDKAVER 472

Query: 317 --SLKPDWE---KGYFRKGC----ILEAMERYDEALDAFQIAL 418
              L  D++   +   RKG     I +  + YD A++ +Q AL
Sbjct: 473 GRELHADFKIISRALTRKGTALAKIAKCFKDYDVAIETYQKAL 515



>gb:AP005291_1849977 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1282_H11.
          Length = 578

 Score = 90.9 bits (224), Expect = 7e-18
 Identities = 44/104 (42%), Positives = 64/104 (61%)
 Frame = +2

Query: 119 DAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALA 298
           D K     +++GN+ FK   Y  A   YT+AI+++P +P +YSNRAA +  L  + + L 
Sbjct: 385 DPKLADEEREKGNQLFKEQKYPDAVKHYTEAIRRNPKDPKVYSNRAACYTKLGAMPEGLK 444

Query: 299 DAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           DAE  I L P + KGY RKG I   M+ YD+A++ +Q  LKH+P
Sbjct: 445 DAEKCIELDPTFSKGYTRKGAIQFFMKEYDKAMETYQAGLKHDP 488



 Score = 77.4 bits (189), Expect = 8e-14
 Identities = 42/96 (43%), Positives = 56/96 (58%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K +GN  F AG Y +AA  +T AI   P N  LYSNR+AA   + + ++ALADAE T+ L
Sbjct: 6   KAKGNAAFSAGRYEEAARHFTDAIALAPGNHVLYSNRSAALASVHRYSEALADAEKTVEL 65

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           KPDW KGY R G     +     A+ A++  L  +P
Sbjct: 66  KPDWAKGYSRLGAAHLGLGDAASAVAAYEKGLALDP 101



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 31/112 (27%), Positives = 59/112 (52%), Gaps = 11/112 (9%)
 Frame = +2

Query: 116 SDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKAL 295
           S A++E   K+ GN  +K  ++  A   YT+A++ D  + +  +NRAA ++ + K ++ +
Sbjct: 248 SSAQKE---KEAGNAAYKKKDFETAIQHYTKAMELDDEDISYLTNRAAVYIEMGKYDECI 304

Query: 296 ADAEMTI----SLKPDWE---KGYFRKGCILEAMER----YDEALDAFQIAL 418
            D +  +     L+ D++   +   RKG  L  + +    YD A++ FQ AL
Sbjct: 305 KDCDKAVERGRELRADFKMISRALTRKGTALAKLAKTSKDYDIAIETFQKAL 356



>pir|S56658|S56658 stress-induced protein sti1 - soybean
          Length = 569

 Score = 90.1 bits (222), Expect = 1e-17
 Identities = 44/104 (42%), Positives = 64/104 (61%)
 Frame = +2

Query: 119 DAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALA 298
           D K     +++GNE FK   Y +A   YT+AIK++P +   YSNRAA +  L  + + L 
Sbjct: 377 DPKLADEAREKGNELFKQQKYPEATKHYTEAIKRNPKDAKAYSNRAACYTKLGAMPEGLK 436

Query: 299 DAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           DAE  I L P + KGY RKG +  +M+ YD+AL+ ++  LKH+P
Sbjct: 437 DAEKCIELDPTFSKGYTRKGAVQFSMKEYDKALETYREGLKHDP 480



 Score = 59.3 bits (142), Expect = 2e-08
 Identities = 36/96 (37%), Positives = 49/96 (51%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K +GN  F AG++  A    + AI   PSN  LYSNR+AA L   +L    +  + T+ L
Sbjct: 6   KAKGNAAFSAGDFAAAVRHLSDAIALSPSNHVLYSNRSAATLP-PELRGGPSRRQKTVDL 64

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           KPDW K Y R G     + R+ +A    + A   NP
Sbjct: 65  KPDWPKAYSRLGAAHLGLRRHRDASPPTKPASNSNP 100



>sp|Q43468|STIP_SOYBN Heat shock protein STI (Stress inducible
           protein) (GmSTI).>gb:GMWSTI_1680764 Glycine max gmsti
           mRNA.
          Length = 569

 Score = 90.1 bits (222), Expect = 1e-17
 Identities = 44/104 (42%), Positives = 64/104 (61%)
 Frame = +2

Query: 119 DAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALA 298
           D K     +++GNE FK   Y +A   YT+AIK++P +   YSNRAA +  L  + + L 
Sbjct: 377 DPKLADEAREKGNELFKQQKYPEATKHYTEAIKRNPKDAKAYSNRAACYTKLGAMPEGLK 436

Query: 299 DAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           DAE  I L P + KGY RKG +  +M+ YD+AL+ ++  LKH+P
Sbjct: 437 DAEKCIELDPTFSKGYTRKGAVQFSMKEYDKALETYREGLKHDP 480



 Score = 60.8 bits (146), Expect = 8e-09
 Identities = 36/96 (37%), Positives = 50/96 (52%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K +GN  F AG++  A   ++ AI   PSN  LYSNR+AA L   +L    +  + T+ L
Sbjct: 6   KAKGNAAFSAGDFAAAVRHFSDAIALSPSNHVLYSNRSAATLP-PELRGGPSRRQKTVDL 64

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           KPDW K Y R G     + R+ +A    + A   NP
Sbjct: 65  KPDWPKAYSRLGAAHLGLRRHRDASPPTKPASNSNP 100



>gb:AC084406_1733626 Oryza sativa chromosome 3 BAC OSJNBa0067E01
           genomic sequence, complete sequence.
          Length = 258

 Score = 89.7 bits (221), Expect = 2e-17
 Identities = 47/115 (40%), Positives = 73/115 (63%)
 Frame = +2

Query: 86  FLKGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAF 265
           FL+G++    SD K E  LK QG +  K  +YL A+ +YT+A++ D  + TLYSNR+  +
Sbjct: 120 FLQGESCSKVSDRKAE--LKSQGEKAVKRKDYLAASKIYTKALELDYFDATLYSNRSLCY 177

Query: 266 LHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L + K  KAL DA+  + L+P W KG++R+G  L  ++ + +A +AF  ALK +P
Sbjct: 178 LQIGKAQKALLDAKKCVKLRPKWMKGHYREGAALMLLKEHKKAFEAFLNALKLDP 232



>gb:AF107772_1241864 Trypanosoma cruzi TcSTI1 (STI1) mRNA, complete
           cds.
          Length = 565

 Score = 89.7 bits (221), Expect = 2e-17
 Identities = 43/85 (50%), Positives = 56/85 (65%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK++GN+ F +G Y +AA  ++QAI  DPSN  LYSNR+A    L +   AL DAE  +S
Sbjct: 6   LKNRGNQEFSSGRYKEAAEFFSQAINLDPSNHVLYSNRSACHAALHQYPNALQDAEKCVS 65

Query: 320 LKPDWEKGYFRKGCILEAMERYDEA 394
           +KPDW KGY RKG  L  + RY+ A
Sbjct: 66  IKPDWVKGYVRKGAALHGLRRYETA 90



 Score = 89.0 bits (219), Expect = 3e-17
 Identities = 45/103 (43%), Positives = 68/103 (66%)
 Frame = +2

Query: 119 DAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALA 298
           D +  +  K++GN FFK+  + +A   YT+AIK++P   T YSNRAAA+L L   ++ALA
Sbjct: 363 DPEIALQKKEEGNTFFKSDKFPEAVEAYTEAIKRNPDEHTTYSNRAAAYLKLGAYSQALA 422

Query: 299 DAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHN 427
           DAE  ISLKP++ K + R+G      ++Y++AL A+   LKH+
Sbjct: 423 DAEKCISLKPEFVKAHARRGHAFFWTKQYNKALQAYDEGLKHD 465



>gb:AF512999_1807387 Medicago sativa TPR1 (tpr1) mRNA, complete cds.
          Length = 346

 Score = 89.4 bits (220), Expect = 2e-17
 Identities = 42/95 (44%), Positives = 62/95 (65%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           +++GNE+FK   Y +A   YT++IK++P NP  YSNRAA +  L  + + L DAE  I L
Sbjct: 161 REKGNEYFKQQKYPEAIKHYTESIKRNPKNPKAYSNRAACYTKLGAMPEGLKDAEKCIEL 220

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHN 427
            P + KGY RKG +   M+ Y++AL+ +Q  LKH+
Sbjct: 221 DPTFTKGYTRKGAVQFFMKEYEKALETYQEGLKHD 255



>gb:AY140001_1582442 Arabidopsis thaliana stress-induced protein
           sti1-like protein (At4g12400) mRNA, complete cds.
          Length = 530

 Score = 89.4 bits (220), Expect = 2e-17
 Identities = 41/96 (42%), Positives = 63/96 (65%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K +GN  F +G+Y  A   +T+AI   P+N  LYSNR+A++  L +  +AL+DA+ TI L
Sbjct: 6   KSKGNAAFSSGDYATAITHFTEAINLSPTNHILYSNRSASYASLHRYEEALSDAKKTIEL 65

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           KPDW KGY R G     + ++DEA+D+++  L+ +P
Sbjct: 66  KPDWSKGYSRLGAAFIGLSKFDEAVDSYKKGLEIDP 101



 Score = 86.7 bits (213), Expect = 1e-16
 Identities = 43/96 (44%), Positives = 61/96 (63%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           + +GN FFK   Y +A   Y++AIK++P++   YSNRAA +  L  L + L DAE  I L
Sbjct: 373 RKKGNGFFKEQKYPEAVKHYSEAIKRNPNDVRAYSNRAACYTKLGALPEGLKDAEKCIEL 432

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            P + KGY RKG I   M+ YD+A++ +Q  LKH+P
Sbjct: 433 DPSFTKGYSRKGAIQFFMKEYDKAMETYQEGLKHDP 468



 Score = 44.7 bits (104), Expect = 6e-04
 Identities = 31/111 (27%), Positives = 60/111 (54%), Gaps = 13/111 (11%)
 Frame = +2

Query: 125 KREVSLKD--QGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALA 298
           ++E +LK+  +GN  +K  ++ +A   YT+A++ D  + +  +NRAA +L + K  + + 
Sbjct: 226 RKEKALKEKGEGNVAYKKKDFGRAVEHYTKAMELDDEDISYLTNRAAVYLEMGKYEECIE 285

Query: 299 DAEMTI----SLKPDWE---KGYFRKGCILEAMER----YDEALDAFQIAL 418
           D +  +     L+ D++   +   RKG  L  M R    ++ A++ FQ AL
Sbjct: 286 DCDKAVERGRELRSDFKMIARALTRKGSALVKMARCSKDFEPAIETFQKAL 336



>gb:ACU89984_1208397 Acanthamoeba castellanii
           transformation-sensitive protein homolog mRNA, complete
           cds.
          Length = 564

 Score = 89.4 bits (220), Expect = 2e-17
 Identities = 45/96 (46%), Positives = 59/96 (61%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K++GN    AG++  A   YT AI+ DP N  LYSNR+AA+  L   ++ALAD E T+ L
Sbjct: 9   KNKGNAAMSAGDFKAAVEHYTNAIQHDPQNHVLYSNRSAAYASLKDYDQALADGEKTVEL 68

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           KPDW KGY RKG  L  + RY +A  A+   L+  P
Sbjct: 69  KPDWSKGYSRKGAALCYLGRYADAKAAYAAGLEVEP 104



 Score = 72.0 bits (175), Expect = 3e-12
 Identities = 35/96 (36%), Positives = 58/96 (60%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K++GN+ F+   Y  A   YT+AI+++P++  LYSNRAA ++ L ++  A+ D +  I L
Sbjct: 380 KEKGNDCFRNAQYPDAIKHYTEAIRRNPTDHVLYSNRAACYMKLGRVPMAVKDCDKAIEL 439

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            P + K Y RKG     M++Y + L+ ++  LK  P
Sbjct: 440 SPTFVKAYTRKGHCQFFMKQYHKCLETYEQGLKVEP 475



 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 29/108 (26%), Positives = 54/108 (50%), Gaps = 7/108 (6%)
 Frame = +2

Query: 116 SDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVK----L 283
           ++ K+ +  K+ GN+ +K  ++  A   Y +A + DP N T  +N AA ++        +
Sbjct: 236 TEKKQALEEKELGNQAYKKKDFDTAIVHYKKAFELDPDNMTYLTNLAAVYMEQKNYEECV 295

Query: 284 NKALADAEMTISLKPDWE---KGYFRKGCILEAMERYDEALDAFQIAL 418
           N      E+   +  D++   + + RKG     ME+Y EA+D++  AL
Sbjct: 296 NTCTEAIEVGRRVFADYKLISRAFHRKGNAYMKMEKYAEAIDSYNRAL 343



>pir|T48150|T48150 stress-induced protein sti1-like protein -
           Arabidopsis thaliana>gb:ATCHRIV34_1545005 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           34.>gb:ATT4C9_1556007 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T4C9 (ESSA project).
          Length = 558

 Score = 89.4 bits (220), Expect = 2e-17
 Identities = 41/96 (42%), Positives = 63/96 (65%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K +GN  F +G+Y  A   +T+AI   P+N  LYSNR+A++  L +  +AL+DA+ TI L
Sbjct: 6   KSKGNAAFSSGDYATAITHFTEAINLSPTNHILYSNRSASYASLHRYEEALSDAKKTIEL 65

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           KPDW KGY R G     + ++DEA+D+++  L+ +P
Sbjct: 66  KPDWSKGYSRLGAAFIGLSKFDEAVDSYKKGLEIDP 101



 Score = 87.8 bits (216), Expect = 6e-17
 Identities = 43/96 (44%), Positives = 62/96 (64%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           +++GN FFK   Y +A   Y++AIK++P++   YSNRAA +  L  L + L DAE  I L
Sbjct: 373 REKGNGFFKEQKYPEAVKHYSEAIKRNPNDVRAYSNRAACYTKLGALPEGLKDAEKCIEL 432

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            P + KGY RKG I   M+ YD+A++ +Q  LKH+P
Sbjct: 433 DPSFTKGYSRKGAIQFFMKEYDKAMETYQEGLKHDP 468



 Score = 44.7 bits (104), Expect = 6e-04
 Identities = 31/111 (27%), Positives = 60/111 (54%), Gaps = 13/111 (11%)
 Frame = +2

Query: 125 KREVSLKD--QGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALA 298
           ++E +LK+  +GN  +K  ++ +A   YT+A++ D  + +  +NRAA +L + K  + + 
Sbjct: 226 RKEKALKEKGEGNVAYKKKDFGRAVEHYTKAMELDDEDISYLTNRAAVYLEMGKYEECIE 285

Query: 299 DAEMTI----SLKPDWE---KGYFRKGCILEAMER----YDEALDAFQIAL 418
           D +  +     L+ D++   +   RKG  L  M R    ++ A++ FQ AL
Sbjct: 286 DCDKAVERGRELRSDFKMIARALTRKGSALVKMARCSKDFEPAIETFQKAL 336



>gb:BT015924_1642542 Arabidopsis thaliana At1g62740 gene, complete
           cds.>gb:BT020538_1642932 Arabidopsis thaliana At1g62740
           gene, complete cds.
          Length = 571

 Score = 89.0 bits (219), Expect = 3e-17
 Identities = 42/96 (43%), Positives = 61/96 (63%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           +++GN+FFK   Y  A   YT+AIK++P +P  YSNRAA +  L  + + L DAE  I L
Sbjct: 386 REKGNDFFKEQKYPDAVRHYTEAIKRNPKDPRAYSNRAACYTKLGAMPEGLKDAEKCIEL 445

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            P + KGY RKG +   M+ YD A++ +Q  L+H+P
Sbjct: 446 DPTFLKGYSRKGAVQFFMKEYDNAMETYQKGLEHDP 481



 Score = 79.3 bits (194), Expect = 2e-14
 Identities = 39/96 (40%), Positives = 60/96 (62%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K +GN  F +G++  A   +T AI   P+N  L+SNR+AA   L   ++AL+DA+ T+ L
Sbjct: 6   KAKGNAAFSSGDFNSAVNHFTDAINLTPTNHVLFSNRSAAHASLNHYDEALSDAKKTVEL 65

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           KPDW KGY R G     + ++DEA++A+   L+ +P
Sbjct: 66  KPDWGKGYSRLGAAHLGLNQFDEAVEAYSKGLEIDP 101



>gb:BT005735_1638667 Arabidopsis thaliana clone RAFL15-47-M19
           (R20937) putative TPR-repeat protein (At1g62740) mRNA,
           complete cds.
          Length = 571

 Score = 89.0 bits (219), Expect = 3e-17
 Identities = 42/96 (43%), Positives = 61/96 (63%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           +++GN+FFK   Y  A   YT+AIK++P +P  YSNRAA +  L  + + L DAE  I L
Sbjct: 386 REKGNDFFKEQKYPDAVRHYTEAIKRNPKDPRAYSNRAACYTKLGAMPEGLKDAEKCIEL 445

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            P + KGY RKG +   M+ YD A++ +Q  L+H+P
Sbjct: 446 DPTFLKGYSRKGAVQFFMKEYDNAMETYQKGLEHDP 481



 Score = 79.3 bits (194), Expect = 2e-14
 Identities = 39/96 (40%), Positives = 60/96 (62%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K +GN  F +G++  A   +T AI   P+N  L+SNR+AA   L   ++AL+DA+ T+ L
Sbjct: 6   KAKGNAAFSSGDFNSAVNHFTDAINLTPTNHVLFSNRSAAHASLNHYDEALSDAKKTVEL 65

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           KPDW KGY R G     + ++DEA++A+   L+ +P
Sbjct: 66  KPDWGKGYSRLGAAHLGLNQFDEAVEAYSKGLEIDP 101



>gb:BC085642_2564520 Danio rerio zgc:92133, mRNA (cDNA clone
           MGC:92133 IMAGE:7049124), complete cds.
          Length = 542

 Score = 88.6 bits (218), Expect = 3e-17
 Identities = 45/97 (46%), Positives = 59/97 (60%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LKDQGN+   AGN  +A   YT+A+  DPSN  L+SNR+AA+      + AL DA  TI 
Sbjct: 7   LKDQGNKALSAGNLEEAIRCYTEALTLDPSNHVLFSNRSAAYAKKGDYDNALKDACQTIK 66

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           +KPDW KGY RK   LE + R ++A   +Q  L+  P
Sbjct: 67  IKPDWGKGYSRKAAALEFLGRLEDAKATYQEGLRQEP 103



 Score = 79.7 bits (195), Expect = 2e-14
 Identities = 40/93 (43%), Positives = 62/93 (66%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K++GN+ F+ G+Y  A   Y++AIK++P +  L+SNRAA +  L++   AL D E  I+L
Sbjct: 363 KNKGNDAFQKGDYPLAMKHYSEAIKRNPYDAKLFSNRAACYTKLLEFQLALKDCEECINL 422

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
              + KGY RKG  LEAM+ + +A+D +Q AL+
Sbjct: 423 DSTFIKGYTRKGAALEAMKDFSKAMDVYQKALE 455



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 31/99 (31%), Positives = 46/99 (46%), Gaps = 7/99 (7%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K+ GN  +K  ++  A   Y +AIK DP+N T  SN+AA +      +K     E  I +
Sbjct: 228 KELGNAAYKKKDFATALKHYEEAIKHDPTNMTYLSNQAAVYFEKGDFDKCRELCEKAIDV 287

Query: 323 ----KPDWE---KGYFRKGCILEAMERYDEALDAFQIAL 418
               + D+    K Y R G      E+Y EA+  F  +L
Sbjct: 288 GRENREDYRQIAKAYARIGNSYFKQEKYKEAVQFFNKSL 326



>gb:AF039202_2051899 Cricetulus griseus Hsp70/Hsp90 organizing
           protein mRNA, complete cds.
          Length = 543

 Score = 88.2 bits (217), Expect = 5e-17
 Identities = 44/93 (47%), Positives = 63/93 (67%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K++GNE F+ G+Y +A   YT+AIK++P +  LYSNRAA +  L++   AL D E  I L
Sbjct: 364 KNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQL 423

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
           +P + KGY RK   LEAM+ Y +A+D +Q AL+
Sbjct: 424 EPTFIKGYTRKAAALEAMKDYTKAMDVYQKALE 456



 Score = 87.8 bits (216), Expect = 6e-17
 Identities = 44/95 (46%), Positives = 57/95 (60%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK++GN+   AGN   A   Y++AIK DP N  LYSNR+AA+       KA  D   T+ 
Sbjct: 7   LKEKGNKALSAGNIDDALQCYSEAIKLDPQNHVLYSNRSAAYAKKGDYQKAYEDGCKTVD 66

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALKH 424
           LKPDW KGY RK   LE + R++EA   ++  LKH
Sbjct: 67  LKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKH 101



 Score = 38.9 bits (89), Expect = 0.031
 Identities = 30/105 (28%), Positives = 48/105 (45%), Gaps = 7/105 (6%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           K+ +  K+ GNE +K  ++  A   Y +A + DP+N T  +N+AA        NK     
Sbjct: 223 KQALKEKEMGNEAYKKKDFDMALKHYDRAKELDPTNMTYITNQAAVHFEKGDYNKCRELC 282

Query: 305 EMTISL----KPDWE---KGYFRKGCILEAMERYDEALDAFQIAL 418
           E  I +    + D+    K Y R G      ERY +A+  +  +L
Sbjct: 283 EKAIEVGRENREDYRQIAKAYARIGNSYFKEERYKDAIHFYNKSL 327



>gb:AC084406_1733628 Oryza sativa chromosome 3 BAC OSJNBa0067E01
           genomic sequence, complete sequence.
          Length = 472

 Score = 88.2 bits (217), Expect = 5e-17
 Identities = 45/124 (36%), Positives = 73/124 (58%), Gaps = 2/124 (1%)
 Frame = +2

Query: 65  LTQISANFLKGKTTMGDSDA--KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPT 238
           +T + +   K K    D ++   ++  LK  G    +  +Y+ A+  Y++AI+ DP++ T
Sbjct: 319 ITHVKSKKSKKKACAQDKESGTDKKAQLKSLGASAVQGKDYVGASKFYSEAIQLDPTDAT 378

Query: 239 LYSNRAAAFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIAL 418
           L+SNR+  +L   +  +AL DA+  I LKPDW KGY+RKG  L +++ Y EA DAF   +
Sbjct: 379 LHSNRSFCYLKSGEAREALVDAKTCIGLKPDWPKGYYRKGAALMSLKEYKEACDAFMDGV 438

Query: 419 KHNP 430
           K +P
Sbjct: 439 KLDP 442



>gb:AE014134_1126843 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003590_1216851 Drosophila melanogaster
           chromosome 2L, section 1 of 83 of the complete sequence.
          Length = 490

 Score = 88.2 bits (217), Expect = 5e-17
 Identities = 48/123 (39%), Positives = 74/123 (60%)
 Frame = +2

Query: 62  TLTQISANFLKGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTL 241
           +L+++ A  +K +  M   + ++    K+QGN FFK G+Y  A   YT+AIK++P +P L
Sbjct: 288 SLSEVEAK-IKEEERMAYINPEKAEEEKEQGNLFFKKGDYSTAVKHYTEAIKRNPDDPKL 346

Query: 242 YSNRAAAFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
           YSNRAA +  L   +  L D +  I L   + KGY RKG IL+ M++  +A  A+Q AL+
Sbjct: 347 YSNRAACYTKLAAFDLGLKDCDTCIKLDEKFIKGYIRKGKILQGMQQQSKAQAAYQKALE 406

Query: 422 HNP 430
            +P
Sbjct: 407 LDP 409



 Score = 85.9 bits (211), Expect = 2e-16
 Identities = 43/97 (44%), Positives = 58/97 (59%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK++GN+   A  + +A A YT+AI  D  N  LYSNR+AAF    K  +AL DAE TI 
Sbjct: 7   LKEKGNQALSAEKFDEAVAAYTEAIALDDQNHVLYSNRSAAFAKAGKFQEALEDAEKTIQ 66

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L P W KGY RKG     +  + +A +A+   LK++P
Sbjct: 67  LNPTWPKGYSRKGAAAAGLNDFMKAFEAYNEGLKYDP 103



 Score = 35.0 bits (79), Expect = 0.45
 Identities = 25/102 (24%), Positives = 47/102 (46%), Gaps = 7/102 (6%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K+ GN  +K  ++  A   Y  AI+ DP++ T Y+N AA      +  + +   E  I +
Sbjct: 179 KELGNAAYKKKDFETALKHYHAAIEHDPTDITFYNNIAAVHFERKEYEECIKQCEKGIEV 238

Query: 323 ----KPDWE---KGYFRKGCILEAMERYDEALDAFQIALKHN 427
               + D++   K + R G     +E Y +A   ++ A+  +
Sbjct: 239 GRESRADFKLIAKSFARIGNTYRKLENYKQAKVYYEKAMSEH 280



>gb:BC078016_2560659 Xenopus laevis stress-induced-phosphoprotein 1
           (Hsp70/Hsp90-organizing protein), mRNA (cDNA clone
           MGC:82554 IMAGE:4968499), complete cds.
          Length = 430

 Score = 87.8 bits (216), Expect = 6e-17
 Identities = 43/91 (47%), Positives = 64/91 (70%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K++GNE F+ G+Y +A   Y++AIK++P++  LYSNRAA +  L++   AL D E  I L
Sbjct: 251 KNKGNESFQKGDYPQAVRHYSEAIKRNPNDAKLYSNRAACYTKLLEFQLALKDCEECIRL 310

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIA 415
           +P++ KGY RK   LEAM+ Y +A+DA+Q A
Sbjct: 311 EPNFIKGYTRKAAALEAMKDYSKAMDAYQKA 341



 Score = 40.8 bits (94), Expect = 0.008
 Identities = 31/99 (31%), Positives = 45/99 (45%), Gaps = 7/99 (7%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K+ GNE +K  ++  A   Y QA + DP+N T  +N+AA +      NK     E  I +
Sbjct: 116 KELGNEAYKKKDFETALKHYGQAQELDPTNMTYITNQAAVYFEQADYNKCRDLCEKGIEV 175

Query: 323 ----KPDWE---KGYFRKGCILEAMERYDEALDAFQIAL 418
               + D+    K Y R G      E+Y EA   F  +L
Sbjct: 176 GRENREDYRQIAKAYARIGNSYYKEEKYKEATQFFNKSL 214



>gb:BC061529_2104511 Rattus norvegicus stress-induced-phosphoprotein
           1 (Hsp70/Hsp90-organizing protein), mRNA (cDNA clone
           MGC:72684 IMAGE:6887497), complete
           cds.>gb:RNRNAHOP_2136337 Rattus norvegicus mRNA for
           Hsp70/Hsp90 organizing protein.
          Length = 543

 Score = 87.8 bits (216), Expect = 6e-17
 Identities = 44/95 (46%), Positives = 57/95 (60%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK++GN+   AGN   A   Y++AIK DP N  LYSNR+AA+       KA  D   T+ 
Sbjct: 7   LKEKGNKALSAGNIDDALQCYSEAIKLDPQNHVLYSNRSAAYAKKGDYQKAYEDGCKTVD 66

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALKH 424
           LKPDW KGY RK   LE + R++EA   ++  LKH
Sbjct: 67  LKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKH 101



 Score = 87.4 bits (215), Expect = 8e-17
 Identities = 44/92 (47%), Positives = 62/92 (67%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K++GNE F+ G+Y +A   YT+AIK++P +  LYSNRAA +  L++   AL D E  I L
Sbjct: 364 KNKGNECFQKGDYPQAMKHYTEAIKRNPRDAKLYSNRAACYTKLLEFQLALKDCEECIQL 423

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIAL 418
           +P + KGY RK   LEAM+ Y +A+D +Q AL
Sbjct: 424 EPTFIKGYTRKAAALEAMKDYTKAMDVYQKAL 455



 Score = 39.3 bits (90), Expect = 0.024
 Identities = 30/105 (28%), Positives = 49/105 (46%), Gaps = 7/105 (6%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           K+ +  K+ GN+ +K  ++ KA   Y +A + DP+N T  +N+AA        NK     
Sbjct: 223 KQALKEKELGNDAYKKKDFDKALKHYDKAKELDPTNMTYITNQAAVHFEKGDYNKCRELC 282

Query: 305 EMTISL----KPDWE---KGYFRKGCILEAMERYDEALDAFQIAL 418
           E  I +    + D+    K Y R G      ERY +A+  +  +L
Sbjct: 283 EKAIEVGRENREDYRQIAKAYARIGNSYFKEERYKDAIHFYNKSL 327



>gb:BC003794_2089349 Mus musculus stress-induced phosphoprotein 1,
           mRNA (cDNA clone MGC:6035 IMAGE:3590457), complete cds.
          Length = 543

 Score = 87.8 bits (216), Expect = 6e-17
 Identities = 44/95 (46%), Positives = 57/95 (60%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK++GN+   AGN   A   Y++AIK DP N  LYSNR+AA+       KA  D   T+ 
Sbjct: 7   LKEKGNKALSAGNIDDALQCYSEAIKLDPQNHVLYSNRSAAYAKKGDYQKAYEDGCKTVD 66

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALKH 424
           LKPDW KGY RK   LE + R++EA   ++  LKH
Sbjct: 67  LKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKH 101



 Score = 87.4 bits (215), Expect = 8e-17
 Identities = 44/92 (47%), Positives = 62/92 (67%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K++GNE F+ G+Y +A   YT+AIK++P +  LYSNRAA +  L++   AL D E  I L
Sbjct: 364 KNKGNECFQKGDYPQAMKHYTEAIKRNPRDAKLYSNRAACYTKLLEFQLALKDCEECIQL 423

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIAL 418
           +P + KGY RK   LEAM+ Y +A+D +Q AL
Sbjct: 424 EPTFIKGYTRKAAALEAMKDYTKAMDVYQKAL 455



 Score = 38.1 bits (87), Expect = 0.054
 Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 7/105 (6%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           K+ +  K+ GN+ +K  ++ KA   Y +A + DP+N T  +N+AA        NK     
Sbjct: 223 KQALKEKELGNDAYKKKDFDKALKHYDRAKELDPTNMTYITNQAAVHFEKGDYNKCRELC 282

Query: 305 EMTISL----KPDWE---KGYFRKGCILEAMERYDEALDAFQIAL 418
           E  I +    + D+    K Y R G      E+Y +A+  +  +L
Sbjct: 283 EKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSL 327



>gb:AF056198_1237041 Drosophila melanogaster Hsp70/Hsp90 organizing
           protein homolog mRNA, complete cds.
          Length = 489

 Score = 87.8 bits (216), Expect = 6e-17
 Identities = 48/123 (39%), Positives = 74/123 (60%)
 Frame = +2

Query: 62  TLTQISANFLKGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTL 241
           +L+++ A  +K +  M   + ++    K+QGN FFK G+Y  A   YT+AIK++P +P L
Sbjct: 287 SLSEVEAK-IKEEERMAYINPEKAEEEKEQGNLFFKNGDYSTAVKHYTEAIKRNPDDPKL 345

Query: 242 YSNRAAAFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
           YSNRAA +  L   +  L D +  I L   + KGY RKG IL+ M++  +A  A+Q AL+
Sbjct: 346 YSNRAACYTKLAAFDLGLKDCDTCIKLDEKFIKGYIRKGKILQGMQQQSKAQAAYQKALE 405

Query: 422 HNP 430
            +P
Sbjct: 406 LDP 408



 Score = 85.9 bits (211), Expect = 2e-16
 Identities = 43/97 (44%), Positives = 58/97 (59%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK++GN+   A  + +A A YT+AI  D  N  LYSNR+AAF    K  +AL DAE TI 
Sbjct: 7   LKEKGNQALSAEKFDEAVAAYTEAIALDDQNHVLYSNRSAAFAKAGKFQEALEDAEKTIQ 66

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L P W KGY RKG     +  + +A +A+   LK++P
Sbjct: 67  LNPTWPKGYSRKGAAAAGLNDFMKAFEAYNEGLKYDP 103



 Score = 35.0 bits (79), Expect = 0.45
 Identities = 25/102 (24%), Positives = 47/102 (46%), Gaps = 7/102 (6%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K+ GN  +K  ++  A   Y  AI+ DP++ T Y+N AA      +  + +   E  I +
Sbjct: 178 KELGNAAYKKKDFETALKHYHAAIEHDPTDITFYNNIAAVHFERKEYEECIKQCEKGIEV 237

Query: 323 ----KPDWE---KGYFRKGCILEAMERYDEALDAFQIALKHN 427
               + D++   K + R G     +E Y +A   ++ A+  +
Sbjct: 238 GRESRADFKLIAKSFARIGNTYRKLENYKQAKVYYEKAMSEH 279



>gb:AK088494_1175440 Mus musculus 2 days neonate thymus thymic cells
           cDNA, RIKEN full-length enriched library,
           clone:E430018O18 product:stress-induced phosphoprotein
           1, full insert sequence.>gb:MMU27830_2120134 Mus
           musculus mSTI1 mRNA, complete cds.>gb:BC086059_2564651
           Xenopus laevis hypothetical LOC495598, mRNA (cDNA clone
           MGC:98390 IMAGE:7197332), complete cds.
          Length = 543

 Score = 87.8 bits (216), Expect = 6e-17
 Identities = 44/95 (46%), Positives = 57/95 (60%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK++GN+   AGN   A   Y++AIK DP N  LYSNR+AA+       KA  D   T+ 
Sbjct: 7   LKEKGNKALSAGNIDDALQCYSEAIKLDPQNHVLYSNRSAAYAKKGDYQKAYEDGCKTVD 66

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALKH 424
           LKPDW KGY RK   LE + R++EA   ++  LKH
Sbjct: 67  LKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKH 101



 Score = 87.4 bits (215), Expect = 8e-17
 Identities = 44/92 (47%), Positives = 62/92 (67%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K++GNE F+ G+Y +A   YT+AIK++P +  LYSNRAA +  L++   AL D E  I L
Sbjct: 364 KNKGNECFQKGDYPQAMKHYTEAIKRNPRDAKLYSNRAACYTKLLEFQLALKDCEECIQL 423

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIAL 418
           +P + KGY RK   LEAM+ Y +A+D +Q AL
Sbjct: 424 EPTFIKGYTRKAAALEAMKDYTKAMDVYQKAL 455



 Score = 38.1 bits (87), Expect = 0.054
 Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 7/105 (6%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           K+ +  K+ GN+ +K  ++ KA   Y +A + DP+N T  +N+AA        NK     
Sbjct: 223 KQALKEKELGNDAYKKKDFDKALKHYDRAKELDPTNMTYITNQAAVHFEKGDYNKCRELC 282

Query: 305 EMTISL----KPDWE---KGYFRKGCILEAMERYDEALDAFQIAL 418
           E  I +    + D+    K Y R G      E+Y +A+  +  +L
Sbjct: 283 EKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSL 327



>sp|P31948|IEFS_HUMAN Stress-induced-phosphoprotein 1 (STI1)
           (Hsp70/Hsp90-organizing protein) (Hop)
           (Transformation-sensitive protein IEF SSP
           3521).>pir|A38093|A38093 transformation-sensitive
           protein IEF SSP 3521 - human>gb:BC002987_1968585 Homo
           sapiens stress-induced-phosphoprotein 1
           (Hsp70/Hsp90-organizing protein), mRNA (cDNA clone
           MGC:3516 IMAGE:2823157), complete
           cds.>gb:BT020010_1991350 Homo sapiens
           stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing
           protein) mRNA, complete cds.>gb:BT020011_1991351 Homo
           sapiens stress-induced-phosphoprotein 1
           (Hsp70/Hsp90-organizing protein) mRNA, complete
           cds.>gb:CR536512_1993806 Homo sapiens full open reading
           frame cDNA clone RZPDo834C0722D for gene STIP1,
           stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing
           protein); complete cds, incl.
           stopcodon.>gb:HUMIEF_2032338 Human
           transformation-sensitive protein (IEF SSP 3521) mRNA,
           complete cds.
          Length = 543

 Score = 87.8 bits (216), Expect = 6e-17
 Identities = 44/92 (47%), Positives = 62/92 (67%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K++GNE F+ G+Y +A   YT+AIK++P +  LYSNRAA +  L++   AL D E  I L
Sbjct: 364 KNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQL 423

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIAL 418
           +P + KGY RK   LEAM+ Y +A+D +Q AL
Sbjct: 424 EPTFIKGYTRKAAALEAMKDYTKAMDVYQKAL 455



 Score = 85.9 bits (211), Expect = 2e-16
 Identities = 43/95 (45%), Positives = 56/95 (58%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK++GN+    GN   A   Y++AIK DP N  LYSNR+AA+       KA  D   T+ 
Sbjct: 7   LKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVD 66

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALKH 424
           LKPDW KGY RK   LE + R++EA   ++  LKH
Sbjct: 67  LKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKH 101



 Score = 37.4 bits (85), Expect = 0.092
 Identities = 28/105 (26%), Positives = 49/105 (46%), Gaps = 7/105 (6%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           K+ +  K+ GN+ +K  ++  A   Y +A + DP+N T  +N+AA +      NK     
Sbjct: 223 KQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELC 282

Query: 305 EMTISL----KPDWE---KGYFRKGCILEAMERYDEALDAFQIAL 418
           E  I +    + D+    K Y R G      E+Y +A+  +  +L
Sbjct: 283 EKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSL 327



>gb:AK075988_1171149 Mus musculus 10 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2610009O10
           product:stress-induced phosphoprotein 1, full insert
           sequence.
          Length = 542

 Score = 87.4 bits (215), Expect = 8e-17
 Identities = 44/92 (47%), Positives = 62/92 (67%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K++GNE F+ G+Y +A   YT+AIK++P +  LYSNRAA +  L++   AL D E  I L
Sbjct: 363 KNKGNECFQKGDYPQAMKHYTEAIKRNPRDAKLYSNRAACYTKLLEFQLALKDCEECIQL 422

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIAL 418
           +P + KGY RK   LEAM+ Y +A+D +Q AL
Sbjct: 423 EPTFIKGYTRKAAALEAMKDYTKAMDVYQKAL 454



 Score = 86.3 bits (212), Expect = 2e-16
 Identities = 44/95 (46%), Positives = 57/95 (60%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK++GN+   AGN   A   Y++AIK DP N  LYSNR+AA+       KA  D   T+ 
Sbjct: 7   LKEKGNKAPSAGNIDDALQCYSEAIKLDPQNHVLYSNRSAAYAKKGDYQKAYEDGCKTVD 66

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALKH 424
           LKPDW KGY RK   LE + R++EA   ++  LKH
Sbjct: 67  LKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKH 101



 Score = 35.4 bits (80), Expect = 0.35
 Identities = 26/106 (24%), Positives = 50/106 (47%), Gaps = 15/106 (14%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           K+ +  K+ GN+ +K  ++ KA   Y +A + DP+N T  +N+AA      +L K     
Sbjct: 223 KQALKEKELGNDAYKKKDFDKALKHYDRAKELDPTNMTYITNQAAVHFEKGRLYKCTELC 282

Query: 305 EMTI---------------SLKPDWEKGYFRKGCILEAMERYDEAL 397
           E  I               +  P+W+   F++  + +A+  Y+++L
Sbjct: 283 EKAIESGRENREDYRQIAKAYAPNWQ-FLFKEEXVQDAIHFYNKSL 327



>gb:AB061261_1522022 Solanum tuberosum mRNA for ankyrin-like
           protein, complete cds.
          Length = 467

 Score = 86.7 bits (213), Expect = 1e-16
 Identities = 42/102 (41%), Positives = 64/102 (62%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           KR    K +G+E FK  ++  A   YTQAI  DP++ TL+SNR+  +L L +  +AL+DA
Sbjct: 334 KRAADAKARGDEAFKRNDFATAIDAYTQAIDFDPTDGTLFSNRSLCWLRLGQAERALSDA 393

Query: 305 EMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
                L+PDW KG +R+G  L  ++R++EA +AF   ++ NP
Sbjct: 394 RACRELRPDWAKGCYREGAALRLLQRFEEAANAFYEGVQINP 435



>gb:AC084406_1733625 Oryza sativa chromosome 3 BAC OSJNBa0067E01
           genomic sequence, complete sequence.
          Length = 541

 Score = 85.5 bits (210), Expect = 3e-16
 Identities = 40/101 (39%), Positives = 67/101 (66%)
 Frame = +2

Query: 128 REVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAE 307
           R+V LK  G +  K  +YL A+ +Y++A++ D  + TLYSNR+  +L + ++ KAL DAE
Sbjct: 386 RKVELKSLGGKAVKRKDYLGASRIYSEALELDYFDATLYSNRSLCYLRIGEVQKALLDAE 445

Query: 308 MTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           M + L+P+W KG++R+G  L  ++ + +A + F  ALK +P
Sbjct: 446 MCVKLRPEWVKGHYREGAALMLLKEHKKAFEVFLNALKLDP 486



>gb:AC079736_1732778 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0003G23 map MAP_LOC, complete
           sequence.
          Length = 170

 Score = 85.5 bits (210), Expect = 3e-16
 Identities = 40/101 (39%), Positives = 67/101 (66%)
 Frame = +2

Query: 128 REVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAE 307
           R+V LK  G +  K  +YL A+ +Y++A++ D  + TLYSNR+  +L + ++ KAL DAE
Sbjct: 15  RKVELKSLGGKAVKRKDYLGASRIYSEALELDYFDATLYSNRSLCYLRIGEVQKALLDAE 74

Query: 308 MTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           M + L+P+W KG++R+G  L  ++ + +A + F  ALK +P
Sbjct: 75  MCVKLRPEWVKGHYREGAALMLLKEHKKAFEVFLNALKLDP 115



>pir|H86257|H86257 protein F5O11.2 [imported] - Arabidopsis
           thaliana>gb:AE005172_890239 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC025416_1539451 Genomic sequence for
           Arabidopsis thaliana BAC F5O11 from chromosome I,
           complete sequence.>gb:AY064967_1566144 Arabidopsis
           thaliana At1g12270/F5O11_1 mRNA, complete
           cds.>gb:BT000651_1634929 Arabidopsis thaliana
           At1g12270/F5O11_1 mRNA, complete cds.
          Length = 572

 Score = 85.1 bits (209), Expect = 4e-16
 Identities = 39/96 (40%), Positives = 62/96 (64%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           +++GN+FFK   Y +A   YT+AIK++P++   YSNRAA++  L  + + L DAE  I L
Sbjct: 387 REKGNDFFKEQKYPEAIKHYTEAIKRNPNDHKAYSNRAASYTKLGAMPEGLKDAEKCIEL 446

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            P + KGY RK  +   ++ YD A++ +Q  L+H+P
Sbjct: 447 DPTFSKGYSRKAAVQFFLKEYDNAMETYQAGLEHDP 482



 Score = 69.7 bits (169), Expect = 2e-11
 Identities = 37/96 (38%), Positives = 58/96 (60%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K +GN  F +G++  A   +T+AI   P+N  L+SNR+AA   L +  +AL+DA+ TI L
Sbjct: 6   KAKGNAAFSSGDFTTAINHFTEAIALAPTNHVLFSNRSAAHASLHQYAEALSDAKETIKL 65

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           KP W KGY R G     + +++ A+ A++  L  +P
Sbjct: 66  KPYWPKGYSRLGAAHLGLNQFELAVTAYKKGLDVDP 101



>gb:AE017341_1753929 Cryptococcus neoformans var. neoformans JEC21
           chromosome 1, complete sequence.
          Length = 584

 Score = 84.0 bits (206), Expect = 9e-16
 Identities = 45/99 (45%), Positives = 59/99 (59%)
 Frame = +2

Query: 134 VSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMT 313
           V+LK + N+ F A +Y  AA LY+ AI  DPSN  LYSNR+A    L     AL DAE T
Sbjct: 5   VALKAEANKAFAAKDYTTAAKLYSDAIALDPSNHVLYSNRSATKAGLKDYEGALEDAEKT 64

Query: 314 ISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           I L P + KGY RKG  L  + R+ +A+ A++  L+  P
Sbjct: 65  IELDPSFSKGYARKGAALHGLRRFPDAVMAYESGLQAEP 103



 Score = 81.3 bits (199), Expect = 6e-15
 Identities = 40/99 (40%), Positives = 61/99 (61%)
 Frame = +2

Query: 119 DAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALA 298
           D ++    +++GNE FK G++  A   Y++AIK+ P++P  Y+NRAA +  L+ L +AL 
Sbjct: 392 DPEKAEKAREEGNEAFKKGDFAGAQKHYSEAIKRLPTDPRAYNNRAACYTKLLALPEALK 451

Query: 299 DAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIA 415
           DAE  IS+ P + K Y RK  + E M+ Y  AL+  Q A
Sbjct: 452 DAETAISIDPTFIKAYIRKALVQEGMKEYTAALETLQKA 490



 Score = 35.0 bits (79), Expect = 0.45
 Identities = 28/110 (25%), Positives = 50/110 (45%), Gaps = 8/110 (7%)
 Frame = +2

Query: 113 DSDAKREVS-LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNK 289
           ++ AK+E    K QGN  +KA  + +A   Y++A    P + T  +N +A +    +  K
Sbjct: 254 EAKAKKEAEEFKAQGNTSYKARKFDEAIEFYSKAWDLYPKDVTFLTNLSAVYFEQGEYQK 313

Query: 290 ALADAEMTI----SLKPDWE---KGYFRKGCILEAMERYDEALDAFQIAL 418
            +   E  +     L+ D++   K Y R G     +    +A+  FQ +L
Sbjct: 314 CIETCEKAVEEGRDLRADYKVFAKAYGRIGSSYSKLGDLAQAIKFFQKSL 363



>gb:AC079736_1732775 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0003G23 map MAP_LOC, complete
           sequence.
          Length = 441

 Score = 84.0 bits (206), Expect = 9e-16
 Identities = 45/116 (38%), Positives = 71/116 (61%), Gaps = 2/116 (1%)
 Frame = +2

Query: 89  LKGKTTMGDS--DAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAA 262
           L+G+  + D   +  ++  LK QG +  K  +Y  A+  YT+AI+ DP++ TLYSNR+  
Sbjct: 299 LRGEKAIKDKHDEQDKKAQLKLQGEKAVKRKDYHGASIFYTEAIELDPTDATLYSNRSLC 358

Query: 263 FLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            L   ++ +AL DA+  I  +P+W KGY+RKG  L  ++ Y++A DAF   LK +P
Sbjct: 359 HL---QMTEALFDADYCIKSRPEWLKGYYRKGAALMLLKEYEKACDAFLAGLKLDP 411



>gb:AC084406_1733624 Oryza sativa chromosome 3 BAC OSJNBa0067E01
           genomic sequence, complete sequence.
          Length = 340

 Score = 82.0 bits (201), Expect = 3e-15
 Identities = 47/124 (37%), Positives = 68/124 (54%), Gaps = 8/124 (6%)
 Frame = +2

Query: 83  NFLKGKTTMGDS--DAKREVSLKDQGNEFFKAGNYLKAAALYTQ------AIKKDPSNPT 238
           NF    T + D   D   +  LK  G +  K  +Y  A+  Y+Q      AI+ DP++ T
Sbjct: 187 NFSDRDTPLVDKQDDQNEKAQLKLCGEKAVKRKDYRGASNFYSQFQNIELAIEMDPTDAT 246

Query: 239 LYSNRAAAFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIAL 418
           LYSNR+   L + +   AL DAE  I L+P+W KGY+RKG  L  ++++++A DAF   L
Sbjct: 247 LYSNRSLCHLQMTEAEAALFDAEFCIQLRPEWIKGYYRKGAALMLLKKHEKACDAFMAGL 306

Query: 419 KHNP 430
           K  P
Sbjct: 307 KLEP 310



>pir|T03899|T03899 hypothetical protein R09E12.3 - Caenorhabditis
           elegans>gb:AF016422_1232231 Caenorhabditis elegans
           cosmid R09E12, complete sequence.
          Length = 320

 Score = 82.0 bits (201), Expect = 3e-15
 Identities = 41/96 (42%), Positives = 59/96 (61%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K++GNE+FK G+Y  A   Y +A+K+DP N  LYSNRAA    L++  +AL D +  I L
Sbjct: 144 KNKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAACLTKLMEFQRALDDCDTCIRL 203

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
              + KGY RK   L AM  + +A  A++ AL+ +P
Sbjct: 204 DSKFIKGYIRKAACLVAMREWSKAQRAYEDALQVDP 239



 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 30/92 (32%), Positives = 47/92 (51%)
 Frame = +2

Query: 134 VSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMT 313
           ++ KD GN  +K  ++ KA   Y +AI+ DPSN T Y+N+AA +    K  + +   E  
Sbjct: 6   IAEKDLGNAAYKQKDFEKAHVHYDKAIELDPSNITFYNNKAAVYFEEKKFAECVQFCEKA 65

Query: 314 ISLKPDWEKGYFRKGCILEAMERYDEALDAFQ 409
           + +  +    Y     I +AM R   A +AFQ
Sbjct: 66  VEVGRETRADY---KLIAKAMSR---AGNAFQ 91



>gb:AJ720539_2502726 Gallus gallus mRNA for hypothetical protein,
           clone 19o2.
          Length = 304

 Score = 81.6 bits (200), Expect = 4e-15
 Identities = 42/104 (40%), Positives = 62/104 (59%)
 Frame = +2

Query: 119 DAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALA 298
           D ++   LKD+GN   K  NY  A   YT+AI+ DP+N   Y NRAAA   L K ++A+ 
Sbjct: 81  DIEKADRLKDEGNNHMKEENYGAAVDCYTRAIELDPNNAVYYCNRAAAQSKLNKYSEAIK 140

Query: 299 DAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           D E  I++ P + K Y R G  L ++ +Y+EA+ ++Q AL  +P
Sbjct: 141 DCERAIAIDPKYSKAYGRMGLALTSVNKYEEAITSYQKALDLDP 184



>gb:BC074276_2557789 Xenopus laevis MGC84046 protein, mRNA (cDNA
           clone MGC:84046 IMAGE:6947941), complete cds.
          Length = 308

 Score = 80.5 bits (197), Expect = 9e-15
 Identities = 45/105 (42%), Positives = 60/105 (57%)
 Frame = +2

Query: 116 SDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKAL 295
           S A++   LKD+GN   K  NY  A   Y+QAI+ DP+N   Y NRAAA     K ++A+
Sbjct: 84  SAAEKAEQLKDEGNGLMKEQNYEAAVDCYSQAIELDPNNAVYYCNRAAAQSQRGKHSEAI 143

Query: 296 ADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            D E  IS+   + K Y R G  L AM RY EA +++Q AL  +P
Sbjct: 144 TDCEKAISIDAKYSKAYGRMGRALVAMSRYKEAFESYQKALDLDP 188



>gb:AC084406_1733623 Oryza sativa chromosome 3 BAC OSJNBa0067E01
            genomic sequence, complete sequence.
          Length = 1831

 Score = 80.5 bits (197), Expect = 9e-15
 Identities = 42/126 (33%), Positives = 73/126 (57%), Gaps = 3/126 (2%)
 Frame = +2

Query: 62   TLTQISANFLKGKTTMGDSDAK---REVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSN 232
            +L ++     + +  M +S  K   R+  LK  G +  K  +YL A+ +Y++A++ D  +
Sbjct: 1696 SLGRVKFQEFRARIGMDESCGKVNDRKAELKSHGEKAVKRNDYLAASKIYSEALELDYFD 1755

Query: 233  PTLYSNRAAAFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQI 412
             TLYSNR+   L + +  KAL DA+  + L+P W KG++R+G  L  ++ + +A +AF  
Sbjct: 1756 ATLYSNRSLCNLQIGEAQKALLDADRCVELRPKWVKGHYREGAALMVLKEHKKAFEAFLN 1815

Query: 413  ALKHNP 430
            ALK +P
Sbjct: 1816 ALKLDP 1821



>gb:AC084818_1733853 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0668H12, complete sequence.
          Length = 460

 Score = 79.7 bits (195), Expect = 2e-14
 Identities = 40/106 (37%), Positives = 67/106 (63%), Gaps = 1/106 (0%)
 Frame = +2

Query: 116 SDAK-REVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKA 292
           S+AK R +  K +G++ F+  +YL A   YTQAI+ +P++ TL+SNR+  +L   +  +A
Sbjct: 323 SEAKERSLEAKSRGDDAFRNKDYLVAVDAYTQAIELNPNDATLHSNRSLCWLRAGQAERA 382

Query: 293 LADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L DA    +L+PDW K  +R+G  L  ++R++EA +AF   ++  P
Sbjct: 383 LEDARACRALRPDWAKACYREGAALRLLQRFEEAANAFYEGVQLEP 428



>gb:CR382129_1661682 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 575

 Score = 79.7 bits (195), Expect = 2e-14
 Identities = 46/135 (34%), Positives = 69/135 (51%), Gaps = 2/135 (1%)
 Frame = +2

Query: 29  SETLRSKNSP*TLTQISA--NFLKGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALY 202
           +  L    +P TL+++ A    LK K T    D  +    +++G E F AG++  A   Y
Sbjct: 351 NRALTEHRTPDTLSKLRAAEKDLKNKETQAYIDPAKAEEAREEGKEKFAAGDWPGAVKAY 410

Query: 203 TQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMER 382
           T+ IK+ P NP  YSNRAAA   L+   +A+ D +  IS  P + + Y RK     AM  
Sbjct: 411 TEMIKRAPENPIGYSNRAAALAKLMSFPEAVVDCDAAISKDPSFIRAYIRKANAYFAMRE 470

Query: 383 YDEALDAFQIALKHN 427
           Y + +D    AL+H+
Sbjct: 471 YSKCVDTCTAALEHD 485



 Score = 67.4 bits (163), Expect = 8e-11
 Identities = 40/98 (40%), Positives = 53/98 (54%), Gaps = 1/98 (1%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPS-NPTLYSNRAAAFLHLVKLNKALADAEMTI 316
           LK QGN  F A ++  A   +T+AI+  P+ N  LYSNR+A    L   + AL DA+  I
Sbjct: 6   LKAQGNAAFAAKDFPTAIDHFTKAIEASPTPNHVLYSNRSACHSSLKNFDDALKDAQSCI 65

Query: 317 SLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            + P W KGY RKG  L        A DA++  LK +P
Sbjct: 66  DINPQWTKGYGRKGAALHGKGDLIGAKDAYEEGLKLDP 103



>gb:AE005173_893941 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC007190_1535510 Genomic sequence
           for Arabidopsis thaliana BAC F23N19 from chromosome I,
           complete sequence.
          Length = 594

 Score = 79.3 bits (194), Expect = 2e-14
 Identities = 39/96 (40%), Positives = 60/96 (62%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K +GN  F +G++  A   +T AI   P+N  L+SNR+AA   L   ++AL+DA+ T+ L
Sbjct: 6   KAKGNAAFSSGDFNSAVNHFTDAINLTPTNHVLFSNRSAAHASLNHYDEALSDAKKTVEL 65

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           KPDW KGY R G     + ++DEA++A+   L+ +P
Sbjct: 66  KPDWGKGYSRLGAAHLGLNQFDEAVEAYSKGLEIDP 101



 Score = 71.2 bits (173), Expect = 6e-12
 Identities = 40/119 (33%), Positives = 60/119 (50%), Gaps = 23/119 (19%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYS-----------------------NR 253
           +++GN+FFK   Y  A   YT+AIK++P +P +                         NR
Sbjct: 386 REKGNDFFKEQKYPDAVRHYTEAIKRNPKDPRVRRIHHHISFNVVLKKSSVFDCFNNFNR 445

Query: 254 AAAFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           AA +  L  + + L DAE  I L P + KGY RKG +   M+ YD A++ +Q  L+H+P
Sbjct: 446 AACYTKLGAMPEGLKDAEKCIELDPTFLKGYSRKGAVQFFMKEYDNAMETYQKGLEHDP 504



>gb:BC074059_2557588 Danio rerio zgc:92462, mRNA (cDNA clone
           MGC:92462 IMAGE:7042969), complete cds.
          Length = 306

 Score = 79.0 bits (193), Expect = 3e-14
 Identities = 43/111 (38%), Positives = 57/111 (51%)
 Frame = +2

Query: 98  KTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLV 277
           KT     D +R   LK++GN   K  NY  A   YT+AI+ D  N   Y NRAAA   L 
Sbjct: 76  KTFPSPEDIERAEQLKNEGNNHMKEENYSSAVDCYTKAIELDQRNAVYYCNRAAAHSKLE 135

Query: 278 KLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
              +A+ D E  I++ P + K Y R G  L +M +Y EA+  F  AL  +P
Sbjct: 136 NYTEAMGDCERAIAIDPSYSKAYGRMGLALTSMSKYPEAISYFNKALVLDP 186



>gb:AB026295_1516945 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, clone:P0681F10.
          Length = 805

 Score = 79.0 bits (193), Expect = 3e-14
 Identities = 40/96 (41%), Positives = 60/96 (62%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           +D+GN+FFK   Y +AA  YT+A+KK+P +P ++SNRA   ++L  L + L DA+  I+L
Sbjct: 158 RDRGNDFFKQKRYQEAAMHYTEAMKKNPKDPRVFSNRAQCHIYLGALPEGLEDADKCIAL 217

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            P + KGY RK  +   M  Y+ AL  +   LK +P
Sbjct: 218 DPTFLKGYLRKAKVQLLMGNYEIALATYVEGLKCDP 253



 Score = 33.5 bits (75), Expect = 1.3
 Identities = 19/68 (27%), Positives = 36/68 (52%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKA 292
           +++A+RE   K+ GN  ++      A   YT+    DP + +  +NRAAA+L + K  + 
Sbjct: 12  EAEARRE---KEAGNAAYRKLYLETAVRHYTRGALLDPRDISFLTNRAAAYLLMSKYKEC 68

Query: 293 LADAEMTI 316
           + D +  +
Sbjct: 69  VRDCDEAV 76



>gb:AE014296_1135346 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003555_1215357 Drosophila melanogaster
           chromosome 3L, section 30 of 83 of the complete
           sequence.
          Length = 2444

 Score = 79.0 bits (193), Expect = 3e-14
 Identities = 41/94 (43%), Positives = 52/94 (55%)
 Frame = +2

Query: 149 QGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISLKP 328
           Q N   ++G++  A  LYT A++ DP N  LYSNR+AA L   +   AL DA     L P
Sbjct: 29  QSNAACQSGDFATAVLLYTDALQLDPGNHILYSNRSAALLKQGQFTAALQDATQARDLCP 88

Query: 329 DWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            W K YFR+G  L+ + RY EAL AF   L   P
Sbjct: 89  QWPKAYFRQGVALQCLGRYGEALAAFASGLAQEP 122



>gb:AF368280_2064284 Rattus norvegicus small glutamine rich protein
           with tetratricopeptide repeats 2 (Sgt2) mRNA, complete
           cds.
          Length = 304

 Score = 78.6 bits (192), Expect = 4e-14
 Identities = 42/104 (40%), Positives = 57/104 (54%)
 Frame = +2

Query: 119 DAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALA 298
           D  +   LKD+GN   K  NY  A   YTQAI+ DP+N   Y NRAAA   L     A+ 
Sbjct: 81  DVGKADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLSHYTDAIK 140

Query: 299 DAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           D E  I++   + K Y R G  L AM +++EA+ ++Q AL  +P
Sbjct: 141 DCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQKALDLDP 184



>gb:AK049820_1168982 Mus musculus adult male hippocampus cDNA, RIKEN
           full-length enriched library, clone:C630001O05
           product:SIMILAR TO SMALL GLUTAMINE-RICH
           TETRATRICOPEPTIDE REPEAT (TPR)-CONTAINING homolog [Homo
           sapiens], full insert sequence.>gb:AK082080_1173457 Mus
           musculus 0 day neonate cerebellum cDNA, RIKEN
           full-length enriched library, clone:C230003A08
           product:SIMILAR TO SMALL GLUTAMINE-RICH
           TETRATRICOPEPTIDE REPEAT (TPR)-CONTAINING homolog [Homo
           sapiens], full insert sequence.>gb:BC017611_2092508 Mus
           musculus small glutamine-rich tetratricopeptide repeat
           (TPR)-containing, beta, mRNA (cDNA clone MGC:27660
           IMAGE:4527683), complete cds.
          Length = 304

 Score = 78.6 bits (192), Expect = 4e-14
 Identities = 42/104 (40%), Positives = 57/104 (54%)
 Frame = +2

Query: 119 DAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALA 298
           D  +   LKD+GN   K  NY  A   YTQAI+ DP+N   Y NRAAA   L     A+ 
Sbjct: 81  DVGKADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLSHYTDAIK 140

Query: 299 DAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           D E  I++   + K Y R G  L AM +++EA+ ++Q AL  +P
Sbjct: 141 DCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQKALDLDP 184



>gb:AY365188_1602859 Nicotiana benthamiana isolate Nb#62 unknown
           mRNA.
          Length = 469

 Score = 78.2 bits (191), Expect = 5e-14
 Identities = 38/102 (37%), Positives = 62/102 (60%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           K+    K +G+E FK  +Y  A   YTQAI  DP++  L+SNR+  ++ L +   AL+DA
Sbjct: 336 KKAADAKVRGDEAFKRKDYATAVDAYTQAIDFDPTDGILFSNRSLCWIRLGQAEHALSDA 395

Query: 305 EMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           +    L+PDW K  FR+G  L  ++R+++A +AF   ++ +P
Sbjct: 396 KACRQLRPDWAKACFREGAALRLLQRFEDAANAFYEGVQIDP 437



>gb:AP003282_1827222 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0583G08.
          Length = 535

 Score = 77.8 bits (190), Expect = 6e-14
 Identities = 41/106 (38%), Positives = 65/106 (61%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKA 292
           ++  KR+  LK QGN  F   +Y  A  LY+ A+K D ++  LYSNR+A +L+L   ++A
Sbjct: 312 NASCKRKDELKLQGNSSFNNEDYDAAILLYSMAMKFDNTDAKLYSNRSACWLNLGIGDEA 371

Query: 293 LADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L+DA++   ++PDW KGY+R+G     ++ Y  A    + ALK +P
Sbjct: 372 LSDAQICSKMQPDWAKGYYRQGMAFSLLQDYASASYVLRRALKLDP 417



>gb:AP005317_1850512 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0579G08.
          Length = 447

 Score = 77.4 bits (189), Expect = 8e-14
 Identities = 44/116 (37%), Positives = 62/116 (53%)
 Frame = +2

Query: 83  NFLKGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAA 262
           N L G+        K    LK QG E  K  +YL A+ LYT+A+  D ++ TLYSNR+  
Sbjct: 306 NTLPGQKDYESGLEKEVAGLKLQGVEALKRQDYLAASDLYTKALCLDFNDATLYSNRSLC 365

Query: 263 FLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           FLH+   +KA  DA     ++PDW K  +R+G  L  ++ Y +A DA     K +P
Sbjct: 366 FLHMGDGDKAYGDAYTCRMMRPDWPKACYRQGAALMLLKEYQKACDALLDGFKMDP 421



>gb:AC079736_1732781 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0003G23 map MAP_LOC, complete
           sequence.
          Length = 140

 Score = 77.4 bits (189), Expect = 8e-14
 Identities = 36/78 (46%), Positives = 53/78 (67%)
 Frame = +2

Query: 197 LYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAM 376
           ++T AI+ DP++ TL+SNR+  +L   +  +AL DA+  I LKPDW KGY+RKG  L ++
Sbjct: 33  VFTTAIQLDPTDATLHSNRSFCYLKSGEAREALVDAKTCIGLKPDWPKGYYRKGAALMSL 92

Query: 377 ERYDEALDAFQIALKHNP 430
           + Y EA DAF   +K +P
Sbjct: 93  KEYKEACDAFMDGVKLDP 110



>sp|Q96EQ0|SGTB_HUMAN Small glutamine-rich tetratricopeptide
           repeat-containing protein B (Small glutamine-rich
           protein with tetratricopeptide repeats
           2).>gb:AF368281_1899281 Homo sapiens small glutamine
           rich protein with tetratricopeptide repeats 2 (SGT2)
           mRNA, complete cds.>gb:AK096321_1914573 Homo sapiens
           cDNA FLJ39002 fis, clone NT2RI2024008, moderately
           similar to SMALL GLUTAMINE-RICH TETRATRICOPEPTIDE
           REPEAT-CONTAINING PROTEIN.>gb:BC012044_1973394 Homo
           sapiens small glutamine-rich tetratricopeptide repeat
           (TPR)-containing, beta, mRNA (cDNA clone MGC:10496
           IMAGE:3625993), complete cds.
          Length = 304

 Score = 77.0 bits (188), Expect = 1e-13
 Identities = 41/104 (39%), Positives = 57/104 (54%)
 Frame = +2

Query: 119 DAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALA 298
           D  +   LKD+GN   K  NY  A   YTQAI+ DP+N   Y NRAAA   L     A+ 
Sbjct: 81  DVGKADQLKDEGNNHMKEENYAAAVDCYTQAIELDPNNAVYYCNRAAAQSKLGHYTDAIK 140

Query: 299 DAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           D E  I++   + K Y R G  L A+ +++EA+ ++Q AL  +P
Sbjct: 141 DCEKAIAIDSKYSKAYGRMGLALTALNKFEEAVTSYQKALDLDP 184



>gb:ATAC011437_1543283 Arabidopsis thaliana chromosome III BAC F7O18
           genomic sequence, complete sequence.>gb:AY084331_1569422
           Arabidopsis thaliana clone 104284 mRNA, complete
           sequence.>gb:AY136361_1581862 Arabidopsis thaliana
           ankyrin-like protein (At3g04710) mRNA, complete
           cds.>gb:BT000201_1634479 Arabidopsis thaliana
           ankyrin-like protein (At3g04710) mRNA, complete
           cds.>gb:AK175477_1817465 Arabidopsis thaliana mRNA for
           ankyrin-like protein, complete cds, clone:
           RAFL21-91-D07.
          Length = 456

 Score = 76.6 bits (187), Expect = 1e-13
 Identities = 38/88 (43%), Positives = 55/88 (62%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K +G + F   ++  A   YTQAI  DP++ TL+SNR+  +L L +   AL+DA+    L
Sbjct: 332 KARGQDAFHRKDFQMAIDAYTQAIDFDPTDHTLFSNRSLCWLRLGQAEHALSDAKACREL 391

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAF 406
            PDW KG FR+G  L  ++R+DEA +AF
Sbjct: 392 NPDWPKGCFREGAALRLLQRFDEAANAF 419



>gb:AC079736_1732780 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OSJNBa0003G23 map MAP_LOC, complete
           sequence.
          Length = 174

 Score = 75.5 bits (184), Expect = 3e-13
 Identities = 39/92 (42%), Positives = 58/92 (63%)
 Frame = +2

Query: 92  KGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLH 271
           KG++    SD K E  LK QG +  K  +YL A+ +YT+A++ D  + TLYSNR+  +L 
Sbjct: 78  KGESCSKVSDRKAE--LKSQGEKAVKRKDYLAASKIYTKALELDYFDATLYSNRSLCYLQ 135

Query: 272 LVKLNKALADAEMTISLKPDWEKGYFRKGCIL 367
           + K  KAL DA+  + L+P W KG++R+G  L
Sbjct: 136 IGKAQKALLDAKKCVKLRPKWMKGHYREGAAL 167



>gb:PFACAM_1393654 P.falciparum calmodulin gene, complete cds.
          Length = 253

 Score = 74.7 bits (182), Expect = 5e-13
 Identities = 38/97 (39%), Positives = 53/97 (54%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK+ GN+ F+ G Y +A   ++ AI  DP +  LYSN + AF  L +  +AL  A   IS
Sbjct: 10  LKELGNKCFQEGKYEEAVKYFSDAITNDPLDHVLYSNLSGAFASLGRFYEALESANKCIS 69

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           +K DW KGY RKGC    + +   A   +   LK +P
Sbjct: 70  IKKDWPKGYIRKGCAEHGLRQLSNAEKTYLEGLKIDP 106



>gb:AE014187_938790 Plasmodium falciparum 3D7 chromosome 14 complete
           sequence.>gb:AE014821_1227866 Plasmodium falciparum 3D7
           chromosome 14 section 6 of 13 of the complete sequence.
          Length = 564

 Score = 74.7 bits (182), Expect = 5e-13
 Identities = 38/97 (39%), Positives = 53/97 (54%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK+ GN+ F+ G Y +A   ++ AI  DP +  LYSN + AF  L +  +AL  A   IS
Sbjct: 10  LKELGNKCFQEGKYEEAVKYFSDAITNDPLDHVLYSNLSGAFASLGRFYEALESANKCIS 69

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           +K DW KGY RKGC    + +   A   +   LK +P
Sbjct: 70  IKKDWPKGYIRKGCAEHGLRQLSNAEKTYLEGLKIDP 106



 Score = 72.0 bits (175), Expect = 3e-12
 Identities = 38/96 (39%), Positives = 58/96 (60%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K++GNE+FK  ++  A   Y +AI+++P++  LYSNRAAA   L++   AL D    I L
Sbjct: 382 KNKGNEYFKNNDFPNAKKEYDEAIRRNPNDAKLYSNRAAALTKLIEYPSALEDVMKAIEL 441

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            P + K Y RKG +   M+ Y +AL A+   L+ +P
Sbjct: 442 DPTFVKAYSRKGNLHFFMKDYYKALQAYNKGLELDP 477



 Score = 38.9 bits (89), Expect = 0.031
 Identities = 26/99 (26%), Positives = 52/99 (52%), Gaps = 7/99 (7%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K +GNEF+K   + +A   Y +AI+ +P++   + N+AA  + +   +KA+      I  
Sbjct: 247 KLKGNEFYKQKKFDEALKEYEEAIQINPNDIMYHYNKAAVHIEMKNYDKAVETCLYAIEN 306

Query: 323 KPDWE-------KGYFRKGCILEAMERYDEALDAFQIAL 418
           + +++       K Y R       M++YD A++A++ +L
Sbjct: 307 RYNFKAEFIQVAKLYNRLAISYINMKKYDLAIEAYRKSL 345



>pir|A45594|A45594 ORF 5' of calmodulin gene - malaria parasite
           (Plasmodium falciparum) (fragments)
          Length = 252

 Score = 74.7 bits (182), Expect = 5e-13
 Identities = 38/97 (39%), Positives = 53/97 (54%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK+ GN+ F+ G Y +A   ++ AI  DP +  LYSN + AF  L +  +AL  A   IS
Sbjct: 10  LKELGNKCFQEGKYEEAVKYFSDAITNDPLDHVLYSNLSGAFASLGRFYEALESANKCIS 69

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           +K DW KGY RKGC    + +   A   +   LK +P
Sbjct: 70  IKKDWPKGYIRKGCAEHGLRQLSNAEKTYLEGLKIDP 106



>sp|P25407|YCA1_PLAFA Hypothetical protein in calmodulin 5'region
           (Fragment).
          Length = 252

 Score = 74.7 bits (182), Expect = 5e-13
 Identities = 38/97 (39%), Positives = 53/97 (54%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK+ GN+ F+ G Y +A   ++ AI  DP +  LYSN + AF  L +  +AL  A   IS
Sbjct: 10  LKELGNKCFQEGKYEEAVKYFSDAITNDPLDHVLYSNLSGAFASLGRFYEALESANKCIS 69

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           +K DW KGY RKGC    + +   A   +   LK +P
Sbjct: 70  IKKDWPKGYIRKGCAEHGLRQLSNAEKTYLEGLKIDP 106



>gb:HS45P1_1998748 Human DNA sequence from clone RP6-45P1 on
           chromosome 22q11.22-12.3, complete
           sequence.>gb:HS477H23_1998849 Human DNA sequence from
           clone RP3-477H23 on chromosome 22q12.1-12.2, complete
           sequence.>gb:HS544A11_1999009 Human DNA sequence from
           clone CTA-544A11 on chromosome 22q12.1-12.3, complete
           sequence.>gb:HSBA436C9_2010928 Human DNA sequence from
           clone RP11-436C9 on chromosome 22, complete
           sequence.>gb:HSBK754D9_2011067 Human DNA sequence from
           clone CTA-754D9 on chromosome 22, complete
           sequence.>gb:HSCB42E1_2011293 Human DNA sequence from
           clone SC22CB-42E1 on chromosome 22q12.1-12.3, complete
           sequence.
          Length = 2481

 Score = 74.3 bits (181), Expect = 7e-13
 Identities = 38/94 (40%), Positives = 55/94 (58%)
 Frame = +2

Query: 149 QGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISLKP 328
           Q N+    G++  A  LY +A+  DP N  LYSNR+AA++ + + +KAL DA     L P
Sbjct: 64  QSNQACHDGDFHTAIVLYNEALAVDPQNCILYSNRSAAYMKIQQYDKALDDAIKARLLNP 123

Query: 329 DWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            W K YFR+G  L+ + R+ +AL AF   L  +P
Sbjct: 124 KWPKAYFRQGVALQYLGRHADALAAFASGLAQDP 157



>gb:AP005317_1850508 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0579G08.
          Length = 381

 Score = 74.3 bits (181), Expect = 7e-13
 Identities = 40/101 (39%), Positives = 58/101 (57%)
 Frame = +2

Query: 128 REVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAE 307
           R   LK +GN  +   +YL AA LY  AI+ DP + TLYSN +  +L + K   AL  A+
Sbjct: 259 RPADLKLEGNRAYMRKDYLTAAKLYNMAIEHDPEDMTLYSNTSVCWLKMGKGMNALETAQ 318

Query: 308 MTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           +   L+PDW KG +R+G     M+ Y++A +AF    K +P
Sbjct: 319 VCRILRPDWPKGCYREGTAHMFMKDYEKACNAFLDGFKLDP 359



>gb:BC045972_2549486 Danio rerio zgc:56178, mRNA (cDNA clone
           MGC:56178 IMAGE:5413232), complete cds.
          Length = 273

 Score = 73.9 bits (180), Expect = 9e-13
 Identities = 36/96 (37%), Positives = 56/96 (58%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K++GN+FFK G +  A   YT+A+  DP NP   +NRA  F  L K   A +D  + I+L
Sbjct: 132 KEKGNQFFKDGQFDSAVECYTRAMDADPYNPVPPTNRATCFYRLKKFAVAESDCNLAIAL 191

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
              + K Y R+     A+E++ EAL+ +++ LK +P
Sbjct: 192 DSKYVKAYIRRAATRTALEKHPEALEDYEMVLKLDP 227



>gb:BC056415_1985311 Homo sapiens hypothetical protein FLJ21908,
           mRNA (cDNA clone MGC:64954 IMAGE:5218249), complete cds.
          Length = 631

 Score = 73.9 bits (180), Expect = 9e-13
 Identities = 35/104 (33%), Positives = 62/104 (59%)
 Frame = +2

Query: 119 DAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALA 298
           D+++ + LK++GN++FK G Y +A   YT+ +  DP NP L +NRA+A+  L K   A +
Sbjct: 129 DSQKALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAES 188

Query: 299 DAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           D  + ++L   + K Y R+G    A+++ +EA   ++  L+  P
Sbjct: 189 DCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEP 232



 Score = 63.9 bits (154), Expect = 9e-10
 Identities = 36/111 (32%), Positives = 55/111 (49%)
 Frame = +2

Query: 98  KTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLV 277
           K      + ++ +S KD+GN FFK G Y +A   YT+ I  D +N  L +NRA A+L + 
Sbjct: 271 KQIEAQQNKQQAISEKDRGNGFFKEGKYERAIECYTRGIAADGANALLPANRAMAYLKIQ 330

Query: 278 KLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           K  +A  D    I L   + K + R+G     + + +EA   F+  L   P
Sbjct: 331 KYEEAEKDCTQAILLDGSYSKAFARRGTARTFLGKLNEAKQDFETVLLLEP 381



>gb:AK025561_1910326 Homo sapiens cDNA: FLJ21908 fis, clone
           HEP03830.
          Length = 665

 Score = 73.9 bits (180), Expect = 9e-13
 Identities = 35/104 (33%), Positives = 62/104 (59%)
 Frame = +2

Query: 119 DAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALA 298
           D+++ + LK++GN++FK G Y +A   YT+ +  DP NP L +NRA+A+  L K   A +
Sbjct: 129 DSQKALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAES 188

Query: 299 DAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           D  + ++L   + K Y R+G    A+++ +EA   ++  L+  P
Sbjct: 189 DCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEP 232



 Score = 63.9 bits (154), Expect = 9e-10
 Identities = 36/111 (32%), Positives = 55/111 (49%)
 Frame = +2

Query: 98  KTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLV 277
           K      + ++ +S KD+GN FFK G Y +A   YT+ I  D +N  L +NRA A+L + 
Sbjct: 271 KQIEAQQNKQQAISEKDRGNGFFKEGKYERAIECYTRGIAADGANALLPANRAMAYLKIQ 330

Query: 278 KLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           K  +A  D    I L   + K + R+G     + + +EA   F+  L   P
Sbjct: 331 KYEEAEKDCTQAILLDGSYSKAFARRGTARTFLGKLNEAKQDFETVLLLEP 381



>gb:AC084406_1733629 Oryza sativa chromosome 3 BAC OSJNBa0067E01
           genomic sequence, complete sequence.
          Length = 525

 Score = 73.6 bits (179), Expect = 1e-12
 Identities = 36/76 (47%), Positives = 47/76 (61%)
 Frame = +2

Query: 203 TQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMER 382
           T A+K DP++ TLYSNR+   L      +AL DA   I LKP+W KGY+RKGC   A++ 
Sbjct: 420 TLAMKLDPADATLYSNRSLCHLRSGAAQEALLDANDCIKLKPEWTKGYYRKGCAHMALKE 479

Query: 383 YDEALDAFQIALKHNP 430
           Y+EA  AF    K +P
Sbjct: 480 YEEACTAFMAGTKLDP 495



>gb:AY182777_1587883 Lycopersicon esculentum type 5 protein
           serine/threonine phosphatase 62 kDa isoform (PP5) mRNA,
           complete cds, alternatively spliced.>gb:AY182778_1587884
           Lycopersicon esculentum type 5 protein serine/threonine
           phosphatase (PP5) gene, complete cds, alternatively
           spliced.
          Length = 556

 Score = 73.6 bits (179), Expect = 1e-12
 Identities = 41/106 (38%), Positives = 56/106 (52%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKA 292
           +S+A R   LK   NE FK   Y +A  LYTQAI+ +  N   Y+NRA A   L +   A
Sbjct: 8   NSNASRAEELKQLANEAFKGHKYSQAIDLYTQAIELNGENAVYYANRAFAHTKLEEYGSA 67

Query: 293 LADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           + D    I + P + KGY+R+G    AM ++ +AL  FQ   K  P
Sbjct: 68  IQDGTRAIEIDPRYSKGYYRRGAAYLAMGKFKDALKDFQQVKKLCP 113



>gb:AY150041_1584918 Lycopersicon esculentum type 5 serine/threonine
           phosphatase 55 kDa isoform mRNA, complete cds;
           alternatively spliced.>gb:AY182778_1587885 Lycopersicon
           esculentum type 5 protein serine/threonine phosphatase
           (PP5) gene, complete cds, alternatively spliced.
          Length = 485

 Score = 73.6 bits (179), Expect = 1e-12
 Identities = 41/106 (38%), Positives = 56/106 (52%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKA 292
           +S+A R   LK   NE FK   Y +A  LYTQAI+ +  N   Y+NRA A   L +   A
Sbjct: 8   NSNASRAEELKQLANEAFKGHKYSQAIDLYTQAIELNGENAVYYANRAFAHTKLEEYGSA 67

Query: 293 LADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           + D    I + P + KGY+R+G    AM ++ +AL  FQ   K  P
Sbjct: 68  IQDGTRAIEIDPRYSKGYYRRGAAYLAMGKFKDALKDFQQVKKLCP 113



>gb:BC068804_2555304 Xenopus laevis hypothetical protein MGC81394,
           mRNA (cDNA clone MGC:81394 IMAGE:6634832), complete cds.
          Length = 312

 Score = 73.2 bits (178), Expect = 2e-12
 Identities = 39/112 (34%), Positives = 59/112 (52%)
 Frame = +2

Query: 95  GKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHL 274
           G  +  D D     SLK +GNE  K  N+  A   YT+A++ +P N   Y NRAAA+  L
Sbjct: 76  GLASPSDEDVAEAESLKTEGNEQMKVENFESAVTYYTKALELNPRNAVYYCNRAAAYSKL 135

Query: 275 VKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
                A+ D E  IS+ P + K Y R G  L ++ ++ E++  ++ AL  +P
Sbjct: 136 GNYAGAVRDCEEAISIDPSYSKAYGRMGLALSSLNKHAESVGFYKQALVLDP 187



>gb:AP005317_1850511 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0579G08.
          Length = 657

 Score = 73.2 bits (178), Expect = 2e-12
 Identities = 38/112 (33%), Positives = 64/112 (57%), Gaps = 1/112 (0%)
 Frame = +2

Query: 98  KTTMGDSDAKREVS-LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHL 274
           + ++G+  +KR+ + LK  GN+  +  +YL A   Y+QA+   P + TL+SNR+  + H+
Sbjct: 521 QASLGEPVSKRKATELKSLGNKAVEKKDYLSATGFYSQAVDLYPDDATLFSNRSLCWHHM 580

Query: 275 VKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
              +KAL DA     L+PDW K Y+R+G  L  ++ Y+ A +      K +P
Sbjct: 581 GDGHKALLDAYECRKLRPDWLKAYYRQGAALMLLKDYESACETLYDGFKLDP 632



>gb:AK009765_1155341 Mus musculus adult male tongue cDNA, RIKEN
           full-length enriched library, clone:2310042P20
           product:hypothetical TPR repeat containing protein, full
           insert sequence.>gb:BC004046_2089560 Mus musculus DNA
           segment, Chr 15, ERATO Doi 682, expressed, mRNA (cDNA
           clone MGC:7675 IMAGE:3496407), complete cds.
          Length = 660

 Score = 73.2 bits (178), Expect = 2e-12
 Identities = 35/104 (33%), Positives = 62/104 (59%)
 Frame = +2

Query: 119 DAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALA 298
           D+++ + LK++GN++FK G Y +A   YT+ +  DP NP L +NRA+A+  L K   A +
Sbjct: 130 DSQKALVLKEKGNKYFKQGKYDEAIECYTKGMDADPYNPVLPTNRASAYFRLKKFAVAES 189

Query: 299 DAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           D  + I+L   + K Y R+G    A+++ ++A   ++  L+  P
Sbjct: 190 DCNLAIALSRTYTKAYARRGAARFALQKLEDARKDYEKVLELEP 233



 Score = 64.3 bits (155), Expect = 7e-10
 Identities = 36/113 (31%), Positives = 56/113 (49%)
 Frame = +2

Query: 92  KGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLH 271
           + K T G    ++ ++ KD GN FFK G Y +A   YT+ I  D +N  L +NRA A+L 
Sbjct: 271 ESKPTGGQQGRQKAIAEKDLGNGFFKEGKYEQAIECYTRGIAADRTNALLPANRAMAYLK 330

Query: 272 LVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           + +  +A  D    I L   + K + R+G     + + +EA   F+  L   P
Sbjct: 331 IQRYEEAERDCTQAIVLDGSYSKAFARRGTARTFLGKINEAKQDFETVLLLEP 383



>gb:BC088960_2566010 Xenopus laevis hypothetical LOC496358, mRNA
           (cDNA clone MGC:85091 IMAGE:6867506), complete cds.
          Length = 302

 Score = 72.8 bits (177), Expect = 2e-12
 Identities = 40/120 (33%), Positives = 63/120 (52%)
 Frame = +2

Query: 71  QISANFLKGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSN 250
           Q S     G  +  D D      LK +GNE  K  N+  A + YT+A++ +P+N   Y N
Sbjct: 56  QNSPEVNSGLASPSDEDLAEAERLKTEGNEQMKVENFESAISYYTKALELNPANAVYYCN 115

Query: 251 RAAAFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           RAAA+  L     A+ D E  I++ P++ K Y R G  L ++ ++ EA+  ++ AL  +P
Sbjct: 116 RAAAYSKLGNYAGAVRDCEAAITIDPNYSKAYGRMGLALSSLNKHAEAVGFYKQALVLDP 175



>gb:CR382124_1656385 Kluyveromyces lactis strain NRRL Y-1140
           chromosome D of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 335

 Score = 72.4 bits (176), Expect = 3e-12
 Identities = 44/116 (37%), Positives = 65/116 (56%), Gaps = 1/116 (0%)
 Frame = +2

Query: 74  ISANFLKGKTTMGDSDAKREVS-LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSN 250
           +S   +K    + D+ AK +   LK QGN+   A  + +A   YT AI+  PSN   YSN
Sbjct: 75  VSGEPVKVHIPVEDAAAKAKAEELKLQGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSN 134

Query: 251 RAAAFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIAL 418
           RAAA+  L +  +A+ DAE  I + P + KG+ R G    A+ + +EALDA++  L
Sbjct: 135 RAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKYALNKPEEALDAYKKVL 190



>gb:BC079414_2107527 Rattus norvegicus similar to RIKEN cDNA
           2310042P20, mRNA (cDNA clone MGC:94954 IMAGE:7113336),
           complete cds.
          Length = 659

 Score = 72.0 bits (175), Expect = 3e-12
 Identities = 35/104 (33%), Positives = 61/104 (58%)
 Frame = +2

Query: 119 DAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALA 298
           D+++ + LK++GN++FK G Y +A   YT+ +  DP NP L +NRA+A+  L K   A +
Sbjct: 129 DSQKALVLKEKGNKYFKQGKYDEAIECYTKGMDADPYNPVLPTNRASAYFRLKKFAVAES 188

Query: 299 DAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           D  + I+L   + K Y R+G    A+++ ++A   +   L+  P
Sbjct: 189 DCNLAIALSRSYTKAYARRGAARFALQKLEDARKDYVKVLELEP 232



 Score = 61.2 bits (147), Expect = 6e-09
 Identities = 34/102 (33%), Positives = 52/102 (50%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           ++ ++ KD GN FFK G Y +A   YT+ I  D +N  L +NRA A+L + K  +A  D 
Sbjct: 280 QKAIAEKDLGNGFFKEGKYEQAIECYTRGIAADSTNALLPANRAMAYLKVQKYEEAERDC 339

Query: 305 EMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
              I L   + K + R+G     + + +EA   F+  L   P
Sbjct: 340 TQAILLDGSYSKAFARRGTARTFLGKINEAKQDFETVLLLEP 381



>gb:AP005012_1847269 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0627E03.
          Length = 613

 Score = 72.0 bits (175), Expect = 3e-12
 Identities = 42/106 (39%), Positives = 57/106 (53%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKA 292
           D+D      LK++GN  FK   + KA   Y+ AIK + +N T YSNRAAA+L L +  +A
Sbjct: 491 DADFGAAELLKEKGNSAFKGRKWSKAVEFYSDAIKLNGTNATYYSNRAAAYLELGRYKQA 550

Query: 293 LADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            AD E  + L     K Y R+G   EA+  + EAL   + AL   P
Sbjct: 551 EADCEQALLLDKKNVKAYLRRGIAREAVLNHQEALQDIRHALALEP 596



>gb:AP004999_1847035 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0040H05.
          Length = 398

 Score = 72.0 bits (175), Expect = 3e-12
 Identities = 38/108 (35%), Positives = 61/108 (56%), Gaps = 1/108 (0%)
 Frame = +2

Query: 110 GDSDAKREVS-LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLN 286
           G+  +KR+ + LK  GN+  +  +YL A   Y++A+   P + TL+SNR+  + H+    
Sbjct: 266 GEPVSKRKATELKSLGNKAVEKKDYLSATGFYSKALDLYPDDATLFSNRSLCWHHMGNGG 325

Query: 287 KALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           KAL DA     L+PDW K Y+R+G  L  ++ Y+ A +     LK +P
Sbjct: 326 KALLDAYECRKLRPDWPKAYYRQGAALMLLKDYESACETLYDGLKLDP 373



>gb:PPP5C_2039892 Human serine-threonine phosphatase (PP5) mRNA,
           partial cds.
          Length = 491

 Score = 71.6 bits (174), Expect = 4e-12
 Identities = 39/106 (36%), Positives = 56/106 (52%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKA 292
           D   KR   LK Q N++FKA +Y  A   Y+QAI+ +PSN   Y NR+ A+L       A
Sbjct: 14  DGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYA 73

Query: 293 LADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L DA   I L   + KGY+R+     A+ ++  AL  ++  +K  P
Sbjct: 74  LGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKP 119



>gb:HSRNAPPP5_2020084 H.sapiens mRNA for protein phosphatase 5.
          Length = 493

 Score = 71.6 bits (174), Expect = 4e-12
 Identities = 39/106 (36%), Positives = 56/106 (52%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKA 292
           D   KR   LK Q N++FKA +Y  A   Y+QAI+ +PSN   Y NR+ A+L       A
Sbjct: 16  DGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYA 75

Query: 293 LADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L DA   I L   + KGY+R+     A+ ++  AL  ++  +K  P
Sbjct: 76  LGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKP 121



>gb:BC000750_1967000 Homo sapiens protein phosphatase 5, catalytic
           subunit, mRNA (cDNA clone IMAGE:2961155), partial
           cds.>gb:BC001831_1967888 Homo sapiens protein
           phosphatase 5, catalytic subunit, mRNA (cDNA clone
           IMAGE:2961155), partial cds.
          Length = 484

 Score = 71.6 bits (174), Expect = 4e-12
 Identities = 39/106 (36%), Positives = 56/106 (52%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKA 292
           D   KR   LK Q N++FKA +Y  A   Y+QAI+ +PSN   Y NR+ A+L       A
Sbjct: 20  DGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYA 79

Query: 293 LADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L DA   I L   + KGY+R+     A+ ++  AL  ++  +K  P
Sbjct: 80  LGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKP 125



>gb:AP005563_1854112 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OJ1227_D07.
          Length = 439

 Score = 71.6 bits (174), Expect = 4e-12
 Identities = 42/109 (38%), Positives = 58/109 (53%), Gaps = 3/109 (2%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPS---NPTLYSNRAAAFLHLVKL 283
           D   K+   +K +G E FK  +YL AA LYT A+   PS   + TL +NR+  +L L   
Sbjct: 305 DLCVKKIAQMKVEGKEAFKRKDYLLAAQLYTSALGLGPSPDDSATLLANRSLCWLRLENG 364

Query: 284 NKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            +ALADA M    +P W K  +R+G     ++ Y  A DAF   LK +P
Sbjct: 365 KQALADANMCRMFRPHWIKACYRQGAAFMLLKEYGNACDAFSDGLKLDP 413



>gb:CR859667_1183773 Pongo pygmaeus mRNA; cDNA DKFZp459E169 (from
           clone DKFZp459E169).
          Length = 499

 Score = 71.6 bits (174), Expect = 4e-12
 Identities = 39/106 (36%), Positives = 56/106 (52%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKA 292
           D   KR   LK Q N++FKA +Y  A   Y+QAI+ +PSN   Y NR+ A+L       A
Sbjct: 22  DGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYA 81

Query: 293 LADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L DA   I L   + KGY+R+     A+ ++  AL  ++  +K  P
Sbjct: 82  LGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKP 127



>pir|S52570|S52570 phosphoprotein phosphatase (EC 3.1.3.16) 5
           [validated] - human
          Length = 498

 Score = 71.6 bits (174), Expect = 4e-12
 Identities = 39/106 (36%), Positives = 56/106 (52%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKA 292
           D   KR   LK Q N++FKA +Y  A   Y+QAI+ +PSN   Y NR+ A+L       A
Sbjct: 22  DGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYA 81

Query: 293 LADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L DA   I L   + KGY+R+     A+ ++  AL  ++  +K  P
Sbjct: 82  LGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKP 127



>sp|Q9USI5|STI1_SCHPO Heat shock protein sti1
           homolog.>pir|T41531|T41531 activator of Hsp70 and Hsp90
           chaperones - fission yeast  (Schizosaccharomyces
           pombe)>gb:SPCC645_1721534 S.pombe chromosome III cosmid
           c645.
          Length = 591

 Score = 71.6 bits (174), Expect = 4e-12
 Identities = 40/96 (41%), Positives = 50/96 (52%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK +GN  F   +Y  A   +TQAI  D  N  LYSNR+A +        AL DA     
Sbjct: 5   LKAKGNAAFSKKDYKTAIDYFTQAIGLDERNHILYSNRSACYASEKDYADALKDATKCTE 64

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHN 427
           LKPDW KG+ RKG  L  +   D A  A++  LKH+
Sbjct: 65  LKPDWAKGWSRKGAALHGLGDLDAARSAYEEGLKHD 100



 Score = 66.6 bits (161), Expect = 1e-10
 Identities = 35/97 (36%), Positives = 55/97 (56%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKA 292
           D D   E  +K  GNE FK+G++  A   YT+  K+ PS+P  + NRAAA+L ++   + 
Sbjct: 395 DPDKAEESRVK--GNELFKSGDFANAIKEYTEMTKRAPSDPRGFGNRAAAYLKVMAPAEC 452

Query: 293 LADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDA 403
           + D    I L P++ K Y RK   L  ++ Y++ +DA
Sbjct: 453 IRDCNKAIELDPNFAKAYVRKAQALFMLKDYNKCIDA 489



>sp|P53041|PPP5_HUMAN Serine/threonine protein phosphatase 5 (EC
           3.1.3.16) (PP5) (Protein phosphatase T) (PP-T)
           (PPT).>gb:AC007193_1875224 Homo sapiens chromosome 19,
           BAC 82621 (CIT-B-139a18), complete
           sequence.>gb:BC001970_1968010 Homo sapiens protein
           phosphatase 5, catalytic subunit, mRNA (cDNA clone
           MGC:5260 IMAGE:3459309), complete
           cds.>gb:BT007275_1990713 Homo sapiens protein
           phosphatase 5, catalytic subunit mRNA, complete cds.
          Length = 499

 Score = 71.6 bits (174), Expect = 4e-12
 Identities = 39/106 (36%), Positives = 56/106 (52%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKA 292
           D   KR   LK Q N++FKA +Y  A   Y+QAI+ +PSN   Y NR+ A+L       A
Sbjct: 22  DGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYA 81

Query: 293 LADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L DA   I L   + KGY+R+     A+ ++  AL  ++  +K  P
Sbjct: 82  LGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKP 127



>gb:AC087797_1734175 Oryza sativa chromosome 3 BAC OSJNBb0022E02
           genomic sequence, complete sequence.
          Length = 586

 Score = 71.2 bits (173), Expect = 6e-12
 Identities = 44/114 (38%), Positives = 58/114 (50%)
 Frame = +2

Query: 89  LKGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFL 268
           +  K  M +  A+   + K++GN  FK   + KA   YT+AIK +    T YSNRAAAFL
Sbjct: 459 VSSKQAMSEEAAE---AAKEKGNIAFKEKQWQKAINFYTEAIKLNNKVATYYSNRAAAFL 515

Query: 269 HLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            L    +A AD    I + P   K Y R+G   E +  Y EA+D F  AL   P
Sbjct: 516 ELASYRQAEADCTSAIDIDPKIVKAYLRRGTAREMLGYYKEAVDDFSHALVLEP 569



>gb:AY182779_1587886 Arabidopsis thaliana type 5 protein
           serine/threonine phosphatase 60 kDa isoform mRNA,
           complete cds, alternatively spliced.
          Length = 538

 Score = 71.2 bits (173), Expect = 6e-12
 Identities = 39/111 (35%), Positives = 58/111 (52%)
 Frame = +2

Query: 98  KTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLV 277
           +T   +SD  R    K Q NE FK   Y  A  LYT+AI+ + +N   ++NRA A   L 
Sbjct: 2   ETKNENSDVSRAEEFKSQANEAFKGHKYSSAIDLYTKAIELNSNNAVYWANRAFAHTKLE 61

Query: 278 KLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           +   A+ DA   I +   + KGY+R+G    AM ++ +AL  FQ   + +P
Sbjct: 62  EYGSAIQDASKAIEVDSRYSKGYYRRGAAYLAMGKFKDALKDFQQVKRLSP 112



>gb:AC006931_1534828 Arabidopsis thaliana chromosome 2 clone F7D19
           map m551, complete sequence.>gb:BT010180_1640246
           Arabidopsis thaliana At2g42810/F7D19.19 mRNA, complete
           cds.>gb:AF419574_1798436 Arabidopsis thaliana
           At2g42810/F7D19.19 mRNA, complete cds.
          Length = 484

 Score = 71.2 bits (173), Expect = 6e-12
 Identities = 39/111 (35%), Positives = 58/111 (52%)
 Frame = +2

Query: 98  KTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLV 277
           +T   +SD  R    K Q NE FK   Y  A  LYT+AI+ + +N   ++NRA A   L 
Sbjct: 2   ETKNENSDVSRAEEFKSQANEAFKGHKYSSAIDLYTKAIELNSNNAVYWANRAFAHTKLE 61

Query: 278 KLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           +   A+ DA   I +   + KGY+R+G    AM ++ +AL  FQ   + +P
Sbjct: 62  EYGSAIQDASKAIEVDSRYSKGYYRRGAAYLAMGKFKDALKDFQQVKRLSP 112



>pir|E84858|E84858 phosphoprotein phosphatase (EC 3.1.3.16)
           At2g42810 [similarity] - Arabidopsis thaliana
          Length = 533

 Score = 71.2 bits (173), Expect = 6e-12
 Identities = 39/111 (35%), Positives = 58/111 (52%)
 Frame = +2

Query: 98  KTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLV 277
           +T   +SD  R    K Q NE FK   Y  A  LYT+AI+ + +N   ++NRA A   L 
Sbjct: 2   ETKNENSDVSRAEEFKSQANEAFKGHKYSSAIDLYTKAIELNSNNAVYWANRAFAHTKLE 61

Query: 278 KLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           +   A+ DA   I +   + KGY+R+G    AM ++ +AL  FQ   + +P
Sbjct: 62  EYGSAIQDASKAIEVDSRYSKGYYRRGAAYLAMGKFKDALKDFQQVKRLSP 112



>gb:AJ721018_2503205 Gallus gallus mRNA for hypothetical protein,
           clone 32j5.
          Length = 313

 Score = 70.9 bits (172), Expect = 7e-12
 Identities = 38/109 (34%), Positives = 60/109 (55%)
 Frame = +2

Query: 104 TMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKL 283
           T  + D      LK +GNE  KA N+  A + Y +AI+ +PSN   + NRAAA+  L   
Sbjct: 81  TPSEDDIAEAERLKTEGNEQMKAENFEAAVSFYGKAIELNPSNAVYFCNRAAAYSKLGNY 140

Query: 284 NKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
             A+ D E  I + P++ K Y R G  L ++ ++ EA+  ++ AL+ +P
Sbjct: 141 AGAVRDCERAIGIDPNYSKAYGRMGLALSSLNKHTEAVVYYKKALELDP 189



>gb:AJ720031_2502218 Gallus gallus mRNA for hypothetical protein,
           clone 9l4.
          Length = 665

 Score = 70.9 bits (172), Expect = 7e-12
 Identities = 32/101 (31%), Positives = 62/101 (61%)
 Frame = +2

Query: 119 DAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALA 298
           D ++ ++ K++GN++FK GN+ +A   YT+ +  DP NP L +NRA+AF  + K + A +
Sbjct: 129 DKEKALAEKEKGNKYFKQGNFDEAIKCYTRGMHSDPFNPVLPTNRASAFYRMKKFSVAES 188

Query: 299 DAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
           D  + ++L  ++ K Y R+G    A++ +  A + ++  L+
Sbjct: 189 DCNLALALDKNYTKAYARRGAARFALKNFQGAKEDYEKVLE 229



 Score = 64.7 bits (156), Expect = 5e-10
 Identities = 35/102 (34%), Positives = 53/102 (51%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           ++ V+ KD GN +FK G Y  A   YT+ I  D +N  L +NRA A+L + K  +A  D 
Sbjct: 281 QKAVTEKDLGNGYFKEGKYEAAIECYTRGIAADGTNALLPANRAMAYLKIQKYEEAENDC 340

Query: 305 EMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
              + L   + K + R+G    A+ +  EA+  F+  LK  P
Sbjct: 341 TQALLLDASYSKAFARRGAARVALGKLKEAMQDFEAVLKLEP 382



>gb:RNU12203_2136861 Rattus norvegicus phosphoprotein phosphatase
           mRNA, partial cds.
          Length = 479

 Score = 70.5 bits (171), Expect = 1e-11
 Identities = 38/102 (37%), Positives = 55/102 (53%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           KR   LK Q N++FKA +Y  A   Y+QAI+ +PSN   Y NR+ A+L       AL DA
Sbjct: 6   KRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDA 65

Query: 305 EMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
              I L   + KGY+R+     A+ ++  AL  ++  +K  P
Sbjct: 66  TRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKP 107



>gb:MMU12204_2118321 Mus musculus phosphoprotein phosphatase mRNA,
           partial cds.
          Length = 144

 Score = 70.5 bits (171), Expect = 1e-11
 Identities = 38/106 (35%), Positives = 55/106 (51%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKA 292
           D   KR   LK Q N++FKA +Y  A   Y+QAI+ +P N   Y NR+ A+L       A
Sbjct: 11  DGTLKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPGNAIYYGNRSLAYLRTECYGYA 70

Query: 293 LADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L DA   I L   + KGY+R+     A+ ++  AL  ++  +K  P
Sbjct: 71  LGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKP 116



>gb:BC078786_2106945 Rattus norvegicus protein phosphatase 5,
           catalytic subunit, mRNA (cDNA clone MGC:93338
           IMAGE:7126555), complete cds.
          Length = 499

 Score = 70.5 bits (171), Expect = 1e-11
 Identities = 38/102 (37%), Positives = 55/102 (53%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           KR   LK Q N++FKA +Y  A   Y+QAI+ +PSN   Y NR+ A+L       AL DA
Sbjct: 26  KRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDA 85

Query: 305 EMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
              I L   + KGY+R+     A+ ++  AL  ++  +K  P
Sbjct: 86  TRAIDLDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKP 127



>sp|P53042|PPP5_RAT Serine/threonine protein phosphatase 5 (EC
           3.1.3.16) (PP5) (Protein phosphatase T)
           (PPT).>gb:RNPPT_2136243 R.norvegicus mRNA for protein
           phosphatase T.
          Length = 499

 Score = 70.5 bits (171), Expect = 1e-11
 Identities = 38/102 (37%), Positives = 55/102 (53%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           KR   LK Q N++FKA +Y  A   Y+QAI+ +PSN   Y NR+ A+L       AL DA
Sbjct: 26  KRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDA 85

Query: 305 EMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
              I L   + KGY+R+     A+ ++  AL  ++  +K  P
Sbjct: 86  TRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKP 127



>gb:BC071463_2556203 Danio rerio zgc:56411, mRNA (cDNA clone
           MGC:86801 IMAGE:6900900), complete cds.
          Length = 402

 Score = 70.1 bits (170), Expect = 1e-11
 Identities = 44/101 (43%), Positives = 53/101 (52%), Gaps = 11/101 (10%)
 Frame = +2

Query: 137 SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNP----TLYSNRAAAFLHLVKLNKALADA 304
           SLKD+GNE+FK   Y KA   YT+ +K    NP     LY+NRAAA  HL  +  AL DA
Sbjct: 81  SLKDEGNEYFKEKKYKKAVVSYTEGLKTSCVNPELNAVLYTNRAAAHFHLGNMRSALNDA 140

Query: 305 EMTISLKPDWEKGYFRKG-CILE------AMERYDEALDAF 406
                LKPD  K   R   C+LE      A++  DE L  F
Sbjct: 141 TAAKKLKPDHNKAIIRGAQCLLELRNYAGALQWCDEGLKLF 181



>gb:BC068702_2555205 Xenopus laevis hypothetical protein MGC81126,
           mRNA (cDNA clone MGC:81126 IMAGE:6317498), complete cds.
          Length = 660

 Score = 70.1 bits (170), Expect = 1e-11
 Identities = 39/120 (32%), Positives = 65/120 (54%), Gaps = 5/120 (4%)
 Frame = +2

Query: 77  SANFLKGKTTMGDSDA-----KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTL 241
           ++N     +  GD DA     ++ +S K++GN +FK+G Y +A   YT+ +  DP N  L
Sbjct: 109 NSNETSSDSECGDEDAITVDTEKALSEKEKGNNYFKSGKYDEAIECYTRGMDADPYNAIL 168

Query: 242 YSNRAAAFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
            +NRA+AF  L K   A +D  + I+L  D+ K Y R+G    A++    A + ++  L+
Sbjct: 169 PTNRASAFFRLKKFAVAESDCNLAIALNRDYAKAYARRGAARLALKNLQGAKEDYEKVLE 228



 Score = 66.2 bits (160), Expect = 2e-10
 Identities = 38/123 (30%), Positives = 65/123 (52%), Gaps = 10/123 (8%)
 Frame = +2

Query: 92  KGKTTMGDSDAKREVSL----------KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTL 241
           + K T+ + + K+++ +          KD GN +FK G Y  A   Y+Q ++ D +N  L
Sbjct: 261 EAKITVENEEEKKQIEIQQRKQQAIMQKDLGNAYFKEGKYEIAIECYSQGMEADNTNALL 320

Query: 242 YSNRAAAFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
            +NRA A+L + K  +A AD  + ISL   + K + R+G     + +  EA + F++ LK
Sbjct: 321 PANRAMAYLKIQKYKEAEADCTLAISLDASYCKAFARRGTASIMLGKQKEAKEDFEMVLK 380

Query: 422 HNP 430
            +P
Sbjct: 381 LDP 383



>gb:BC049428_2550237 Danio rerio zgc:56411, mRNA (cDNA clone
           MGC:56411 IMAGE:5605382), complete cds.
          Length = 399

 Score = 70.1 bits (170), Expect = 1e-11
 Identities = 44/101 (43%), Positives = 53/101 (52%), Gaps = 11/101 (10%)
 Frame = +2

Query: 137 SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNP----TLYSNRAAAFLHLVKLNKALADA 304
           SLKD+GNE+FK   Y KA   YT+ +K    NP     LY+NRAAA  HL  +  AL DA
Sbjct: 81  SLKDEGNEYFKEKKYKKAVVSYTEGLKTSCVNPELNAVLYTNRAAAHFHLGNMRSALNDA 140

Query: 305 EMTISLKPDWEKGYFRKG-CILE------AMERYDEALDAF 406
                LKPD  K   R   C+LE      A++  DE L  F
Sbjct: 141 TAAKKLKPDHNKAIIRGAQCLLELRNYAGALQWCDEGLKLF 181



>pir|T51996|T51996 hypothetical protein stil+ - fission yeast
           (Schizosaccharomyces pombe)>gb:D85197_1674883
           Schizosaccharomyces pombe stil+ gene, complete cds.
          Length = 591

 Score = 70.1 bits (170), Expect = 1e-11
 Identities = 39/96 (40%), Positives = 49/96 (51%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK +GN  F   +Y  A   +TQ I  D  N  LYSNR+A +        AL DA     
Sbjct: 5   LKAKGNAAFSKKDYKTAIDYFTQTIGLDERNHILYSNRSACYASEKDYADALKDATKCTE 64

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHN 427
           LKPDW KG+ RKG  L  +   D A  A++  LKH+
Sbjct: 65  LKPDWAKGWSRKGAALHGLGDLDAARSAYEEGLKHD 100



 Score = 66.6 bits (161), Expect = 1e-10
 Identities = 35/97 (36%), Positives = 55/97 (56%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKA 292
           D D   E  +K  GNE FK+G++  A   YT+  K+ PS+P  + NRAAA+L ++   + 
Sbjct: 395 DPDKAEESRVK--GNELFKSGDFANAIKEYTEMTKRAPSDPRGFGNRAAAYLKVMAPAEC 452

Query: 293 LADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDA 403
           + D    I L P++ K Y RK   L  ++ Y++ +DA
Sbjct: 453 IRDCNKAIELDPNFAKAYVRKAQALFMLKDYNKCIDA 489



>sp|Q60676|PPP5_MOUSE Serine/threonine protein phosphatase 5 (EC
           3.1.3.16) (PP5) (Protein phosphatase T)
           (PPT).>gb:AF018262_2050988 Mus musculus protein
           phosphatase 5 (PP5) mRNA, complete
           cds.>gb:BC003744_2089304 Mus musculus protein
           phosphatase 5, catalytic subunit, mRNA (cDNA clone
           MGC:5847 IMAGE:3590322), complete cds.
          Length = 499

 Score = 70.1 bits (170), Expect = 1e-11
 Identities = 38/106 (35%), Positives = 55/106 (51%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKA 292
           D   KR   LK Q N++FKA +Y  A   Y+QAI+ +P N   Y NR+ A+L       A
Sbjct: 22  DGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPGNAIYYGNRSLAYLRTECYGYA 81

Query: 293 LADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L DA   I L   + KGY+R+     A+ ++  AL  ++  +K  P
Sbjct: 82  LGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKP 127



>gb:BC072155_2556415 Xenopus laevis hypothetical protein MGC80137,
           mRNA (cDNA clone MGC:80137 IMAGE:4970077), complete cds.
          Length = 384

 Score = 69.3 bits (168), Expect = 2e-11
 Identities = 45/111 (40%), Positives = 56/111 (50%), Gaps = 5/111 (4%)
 Frame = +2

Query: 113 DSDAKREV-SLKDQGNEFFKAGNYLKAAALYTQAIKKDPS----NPTLYSNRAAAFLHLV 277
           D D + +  S KD+GNE+FK  +Y KA   YT+ IKK+      N  LY+NRAAA  +L 
Sbjct: 68  DGDPEEQAKSYKDEGNEYFKEKDYNKAITSYTEGIKKNCKDQELNAILYTNRAAAQFYLG 127

Query: 278 KLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
               AL DA     LKPD  K   R       ++ Y EAL      LK NP
Sbjct: 128 NYRSALNDATAARKLKPDHLKAVIRGALCCVEIKNYTEALKWCDEGLKFNP 178



>gb:BC064275_2553826 Xenopus tropicalis hypothetical protein
           LOC394994, mRNA (cDNA clone IMAGE:5379951), partial cds.
          Length = 294

 Score = 69.3 bits (168), Expect = 2e-11
 Identities = 39/120 (32%), Positives = 63/120 (52%)
 Frame = +2

Query: 71  QISANFLKGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSN 250
           Q S     G  +  D D      LK +GNE  K  N+  A + Y++A++ +P+N   Y N
Sbjct: 48  QDSPQVNSGLASPCDEDVAEAERLKTEGNEQMKLENFESAISYYSKALELNPTNAVYYCN 107

Query: 251 RAAAFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           RAAA+  L     A+ D E  I++ P++ K Y R G  L ++ ++ EA+  ++ AL  +P
Sbjct: 108 RAAAYSKLGNYAGAVRDCEEAITIDPNYSKAYGRMGLALSSLNKHAEAVGFYKQALILDP 167



>gb:AF179282_1774760 Pisum sativum Toc64 (toc64) mRNA, complete cds;
           chloroplast gene for chloroplast product.
          Length = 593

 Score = 69.3 bits (168), Expect = 2e-11
 Identities = 42/113 (37%), Positives = 59/113 (52%)
 Frame = +2

Query: 92  KGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLH 271
           K   ++   +   E+S K++GN+ +K   + KA   YT+AIK   +N T YSNRA A+L 
Sbjct: 465 KSSKSVVSKEQSAEIS-KEKGNQAYKDKQWQKAIGFYTEAIKLCGNNATYYSNRAQAYLE 523

Query: 272 LVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L    +A  D    IS      K YFR+G   E +  Y EA+D F+ AL   P
Sbjct: 524 LGSYLQAEEDCTTAISFDKKNVKAYFRRGTAREMLGYYKEAIDDFKYALVLEP 576



>gb:AE017341_1754111 Cryptococcus neoformans var. neoformans JEC21
           chromosome 1, complete sequence.
          Length = 338

 Score = 69.3 bits (168), Expect = 2e-11
 Identities = 44/130 (33%), Positives = 69/130 (53%)
 Frame = +2

Query: 41  RSKNSP*TLTQISANFLKGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKK 220
           ++K+   T  Q  A+  +  + +  +D  +  SLK +GN+      Y  A   YT+AIK 
Sbjct: 76  KAKSFASTSPQSEASLPQSSSDISQTDKIKAESLKTKGNQLMGQKLYDSAIEQYTEAIKL 135

Query: 221 DPSNPTLYSNRAAAFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALD 400
           DP NP  YSNRAAA+    +  KA+ DAE  + L P + K Y R G    ++  Y +A+ 
Sbjct: 136 DP-NPVYYSNRAAAWGGAGQHEKAVEDAEKALELDPKFTKAYSRLGHAHFSLGNYSDAVR 194

Query: 401 AFQIALKHNP 430
           A++  L+ +P
Sbjct: 195 AYENGLELDP 204



>gb:CR382136_1669321 Debaryomyces hansenii chromosome D of strain
           CBS767 of Debaryomyces hansenii.
          Length = 532

 Score = 68.9 bits (167), Expect = 3e-11
 Identities = 36/105 (34%), Positives = 56/105 (53%)
 Frame = +2

Query: 116 SDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKAL 295
           ++ +  + LKD+GN + K   +  A   YT+AI+ DP+N   YSNRA   + L     A+
Sbjct: 3   NNKEEAIKLKDEGNAYLKEHRHNYAIDSYTKAIELDPTNAVFYSNRAQVHIKLENYGLAI 62

Query: 296 ADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           +D    + + P+  K Y+R+G  L A+  Y EA   F+  LK  P
Sbjct: 63  SDCNEALKVDPNMMKAYYRRGISLMAILNYKEAQINFKEILKKMP 107



>pir|A55346|A55346 phosphoprotein phosphatase (EC 3.1.3.16) PPT
           [validated] - rat
          Length = 499

 Score = 68.9 bits (167), Expect = 3e-11
 Identities = 37/102 (36%), Positives = 55/102 (53%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           KR   LK Q N++FKA +Y  A   Y++AI+ +PSN   Y NR+ A+L       AL DA
Sbjct: 26  KRAEELKTQANDYFKAKDYENAIKFYSKAIELNPSNAIYYGNRSLAYLRTECYGYALGDA 85

Query: 305 EMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
              I L   + KGY+R+     A+ ++  AL  ++  +K  P
Sbjct: 86  TRAIELDKKYIKGYYRRAASNMALGKFRAALRDYETVVKVKP 127



>gb:CR382137_1670042 Debaryomyces hansenii chromosome E of strain
           CBS767 of Debaryomyces hansenii.
          Length = 571

 Score = 68.6 bits (166), Expect = 4e-11
 Identities = 36/94 (38%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPS-NPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           K QGN++F A ++ KA   +T+AI+  P+ N  LYSNR+A++  L    KAL DAE  + 
Sbjct: 7   KAQGNQYFAAKDFTKAIEYFTKAIEASPTPNHVLYSNRSASYASLKNFKKALEDAEECVK 66

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
           +   W KGY R       +   DEA  +++ AL+
Sbjct: 67  VNDSWAKGYNRVASAQHGLGNLDEAKTSYKKALE 100



 Score = 60.8 bits (146), Expect = 8e-09
 Identities = 36/130 (27%), Positives = 61/130 (46%), Gaps = 2/130 (1%)
 Frame = +2

Query: 32  ETLRSKNSP*TLTQISANF--LKGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYT 205
           ++L    +P  L ++ A    +K +  +   D ++    + QG E+F  G++  A   YT
Sbjct: 345 KSLTEHRTPDILNKLRATQRDIKIQEALSYVDPEKAEEARLQGKEYFTKGDWPNAVKAYT 404

Query: 206 QAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERY 385
           + +K+ P +   YSNRAAA   L+    A+ D    I   P + + Y RK     AM  Y
Sbjct: 405 EMVKRAPEDARGYSNRAAALAKLMSFPDAVQDCNKAIEKDPSFIRAYIRKANAQLAMREY 464

Query: 386 DEALDAFQIA 415
            + ++   IA
Sbjct: 465 SQVMETLNIA 474



>pir|T40391|T40391 phosphoprotein phosphatase (EC 3.1.3.16)
           SPBC3F6.01c [similarity] - fission yeast
           (Schizosaccharomyces pombe)>gb:SPBC3F6_1720089 S.pombe
           chromosome II cosmid c3F6.
          Length = 473

 Score = 68.6 bits (166), Expect = 4e-11
 Identities = 39/103 (37%), Positives = 58/103 (56%)
 Frame = +2

Query: 122 AKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALAD 301
           AK  + LK++ N+F K G+ ++A  LYT+AI+ D +N  LYSNR+ A L       A+ D
Sbjct: 2   AKEALELKNEANKFLKEGHIVQAIDLYTKAIELDSTNAILYSNRSLAHLKSEDYGLAIND 61

Query: 302 AEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           A   I   P++ K YFR+     A+ +  EA+  F+ AL   P
Sbjct: 62  ASKAIECDPEYAKAYFRRATAHIAIFQPKEAVGDFRKALALAP 104



>gb:CR382131_1664511 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 488

 Score = 68.2 bits (165), Expect = 5e-11
 Identities = 36/88 (40%), Positives = 52/88 (59%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K+QGN  +KAG Y +A  LYTQA+ ++P+N T  +NR+ A+  L K   AL DA+    L
Sbjct: 8   KEQGNVAYKAGQYSEAVHLYTQAVDEEPTNATYLNNRSMAYFQLGKYEDALMDAQRANLL 67

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAF 406
            P  EK   R G I  ++   ++AL+ F
Sbjct: 68  APHAEKTLLRIGKIQTSLGHCEDALNTF 95



 Score = 64.3 bits (155), Expect = 7e-10
 Identities = 32/100 (32%), Positives = 58/100 (58%), Gaps = 4/100 (4%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPT----LYSNRAAAFLHLVKLNKALADAEM 310
           +++GN  FK+G Y +A  LYT+ +  DP+N      +YSNRA A + L     AL D ++
Sbjct: 235 REEGNSAFKSGQYARAKELYTETLALDPTNKLVNAKIYSNRATANVKLGDFEDALKDCDL 294

Query: 311 TISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            +   P + K    K   L ++E++++A++ F+ A++ +P
Sbjct: 295 ALEADPSFVKARKTKARALGSLEKWEDAVNEFKQAMEADP 334



>gb:CR382126_1659415 Kluyveromyces lactis strain NRRL Y-1140
           chromosome F of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 604

 Score = 68.2 bits (165), Expect = 5e-11
 Identities = 34/91 (37%), Positives = 54/91 (59%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           K  ++LKD+GNEFFKA ++ KA   YT AI     +P  YSNR+AA++ +    K + D 
Sbjct: 102 KYALALKDKGNEFFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDT 160

Query: 305 EMTISLKPDWEKGYFRKGCILEAMERYDEAL 397
              + LKPD+ K + R+    E + ++ +A+
Sbjct: 161 TAALKLKPDYSKCWLRRASAYENLGQFSDAM 191



>gb:AK079168_1172617 Mus musculus 12 days embryo embryonic body
           between diaphragm region and neck cDNA, RIKEN
           full-length enriched library, clone:9430097N04
           product:SMALL GLUTAMINE-RICH TETRATRICOPEPTIDE
           REPEAT-CONTAINING PROTEIN homolog [Rattus norvegicus],
           full insert sequence.
          Length = 315

 Score = 68.2 bits (165), Expect = 5e-11
 Identities = 37/111 (33%), Positives = 60/111 (54%)
 Frame = +2

Query: 98  KTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLV 277
           +T   + D+     LK +GNE  K  N+  A  LY +AI+ +P+N   + NRAAA+  L 
Sbjct: 81  RTPPSEEDSAEAERLKTEGNEQMKLENFEAAVHLYGKAIELNPANAVYFCNRAAAYSKLG 140

Query: 278 KLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
               A+ D E  I + P + K Y R G  L ++ ++ EA+  ++ AL+ +P
Sbjct: 141 NYVGAVQDCERAIGIDPGYSKAYGRMGLALSSLNKHAEAVAYYKKALELDP 191



>gb:AK039966_1165531 Mus musculus 0 day neonate thymus cDNA, RIKEN
           full-length enriched library, clone:A430036K17
           product:SMALL GLUTAMINE-RICH TETRATRICOPEPTIDE
           REPEAT-CONTAINING PROTEIN homolog [Rattus norvegicus],
           full insert sequence.>gb:AK051005_1169542 Mus musculus 9
           days embryo whole body cDNA, RIKEN full-length enriched
           library, clone:D030054B09 product:SMALL GLUTAMINE-RICH
           TETRATRICOPEPTIDE REPEAT-CONTAINING PROTEIN homolog
           [Rattus norvegicus], full insert
           sequence.>gb:BC086028_2564621 Xenopus laevis
           hypothetical LOC495574, mRNA (cDNA clone MGC:98120
           IMAGE:7200365), complete cds.
          Length = 314

 Score = 68.2 bits (165), Expect = 5e-11
 Identities = 37/111 (33%), Positives = 60/111 (54%)
 Frame = +2

Query: 98  KTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLV 277
           +T   + D+     LK +GNE  K  N+  A  LY +AI+ +P+N   + NRAAA+  L 
Sbjct: 80  RTPPSEEDSAEAERLKTEGNEQMKLENFEAAVHLYGKAIELNPANAVYFCNRAAAYSKLG 139

Query: 278 KLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
               A+ D E  I + P + K Y R G  L ++ ++ EA+  ++ AL+ +P
Sbjct: 140 NYVGAVQDCERAIGIDPGYSKAYGRMGLALSSLNKHAEAVAYYKKALELDP 190



>sp|O70593|SGTA_RAT Small glutamine-rich tetratricopeptide
           repeat-containing protein A.>gb:AF368278_2064283 Rattus
           norvegicus small glutamine rich protein with
           tetratricopeptide repeats 1 (Sgt1) mRNA, complete
           cds.>gb:BC087642_2110115 Rattus norvegicus small
           glutamine-rich tetratricopeptide repeat
           (TPR)-containing, alpha, mRNA (cDNA clone MGC:105278
           IMAGE:7308544), complete cds.>gb:RAN222724_2131256
           Rattus norvegicus mRNA for small glutamine-rich
           tetratricopeptide repeat (TPR) containing protein (SGT).
          Length = 314

 Score = 68.2 bits (165), Expect = 5e-11
 Identities = 37/111 (33%), Positives = 60/111 (54%)
 Frame = +2

Query: 98  KTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLV 277
           +T   + D+     LK +GNE  K  N+  A  LY +AI+ +P+N   + NRAAA+  L 
Sbjct: 80  RTPPSEEDSAEAERLKTEGNEQMKLENFEAAVHLYGKAIELNPANAVYFCNRAAAYSKLG 139

Query: 278 KLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
               A+ D E  I + P + K Y R G  L ++ ++ EA+  ++ AL+ +P
Sbjct: 140 NYVGAVQDCERAIGIDPGYSKAYGRMGLALSSLNKHAEAVAYYKKALELDP 190



>sp|Q8BJU0|SGTA_MOUSE Small glutamine-rich tetratricopeptide
           repeat-containing protein A.>gb:BC003836_2089389 Mus
           musculus small glutamine-rich tetratricopeptide repeat
           (TPR)-containing, alpha, mRNA (cDNA clone MGC:6336
           IMAGE:3486148), complete cds.
          Length = 315

 Score = 68.2 bits (165), Expect = 5e-11
 Identities = 37/111 (33%), Positives = 60/111 (54%)
 Frame = +2

Query: 98  KTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLV 277
           +T   + D+     LK +GNE  K  N+  A  LY +AI+ +P+N   + NRAAA+  L 
Sbjct: 81  RTPPSEEDSAEAERLKTEGNEQMKLENFEAAVHLYGKAIELNPANAVYFCNRAAAYSKLG 140

Query: 278 KLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
               A+ D E  I + P + K Y R G  L ++ ++ EA+  ++ AL+ +P
Sbjct: 141 NYVGAVQDCERAIGIDPGYSKAYGRMGLALSSLNKHAEAVAYYKKALELDP 191



>gb:AP005828_1858612 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0702F05.
          Length = 430

 Score = 67.8 bits (164), Expect = 6e-11
 Identities = 34/96 (35%), Positives = 55/96 (57%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           +++G E      Y +AA  +T+AIK++P NP  +S+RA   + L  L + L DA+  I +
Sbjct: 165 REKGKELLSKKKYKEAAIQFTKAIKRNPLNPRNFSDRAKCRIELNALAEGLEDADKCIEV 224

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            P + KGYF KG +   M  Y++A+  +   LK+ P
Sbjct: 225 DPTFWKGYFCKGEVQFLMHNYEDAMTTYLDGLKYGP 260



>gb:AE016818_1747925 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome V, complete sequence.
          Length = 580

 Score = 67.8 bits (164), Expect = 6e-11
 Identities = 36/94 (38%), Positives = 57/94 (60%), Gaps = 1/94 (1%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIK-KDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           K +GN  F A ++ KA  L+ +AI+  +  N  LYSNR+A +  + K  +ALADA+  + 
Sbjct: 8   KKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQECVR 67

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
           +KPDW KG+ R G     +   DEA ++++ AL+
Sbjct: 68  IKPDWSKGHNRLGAAHYGLGDLDEAEESYKKALE 101



 Score = 60.1 bits (144), Expect = 1e-08
 Identities = 31/99 (31%), Positives = 50/99 (50%)
 Frame = +2

Query: 119 DAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALA 298
           D ++    + QG E+F   ++  A   YT+ IK+ P +   YSNRAAA   L+    A+ 
Sbjct: 384 DPEKAEEARLQGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIK 443

Query: 299 DAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIA 415
           D +M I   P++ + Y RK     A++ Y  A++    A
Sbjct: 444 DCDMAIQKDPNFVRAYIRKATAQIAVQEYAAAIETLDTA 482



>gb:AY496564_1609114 Physcomitrella patens chloroplast Toc64-2 mRNA,
           complete cds; nuclear gene for chloroplast product.
          Length = 585

 Score = 67.8 bits (164), Expect = 6e-11
 Identities = 37/91 (40%), Positives = 50/91 (54%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K++GN  FK  +Y KA + YT AI+ D +N T Y+NRA A+L L    +A AD    + L
Sbjct: 473 KEKGNASFKEKDYKKAISHYTDAIRMDENNATFYNNRAMAYLQLCSFQEAEADCTKALGL 532

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIA 415
                K Y R+G   E +  Y EA D F+ A
Sbjct: 533 DKKSVKAYLRRGTAREFLGYYKEANDDFRQA 563



>pir|T16689|T16689 hypothetical protein R05F9.10 - Caenorhabditis
           elegans>gb:U41533_1403999 Caenorhabditis elegans cosmid
           R05F9, complete sequence.
          Length = 337

 Score = 67.8 bits (164), Expect = 6e-11
 Identities = 36/109 (33%), Positives = 57/109 (52%)
 Frame = +2

Query: 104 TMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKL 283
           T  DSD  +   LK++GN+  KA  +  A   Y  AIK +  +P  + NRAAA+  L + 
Sbjct: 96  TPSDSDISQANKLKEEGNDLMKASQFEAAVQKYNAAIKLN-RDPVYFCNRAAAYCRLEQY 154

Query: 284 NKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           + A+ D    ++L P + K + R G       RY+ A +A++ AL+  P
Sbjct: 155 DLAIQDCRTALALDPSYSKAWGRMGLAYSCQNRYEHAAEAYKKALELEP 203



>gb:BC085453_2564401 Danio rerio zgc:101838, mRNA (cDNA clone
           MGC:101838 IMAGE:7252488), complete cds.
          Length = 319

 Score = 67.4 bits (163), Expect = 8e-11
 Identities = 36/111 (32%), Positives = 63/111 (56%), Gaps = 5/111 (4%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDP-----SNPTLYSNRAAAFLHLV 277
           +S  K  + LK++GN  FK+G +++A   Y+ A+K  P         L+SNRAA+ LH  
Sbjct: 136 ESRRKESLELKEKGNAQFKSGEHVEAEESYSAALKLCPVCFTKDRSILFSNRAASRLHQD 195

Query: 278 KLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           K + A++D    I L P++ +   R+  + E  ++ DEAL+ ++  L+ +P
Sbjct: 196 KKDGAISDCSKAIELNPNYVRAILRRAELYEKTDKLDEALEDYKTVLEKDP 246



>gb:AY464141_2533929 Gallus gallus EKN1 mRNA, complete cds.
          Length = 423

 Score = 67.0 bits (162), Expect = 1e-10
 Identities = 41/105 (39%), Positives = 56/105 (53%), Gaps = 8/105 (7%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LKD+GN+ F  G+YL A   Y  A++ +   P LY NRAA  L L  L+KA+ D+   + 
Sbjct: 296 LKDKGNKMFATGDYLAAVNAYNLAVRLNNKLPLLYLNRAACHLKLRNLHKAIEDSSKALE 355

Query: 320 L----KPDWE----KGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L     PD E    K Y R+G     +E Y E L  ++ ALK +P
Sbjct: 356 LLTPPVPDNENARVKAYVRRGTAFCQLELYAEGLQDYEAALKIDP 400



>gb:AY323828_2083490 Mus musculus cytoplasmic CAR retention protein
           mRNA, complete cds.
          Length = 494

 Score = 67.0 bits (162), Expect = 1e-10
 Identities = 38/104 (36%), Positives = 60/104 (57%), Gaps = 1/104 (0%)
 Frame = +2

Query: 113 DSDAKREV-SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNK 289
           D DAKRE  S K+QGN ++   +Y +A   YT+AI   P+N + Y NRAA  + L +  +
Sbjct: 21  DEDAKREAESFKEQGNAYYAKKDYNEAYNYYTKAIDMCPNNASYYGNRAATLMMLGRFRE 80

Query: 290 ALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
           AL DA+ ++ L   + +G+ R+G    ++     A  +FQ AL+
Sbjct: 81  ALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALE 124



 Score = 55.5 bits (132), Expect = 3e-07
 Identities = 34/108 (31%), Positives = 53/108 (49%), Gaps = 4/108 (3%)
 Frame = +2

Query: 98  KTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDP----SNPTLYSNRAAAF 265
           K  +   +AK   + K+ GN+ FK GNY  A  LYT+A+  DP    +N  LY NR    
Sbjct: 245 KACVACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVN 304

Query: 266 LHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQ 409
             L +L  A+ D    + L   + K Y R+       E+++EA+  ++
Sbjct: 305 SKLRQLEDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQFEEAVRDYE 352



>gb:AB101661_2048339 Rattus norvegicus tpr mRNA for PP5-TPR variant,
           partial cds.
          Length = 126

 Score = 67.0 bits (162), Expect = 1e-10
 Identities = 36/95 (37%), Positives = 52/95 (54%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           KR   LK Q N++FKA +Y  A   Y+QAI+ +PSN   Y NR+ A+L       AL DA
Sbjct: 18  KRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYALGDA 77

Query: 305 EMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQ 409
              I L   + KGY+R+     A+ ++  AL  ++
Sbjct: 78  TRAIELDKKYIKGYYRRAASNMALGKFRAALRDYE 112



>gb:AP005828_1858614 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC clone:P0702F05.
          Length = 441

 Score = 67.0 bits (162), Expect = 1e-10
 Identities = 35/96 (36%), Positives = 53/96 (55%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           +D+G E  +   Y +A   +++AIK++P  P  +S+RA   + L  L KAL DA   I L
Sbjct: 173 RDRGLELLRKKKYKEAEMQFSEAIKRNPRYPKNFSDRARCLVELNSLPKALEDANRCIEL 232

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
                 GY RKG +  AM +Y++A+      LKH+P
Sbjct: 233 DDTLGMGYLRKGLVQIAMAKYEDAIATLVDGLKHDP 268



 Score = 33.9 bits (76), Expect = 1.0
 Identities = 22/72 (30%), Positives = 33/72 (45%), Gaps = 1/72 (1%)
 Frame = +2

Query: 95  GKTTMGDSDAKREVSL-KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLH 271
           G   MG  + K      K+ G+E +    Y +AAA Y  A   DP + +    RAAA   
Sbjct: 12  GGRAMGAKERKEAAQREKEAGDEAYGEELYKRAAAHYAAAADLDPGDTSCLIKRAAANFS 71

Query: 272 LVKLNKALADAE 307
           + K  + +AD +
Sbjct: 72  MNKCKECVADCD 83



>gb:AP005603_1854701 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:B1047A05.
          Length = 384

 Score = 67.0 bits (162), Expect = 1e-10
 Identities = 35/102 (34%), Positives = 56/102 (54%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           K+   LK  GN+     +Y+ A+A YT+A+  DP++ TL+SNR+  +L +    KA  DA
Sbjct: 257 KKIEELKTSGNKAVDREDYISASAFYTKAMDLDPNDATLFSNRSLCWLCMGDGKKAFLDA 316

Query: 305 EMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
                ++PDW K  +R G  L  ++ ++ A DA     K +P
Sbjct: 317 LECREMRPDWPKACYRLGAALMTLKDFESACDALFDGFKLDP 358



>gb:CR382129_1661697 Yarrowia lipolytica chromosome C of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 344

 Score = 67.0 bits (162), Expect = 1e-10
 Identities = 41/125 (32%), Positives = 64/125 (51%)
 Frame = +2

Query: 47  KNSP*TLTQISANFLKGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDP 226
           K+SP  L   +A        + +    +   LK +GN+     N+ ++  LYTQAI  D 
Sbjct: 77  KSSP-ALEAAAAKMAAATAVLTEEQKTQADKLKLEGNKALSQRNFEESIDLYTQAIDIDA 135

Query: 227 SNPTLYSNRAAAFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAF 406
           +N   YSNRAAA+  L   + A+ADA+  I + P++ K Y R G    A      AL+A+
Sbjct: 136 NNAVYYSNRAAAYSQLQLHDNAIADADAAIRVDPNYSKAYSRLGLAKYASGDAQGALEAY 195

Query: 407 QIALK 421
           ++ +K
Sbjct: 196 EMGMK 200



>gb:AK077715_1172026 Mus musculus 8 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:5730547M21
           product:SIMILAR TO TETRATRICOPEPTIDE REPEAT DOMAIN 1,
           full insert sequence.>gb:BC010236_2090910 Mus musculus
           tetratricopeptide repeat domain 1, mRNA (cDNA clone
           MGC:7871 IMAGE:3581904), complete cds.
          Length = 292

 Score = 67.0 bits (162), Expect = 1e-10
 Identities = 38/113 (33%), Positives = 64/113 (56%), Gaps = 7/113 (6%)
 Frame = +2

Query: 113 DSDAKREVS--LKDQGNEFFKAGNYLKAAALYTQAIKKDPS-----NPTLYSNRAAAFLH 271
           +   +RE S  LK++GNE FK G+Y++A + Y+QA++  P+        L+SNRAAA + 
Sbjct: 108 EKQKRREESAKLKEEGNERFKRGDYMEAESSYSQALQMCPACFQKDRSVLFSNRAAARMK 167

Query: 272 LVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
             K   A+ D    I L P + +   R+  + E  ++ DEAL+ ++  L+ +P
Sbjct: 168 QDKKETAITDCSKAIQLNPTYIRAILRRAELYEKTDKLDEALEDYKSVLEKDP 220



>gb:AK076032_1171182 Mus musculus 10 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2610300C22
           product:DnaJ (Hsp40) homolog, subfamily C, member 7,
           full insert sequence.
          Length = 494

 Score = 67.0 bits (162), Expect = 1e-10
 Identities = 38/104 (36%), Positives = 60/104 (57%), Gaps = 1/104 (0%)
 Frame = +2

Query: 113 DSDAKREV-SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNK 289
           D DAKRE  S K+QGN ++   +Y +A   YT+AI   P+N + Y NRAA  + L +  +
Sbjct: 21  DEDAKREAESFKEQGNAYYAKKDYNEAYNYYTKAIDMCPNNASYYGNRAATLMMLGRFRE 80

Query: 290 ALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
           AL DA+ ++ L   + +G+ R+G    ++     A  +FQ AL+
Sbjct: 81  ALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALE 124



 Score = 55.5 bits (132), Expect = 3e-07
 Identities = 34/108 (31%), Positives = 53/108 (49%), Gaps = 4/108 (3%)
 Frame = +2

Query: 98  KTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDP----SNPTLYSNRAAAF 265
           K  +   +AK   + K+ GN+ FK GNY  A  LYT+A+  DP    +N  LY NR    
Sbjct: 245 KACVACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVN 304

Query: 266 LHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQ 409
             L +L  A+ D    + L   + K Y R+       E+++EA+  ++
Sbjct: 305 SKLRQLEDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQFEEAVRDYE 352



>sp|Q9QYI3|DJC7_MOUSE DnaJ homolog subfamily C member 7
           (Tetratricopeptide repeat protein 2) (TPR repeat protein
           2) (MDj11).>gb:BC023681_2094207 Mus musculus DnaJ
           (Hsp40) homolog, subfamily C, member 7, mRNA (cDNA clone
           MGC:35912 IMAGE:5343384), complete
           cds.>gb:BC055729_2102122 Mus musculus DnaJ (Hsp40)
           homolog, subfamily C, member 7, mRNA (cDNA clone
           MGC:66940 IMAGE:6414499), complete cds.
          Length = 494

 Score = 67.0 bits (162), Expect = 1e-10
 Identities = 38/104 (36%), Positives = 60/104 (57%), Gaps = 1/104 (0%)
 Frame = +2

Query: 113 DSDAKREV-SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNK 289
           D DAKRE  S K+QGN ++   +Y +A   YT+AI   P+N + Y NRAA  + L +  +
Sbjct: 21  DEDAKREAESFKEQGNAYYAKKDYNEAYNYYTKAIDMCPNNASYYGNRAATLMMLGRFRE 80

Query: 290 ALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
           AL DA+ ++ L   + +G+ R+G    ++     A  +FQ AL+
Sbjct: 81  ALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALE 124



 Score = 55.5 bits (132), Expect = 3e-07
 Identities = 34/108 (31%), Positives = 53/108 (49%), Gaps = 4/108 (3%)
 Frame = +2

Query: 98  KTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDP----SNPTLYSNRAAAF 265
           K  +   +AK   + K+ GN+ FK GNY  A  LYT+A+  DP    +N  LY NR    
Sbjct: 245 KACVACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVN 304

Query: 266 LHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQ 409
             L +L  A+ D    + L   + K Y R+       E+++EA+  ++
Sbjct: 305 SKLRQLEDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQFEEAVRDYE 352



>gb:AP002897_1823660 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0686E09.
          Length = 692

 Score = 66.6 bits (161), Expect = 1e-10
 Identities = 31/105 (29%), Positives = 57/105 (54%)
 Frame = +2

Query: 116 SDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKAL 295
           ++ K     + QGNE +KA  +  A+  Y++ +K +PSNP LY NRAA +  L +  KA+
Sbjct: 450 NNVKLVAKARAQGNELYKAAKFSDASIAYSEGLKYEPSNPVLYCNRAACWGKLERWEKAV 509

Query: 296 ADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            D    + ++P++ K   R+      +ER+ + +  +++  K  P
Sbjct: 510 DDCNEALRIQPNYTKALLRRASSYAKLERWADCVRDYEVLHKELP 554



 Score = 41.6 bits (96), Expect = 0.005
 Identities = 22/59 (37%), Positives = 31/59 (52%)
 Frame = +2

Query: 152 GNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISLKP 328
           GNE++K G + +A   Y +A+   P +     NRAAA   L +L  AL D E  + L P
Sbjct: 222 GNEWYKKGKHAEALRHYDRAVALCPESAACRGNRAAALAGLGRLADALRDCEEAVRLDP 280



>gb:AC097280_1736614 Oryza sativa chromosome 3 BAC OSJNBb0111B07
           genomic sequence, complete sequence.
          Length = 431

 Score = 66.6 bits (161), Expect = 1e-10
 Identities = 35/102 (34%), Positives = 55/102 (53%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           ++    K  G E  +  +YL AA  Y++A+  DP + TL SNR+  +L+L +  KAL DA
Sbjct: 305 RKIAEFKSLGLEAVEKKDYLSAAGFYSEAMDLDPDDATLLSNRSLCWLYLGEGGKALVDA 364

Query: 305 EMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
                ++PDW K  +R+G  L  ++ Y  A +A     K +P
Sbjct: 365 HKCRKMRPDWPKACYRQGAALMLLKDYVSACEALFDGFKLDP 406



>gb:AB028861_2044520 Mus musculus mRNA for mDj11, complete cds.
          Length = 494

 Score = 66.2 bits (160), Expect = 2e-10
 Identities = 38/104 (36%), Positives = 59/104 (56%), Gaps = 1/104 (0%)
 Frame = +2

Query: 113 DSDAKREV-SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNK 289
           D DAKRE  S K+QGN ++   +Y +A   YT+AI   P+N + Y NRAA  + L +  +
Sbjct: 21  DEDAKREAESFKEQGNAYYAKKDYNEAYNYYTKAIDMCPNNASYYGNRAATLMMLGRFRE 80

Query: 290 ALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
           AL DA+ ++ L   + +G+ R+G    ++     A   FQ AL+
Sbjct: 81  ALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRIFQRALE 124



 Score = 55.5 bits (132), Expect = 3e-07
 Identities = 34/108 (31%), Positives = 53/108 (49%), Gaps = 4/108 (3%)
 Frame = +2

Query: 98  KTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDP----SNPTLYSNRAAAF 265
           K  +   +AK   + K+ GN+ FK GNY  A  LYT+A+  DP    +N  LY NR    
Sbjct: 245 KACVACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVN 304

Query: 266 LHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQ 409
             L +L  A+ D    + L   + K Y R+       E+++EA+  ++
Sbjct: 305 SKLRQLEDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQFEEAVRDYE 352



>gb:BC045536_1983567 Homo sapiens, clone IMAGE:4825300, mRNA,
           partial cds.
          Length = 487

 Score = 66.2 bits (160), Expect = 2e-10
 Identities = 34/90 (37%), Positives = 53/90 (58%)
 Frame = +2

Query: 152 GNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISLKPD 331
           G  F + G Y +A  L+TQA+K +P +  L+ NR+     L +   ALADA++ ++L+P 
Sbjct: 280 GTSFAQNGFYHEAVVLFTQALKLNPQDHRLFGNRSFCHERLGQPAWALADAQVALTLRPG 339

Query: 332 WEKGYFRKGCILEAMERYDEALDAFQIALK 421
           W +G FR G  L  ++R+ EA   FQ  L+
Sbjct: 340 WPRGLFRLGKALMGLQRFREAAAVFQETLR 369



>gb:BC000942_1967148 Homo sapiens tetratricopeptide repeat domain 1,
           mRNA (cDNA clone MGC:5385 IMAGE:3446109), complete cds.
          Length = 292

 Score = 66.2 bits (160), Expect = 2e-10
 Identities = 41/120 (34%), Positives = 67/120 (55%), Gaps = 9/120 (7%)
 Frame = +2

Query: 98  KTTMGDSDA--KREVS--LKDQGNEFFKAGNYLKAAALYTQAIKKDPS-----NPTLYSN 250
           K  M D +   +RE S  LK++GNE FK G+Y++A + Y++A++  PS        L+SN
Sbjct: 101 KKNMSDEEKQKRREESTRLKEEGNEQFKKGDYIEAESSYSRALEMCPSCFQKERSILFSN 160

Query: 251 RAAAFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           RAAA +   K   A+ D    I L P + +   R+  + E  ++ DEAL+ ++  L+ +P
Sbjct: 161 RAAARMKQDKKEMAINDCSKAIQLNPSYIRAILRRAELYEKTDKLDEALEDYKSILEKDP 220



>gb:AY847013_1965059 Cercopithecus aethiops kidney fibroblast small
           glutamine rich tricopeptide-containing protein alpha
           mRNA, complete cds.
          Length = 313

 Score = 66.2 bits (160), Expect = 2e-10
 Identities = 36/111 (32%), Positives = 59/111 (53%)
 Frame = +2

Query: 98  KTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLV 277
           +T   + D+     LK +GNE  K  N+  A   Y +AI+ +P+N   + NRAAA+  L 
Sbjct: 80  RTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLG 139

Query: 278 KLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
               A+ D E  I + P + K Y R G  L ++ ++ EA+  ++ AL+ +P
Sbjct: 140 NYAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVAYYKKALELDP 190



>gb:AC135918_1742825 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBb0115F21, complete sequence.
          Length = 483

 Score = 66.2 bits (160), Expect = 2e-10
 Identities = 36/102 (35%), Positives = 56/102 (54%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           ++   LK + N+ FKA  +  A  LY+QAI+ + SN   ++NRA A   L +   A+ DA
Sbjct: 10  QKSEELKLKANDAFKANKFSLAIELYSQAIELNSSNAVYWANRAFAHTKLEEYGSAVQDA 69

Query: 305 EMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
              I +   + KGY+R+G    AM ++ EAL  FQ   + +P
Sbjct: 70  SKAIEIDARYSKGYYRRGAAYLAMGKFKEALKDFQQVKRISP 111



>gb:AY496563_1609113 Physcomitrella patens chloroplast Toc64-1 mRNA,
           complete cds; nuclear gene for chloroplast product.
          Length = 592

 Score = 66.2 bits (160), Expect = 2e-10
 Identities = 37/108 (34%), Positives = 57/108 (52%)
 Frame = +2

Query: 107 MGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLN 286
           + D ++      K++GN  FK  +Y KA   YT AI+ + +N T Y+NRA A+L L   +
Sbjct: 467 VSDGNSAAAELAKEKGNAAFKEKDYKKAVGFYTDAIRLNGNNATYYNNRAMAYLQLCSFS 526

Query: 287 KALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           +A +D    ++L     K Y R+G   E +  Y EA + F+ AL   P
Sbjct: 527 EAESDCTKALNLDKRSVKAYLRRGTAREFLGYYKEADEDFRQALIFEP 574



>gb:AY144442_1583538 Sorghum bicolor BAC 95A23/98N8.1 Rph region,
           partial sequence.
          Length = 428

 Score = 66.2 bits (160), Expect = 2e-10
 Identities = 38/98 (38%), Positives = 58/98 (59%), Gaps = 1/98 (1%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKK-DPSNPTLYSNRAAAFLHLVKLNKALADAEMTI 316
           LK +G++ +   +Y  A  LY+ AI K D  + TL SNR+  F+ + + +KAL DAE   
Sbjct: 315 LKLEGSKAYNEKDYSTAVKLYSVAIMKADSGDATLLSNRSLCFIRMGEGDKALVDAEACR 374

Query: 317 SLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           +L+P W K  FR+G     ++ Y++A DAF   LK +P
Sbjct: 375 ALQPYWPKACFRQGAAHMLLKDYEKACDAFLDGLKLDP 412



>gb:ATH319538_1552500 Arabidopsis thaliana partial mRNA for
           stil-like (stil gene).
          Length = 165

 Score = 66.2 bits (160), Expect = 2e-10
 Identities = 30/75 (40%), Positives = 48/75 (64%)
 Frame = +2

Query: 206 QAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERY 385
           +AIK++P++   YSNRAA++  L  + + L DAE  I L P + KGY RK  +   ++ Y
Sbjct: 1   EAIKRNPNDHKAYSNRAASYTKLGAMPEGLKDAEKCIELDPTFSKGYSRKAAVQFFLKEY 60

Query: 386 DEALDAFQIALKHNP 430
           D A++ +Q  L+H+P
Sbjct: 61  DNAMETYQAGLEHDP 75



>pir|S61991|S61991 hypothetical protein YOR007c - yeast
           (Saccharomyces cerevisiae)>gb:SCU43491_1710337
           Saccharomyces cerevisiae cosmid clone pEOA156 from
           chromosome XV.>gb:SCYOR007C_1714229 S.cerevisiae
           chromosome XV reading frame ORF YOR007c.
          Length = 346

 Score = 66.2 bits (160), Expect = 2e-10
 Identities = 41/102 (40%), Positives = 60/102 (58%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKA 292
           ++ AK E  LK QGN+     +Y  A   YT+AIK  P+N   Y+NRAAA   L + ++A
Sbjct: 97  ETKAKAE-DLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQA 155

Query: 293 LADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIAL 418
           + DAE  IS+ P + +GY R G    A  + +EAL+A++  L
Sbjct: 156 VKDAESAISIDPSYFRGYSRLGFAKYAQGKPEEALEAYKKVL 197



>pir|T08782|T08782 hypothetical protein DKFZp586N1020.1 - human
           (fragment)
          Length = 349

 Score = 66.2 bits (160), Expect = 2e-10
 Identities = 36/111 (32%), Positives = 59/111 (53%)
 Frame = +2

Query: 98  KTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLV 277
           +T   + D+     LK +GNE  K  N+  A   Y +AI+ +P+N   + NRAAA+  L 
Sbjct: 116 RTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLG 175

Query: 278 KLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
               A+ D E  I + P + K Y R G  L ++ ++ EA+  ++ AL+ +P
Sbjct: 176 NYAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVAYYKKALELDP 226



>sp|P15705|STI1_YEAST Heat shock protein STI1.>pir|A32567|A32567
           stress-induced protein STI1 - yeast (Saccharomyces
           cerevisiae)>gb:SCXV58KB_1711019 S.cerevisiae genomic DNA
           (chromosome XV; strain FY1679).>gb:SCYOR027W_1714251
           S.cerevisiae chromosome XV reading frame ORF
           YOR027w.>gb:YSCSTI1A_1730722 Yeast (S.cerevisiae) heat
           shock protein (STI1) gene, complete cds.
          Length = 589

 Score = 66.2 bits (160), Expect = 2e-10
 Identities = 38/94 (40%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIK-KDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           K QGN  F A +Y KA  L+T+AI+  +  N  LYSNR+A +  L K + AL DA   + 
Sbjct: 9   KQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVK 68

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
           + P W KGY R G     +   DEA   ++ AL+
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEAESNYKKALE 102



 Score = 58.9 bits (141), Expect = 3e-08
 Identities = 30/89 (33%), Positives = 46/89 (51%)
 Frame = +2

Query: 149 QGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISLKP 328
           +G E+F   ++  A   YT+ IK+ P +   YSNRAAA   L+   +A+AD    I   P
Sbjct: 402 EGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDP 461

Query: 329 DWEKGYFRKGCILEAMERYDEALDAFQIA 415
           ++ + Y RK     A++ Y  AL+    A
Sbjct: 462 NFVRAYIRKATAQIAVKEYASALETLDAA 490



>sp|O43765|SGTA_HUMAN Small glutamine-rich tetratricopeptide
           repeat-containing protein A (Vpu-binding protein)
           (UBP).>gb:HSM800226_1185779 Homo sapiens mRNA; cDNA
           DKFZp586N1020 (from clone
           DKFZp586N1020).>gb:AC006538_1875173 Homo sapiens
           chromosome 19, BAC 41195 (CIT-B-31c16), complete
           sequence.>gb:AF368279_1899280 Homo sapiens small
           glutamine rich protein with tetratricopeptide repeats 1
           (SGT1) mRNA, complete cds.>gb:AF408399_1901249 Homo
           sapiens TPR-containing co-chaperone mRNA, complete
           cds.>gb:BC000390_1966678 Homo sapiens small
           glutamine-rich tetratricopeptide repeat
           (TPR)-containing, alpha, mRNA (cDNA clone MGC:8439
           IMAGE:2821268), complete cds.>gb:BC002989_1968587 Homo
           sapiens small glutamine-rich tetratricopeptide repeat
           (TPR)-containing, alpha, mRNA (cDNA clone MGC:3636
           IMAGE:2821268), complete cds.>gb:BC005165_1969653 Homo
           sapiens small glutamine-rich tetratricopeptide repeat
           (TPR)-containing, alpha, mRNA (cDNA clone MGC:4672
           IMAGE:3532317), complete cds.>gb:BC008885_1971664 Homo
           sapiens small glutamine-rich tetratricopeptide repeat
           (TPR)-containing, alpha, mRNA (cDNA clone MGC:15252
           IMAGE:4302652), complete cds.>gb:CR533517_1993722 Homo
           sapiens full open reading frame cDNA clone
           RZPDo834B1119D for gene SGTA, small glutamine-rich
           tetratricopeptide repeat (TPR)-containing, alpha;
           complete cds, incl. stopcodon.>gb:CR542282_1994506 Homo
           sapiens full open reading frame cDNA clone
           RZPDo834H1026D for gene SGTA, small glutamine-rich
           tetratricopeptide repeat (TPR)-containing, alpha;
           complete cds, without stopcodon.>gb:HSA133129_2000355
           Homo sapiens mRNA for small glutamine-rich
           tetratricopeptide repeat containing
           protein.>gb:HSAJ3828_2010353 Homo sapiens small
           glutamine-rich tetratricopeptide repeat (TPR) containing
           protein.
          Length = 313

 Score = 66.2 bits (160), Expect = 2e-10
 Identities = 36/111 (32%), Positives = 59/111 (53%)
 Frame = +2

Query: 98  KTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLV 277
           +T   + D+     LK +GNE  K  N+  A   Y +AI+ +P+N   + NRAAA+  L 
Sbjct: 80  RTPPSEEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLG 139

Query: 278 KLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
               A+ D E  I + P + K Y R G  L ++ ++ EA+  ++ AL+ +P
Sbjct: 140 NYAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVAYYKKALELDP 190



>gb:BC080162_2561592 Xenopus tropicalis ppp5c-prov protein, mRNA
           (cDNA clone MGC:89961 IMAGE:7025761), complete cds.
          Length = 493

 Score = 65.9 bits (159), Expect = 2e-10
 Identities = 37/105 (35%), Positives = 52/105 (49%)
 Frame = +2

Query: 116 SDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKAL 295
           S  K    LK+Q NE+F+  +Y +A   YTQAI   P     Y NR+ A+L       AL
Sbjct: 17  SREKTAEELKEQANEYFRVKDYDRAVQYYTQAIGLSPDTAIYYGNRSLAYLRTECYGYAL 76

Query: 296 ADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           ADA   I L   + KGY+R+     A+ +   AL  ++  +K  P
Sbjct: 77  ADASRAIQLDAKYIKGYYRRAASNMALGKLKAALKDYETVVKVRP 121



>gb:BC082093_2108320 Rattus norvegicus tetratricopeptide repeat
           domain 1, mRNA (cDNA clone MGC:95276 IMAGE:7134129),
           complete cds.
          Length = 292

 Score = 65.9 bits (159), Expect = 2e-10
 Identities = 38/113 (33%), Positives = 64/113 (56%), Gaps = 7/113 (6%)
 Frame = +2

Query: 113 DSDAKREVS--LKDQGNEFFKAGNYLKAAALYTQAIKKDPS-----NPTLYSNRAAAFLH 271
           +   +RE S  LK++GNE FK G+Y++A + Y+QA++  P+        L+SNRAAA + 
Sbjct: 108 EKQKRREESAKLKEEGNEQFKRGDYVEAESSYSQALQMCPACFQKDRSVLFSNRAAARMK 167

Query: 272 LVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
             K   A+ D    I L P + +   R+  + E  ++ DEAL+ ++  L+ +P
Sbjct: 168 QDKKEMAITDCSKAIQLNPTYIRAILRRAELYEKTDKLDEALEDYKSILETDP 220



>gb:BT019637_2151463 Synthetic construct Homo sapiens
           tetratricopeptide repeat domain 1 mRNA, partial
           cds.>gb:BT019638_2151464 Synthetic construct Homo
           sapiens tetratricopeptide repeat domain 1 mRNA, partial
           cds.
          Length = 293

 Score = 65.5 bits (158), Expect = 3e-10
 Identities = 38/113 (33%), Positives = 64/113 (56%), Gaps = 7/113 (6%)
 Frame = +2

Query: 113 DSDAKREVS--LKDQGNEFFKAGNYLKAAALYTQAIKKDPS-----NPTLYSNRAAAFLH 271
           +   +RE S  LK++GNE FK G+Y++A + Y++A++  PS        L+SNRAAA + 
Sbjct: 108 EKQKRREESTRLKEEGNEQFKKGDYIEAESSYSRALEMCPSCFQKERSILFSNRAAARMK 167

Query: 272 LVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
             K   A+ D    I L P + +   R+  + E  ++ DEAL+ ++  L+ +P
Sbjct: 168 QDKKEMAINDCSKAIQLNPSYIRAILRRAELYEKTDKLDEALEDYKSILEKDP 220



>gb:AK011875_1156638 Mus musculus 10 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2610204E12
           product:DnaJ (Hsp40) homolog, subfamily C, member 7,
           full insert sequence.
          Length = 484

 Score = 65.5 bits (158), Expect = 3e-10
 Identities = 38/104 (36%), Positives = 59/104 (56%), Gaps = 1/104 (0%)
 Frame = +2

Query: 113 DSDAKREV-SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNK 289
           D DAKRE  S K+QGN ++   +Y +A   YT+AI   P+N + Y NRAA  + L +  +
Sbjct: 11  DEDAKREAESFKEQGNAYYAKKDYNEAYNYYTKAIDMCPNNASYYGNRAATLMMLGRFRE 70

Query: 290 ALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
           AL DA  ++ L   + +G+ R+G    ++     A  +FQ AL+
Sbjct: 71  ALGDAHESVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALE 114



 Score = 55.8 bits (133), Expect = 2e-07
 Identities = 34/108 (31%), Positives = 53/108 (49%), Gaps = 4/108 (3%)
 Frame = +2

Query: 98  KTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDP----SNPTLYSNRAAAF 265
           K  +   +AK   + K+ GN+ FK GNY  A  LYT+A+  DP    +N  LY NR    
Sbjct: 235 KACVACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGVDPNNIKTNAKLYCNRGTVN 294

Query: 266 LHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQ 409
             L +L  A+ D    + L   + K Y R+       E+++EA+  ++
Sbjct: 295 SKLRQLEDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQFEEAVRDYE 342



>sp|Q99614|TTC1_HUMAN Tetratricopeptide repeat protein 1 (TPR repeat
           protein 1).>gb:HSU46570_2024452 Human tetratricopeptide
           repeat protein (tpr1) mRNA, complete cds.
          Length = 292

 Score = 65.5 bits (158), Expect = 3e-10
 Identities = 38/113 (33%), Positives = 64/113 (56%), Gaps = 7/113 (6%)
 Frame = +2

Query: 113 DSDAKREVS--LKDQGNEFFKAGNYLKAAALYTQAIKKDPS-----NPTLYSNRAAAFLH 271
           +   +RE S  LK++GNE FK G+Y++A + Y++A++  PS        L+SNRAAA + 
Sbjct: 108 EKQKRREESTRLKEEGNEQFKKGDYIEAESSYSRALEMCPSCFQKERSILFSNRAAARMK 167

Query: 272 LVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
             K   A+ D    I L P + +   R+  + E  ++ DEAL+ ++  L+ +P
Sbjct: 168 QDKKEMAINDCSKAIQLNPSYIRAILRRAELYEKTDKLDEALEDYKSILEKDP 220



>gb:AB178470_2049693 Rattus norvegicus CCRP mRNA for cytoplasmic CAR
           retention protein, complete cds.
          Length = 494

 Score = 65.1 bits (157), Expect = 4e-10
 Identities = 37/104 (35%), Positives = 59/104 (56%), Gaps = 1/104 (0%)
 Frame = +2

Query: 113 DSDAKREV-SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNK 289
           D +AKRE  S K+QGN ++   +Y +A   YT+AI   P N + Y NRAA  + L +  +
Sbjct: 21  DEEAKREAESFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRFRE 80

Query: 290 ALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
           AL DA+ ++ L   + +G+ R+G    ++     A  +FQ AL+
Sbjct: 81  ALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALE 124



 Score = 58.2 bits (139), Expect = 5e-08
 Identities = 35/108 (32%), Positives = 53/108 (49%), Gaps = 4/108 (3%)
 Frame = +2

Query: 98  KTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDP----SNPTLYSNRAAAF 265
           K  +   +AK   + K+ GN+ FK GNY  A  LYT+A+  DP    +N  LY NR    
Sbjct: 245 KACLACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVN 304

Query: 266 LHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQ 409
             L KL  A+ D    + L   + K Y R+       E+++EA+  ++
Sbjct: 305 SKLKKLEDAIEDCTNAVKLDDTYVKAYLRRAQCYMDTEQFEEAVRDYE 352



>gb:AX888164_1483617 Sequence 4027 from Patent EP1033401.
          Length = 124

 Score = 65.1 bits (157), Expect = 4e-10
 Identities = 34/81 (41%), Positives = 45/81 (55%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKA 292
           D   KR   LK Q N++FKA +Y  A   Y+QAI+ +PSN   Y NR+ A+L       A
Sbjct: 22  DGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPSNAIYYGNRSLAYLRTECYGYA 81

Query: 293 LADAEMTISLKPDWEKGYFRK 355
           L DA   I L   + KGY+R+
Sbjct: 82  LGDATRAIELDKKYIKGYYRR 102



>gb:CEY39B6A_1369835 Caenorhabditis elegans YAC Y39B6A, complete
           sequence.
          Length = 496

 Score = 65.1 bits (157), Expect = 4e-10
 Identities = 37/106 (34%), Positives = 60/106 (56%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKA 292
           + + ++   +KD+ N+FFK   Y  AA LY+ AI+  P+   LY NRA A+L       A
Sbjct: 23  EDEKEKAGMIKDEANQFFKDQVYDVAADLYSVAIEIHPT-AVLYGNRAQAYLKKELYGSA 81

Query: 293 LADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L DA+  I++ P + KG++R+     A+ R+ +AL  +Q  +K  P
Sbjct: 82  LEDADNAIAIDPSYVKGFYRRATANMALGRFKKALTDYQAVVKVCP 127



>pir|T45058|T45058 phosphoprotein phosphatase (EC 3.1.3.16)
           Y39B6B.ff [similarity] - Caenorhabditis elegans
          Length = 526

 Score = 65.1 bits (157), Expect = 4e-10
 Identities = 37/106 (34%), Positives = 60/106 (56%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKA 292
           + + ++   +KD+ N+FFK   Y  AA LY+ AI+  P+   LY NRA A+L       A
Sbjct: 23  EDEKEKAGMIKDEANQFFKDQVYDVAADLYSVAIEIHPT-AVLYGNRAQAYLKKELYGSA 81

Query: 293 LADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L DA+  I++ P + KG++R+     A+ R+ +AL  +Q  +K  P
Sbjct: 82  LEDADNAIAIDPSYVKGFYRRATANMALGRFKKALTDYQAVVKVCP 127



>gb:BC073033_2556946 Xenopus laevis protein phosphatase 5, mRNA
           (cDNA clone MGC:82642 IMAGE:5049131), complete cds.
          Length = 493

 Score = 64.7 bits (156), Expect = 5e-10
 Identities = 36/102 (35%), Positives = 50/102 (49%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           K    LK+Q NE+F+  +Y  A   YTQAI   P     Y NR+ A+L       ALADA
Sbjct: 20  KTAEELKEQANEYFRVKDYDHAVQYYTQAIDLSPDTAIYYGNRSLAYLRTECYGYALADA 79

Query: 305 EMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
              I L   + KGY+R+     A+ +   AL  ++  +K  P
Sbjct: 80  SRAIQLDAKYIKGYYRRAASNMALGKLKAALKDYETVVKVRP 121



>gb:BC067176_2554649 Danio rerio zgc:55741, mRNA (cDNA clone
           MGC:77080 IMAGE:6960275), complete cds.
          Length = 320

 Score = 64.7 bits (156), Expect = 5e-10
 Identities = 33/97 (34%), Positives = 53/97 (54%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK  GN+  K  N+  A   Y++AI+ +P N   + NRAAA+  L     A+ D E  I 
Sbjct: 94  LKTDGNDQMKVENFSAAVEFYSKAIQLNPQNAVYFCNRAAAYSKLGNYAGAVQDCERAIG 153

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           +  ++ K Y R G  L ++ +Y EA+  ++ AL+ +P
Sbjct: 154 IDANYSKAYGRMGLALASLNKYSEAVSYYKKALELDP 190



>gb:BC048062_2550023 Danio rerio zgc:55741, mRNA (cDNA clone
           MGC:55741 IMAGE:3816361), complete cds.
          Length = 320

 Score = 64.7 bits (156), Expect = 5e-10
 Identities = 33/97 (34%), Positives = 53/97 (54%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK  GN+  K  N+  A   Y++AI+ +P N   + NRAAA+  L     A+ D E  I 
Sbjct: 94  LKTDGNDQMKVENFSAAVEFYSKAIQLNPQNAVYFCNRAAAYSKLGNYAGAVQDCERAIG 153

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           +  ++ K Y R G  L ++ +Y EA+  ++ AL+ +P
Sbjct: 154 IDANYSKAYGRMGLALASLNKYSEAVSYYKKALELDP 190



>gb:AF018263_2468871 Xenopus laevis protein phosphatase 5 (PP5)
           mRNA, partial cds.
          Length = 492

 Score = 64.7 bits (156), Expect = 5e-10
 Identities = 36/102 (35%), Positives = 50/102 (49%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           K    LK+Q NE+F+  +Y  A   YTQAI   P     Y NR+ A+L       ALADA
Sbjct: 19  KTAEELKEQANEYFRVKDYDHAVQYYTQAIDLSPDTAIYYGNRSLAYLRTECYGYALADA 78

Query: 305 EMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
              I L   + KGY+R+     A+ +   AL  ++  +K  P
Sbjct: 79  SRAIQLDAKYIKGYYRRAASNMALGKLKAALKDYETVVKVRP 120



>gb:AE016816_1746696 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome III, complete sequence.
          Length = 327

 Score = 64.7 bits (156), Expect = 5e-10
 Identities = 38/109 (34%), Positives = 61/109 (55%), Gaps = 1/109 (0%)
 Frame = +2

Query: 95  GKTTMGDSDAKREV-SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLH 271
           G+  +   + K+E  +LK +GN    A +Y  A   YT AI+  P++   Y+NRAAA+  
Sbjct: 77  GEPKVAAEELKKEAEALKLEGNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSS 136

Query: 272 LVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIAL 418
           L +  KA+ DAE    +   + KG+ R G    A+ R++EAL+A++  L
Sbjct: 137 LQQYEKAVEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEALEAYKRVL 185



>gb:OSJN00076_1694423 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0039K24, complete sequence.
          Length = 410

 Score = 64.7 bits (156), Expect = 5e-10
 Identities = 34/85 (40%), Positives = 49/85 (57%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K +GNEF ++  +LKA  LYT AI    +N   Y NRAAA+  L   N+A+ D   +I +
Sbjct: 160 KSKGNEFMRSKQHLKAVELYTCAIALSRNNAIYYCNRAAAYTLLNMFNEAVEDCLKSIEI 219

Query: 323 KPDWEKGYFRKGCILEAMERYDEAL 397
            P++ K Y R G    A+ +Y +AL
Sbjct: 220 DPNYSKAYSRLGSAYFALGKYHDAL 244



>gb:OSA245900_1692394 Oryza sativa chromosome 4 BAC q3037-207F1
           complete genome.
          Length = 431

 Score = 64.7 bits (156), Expect = 5e-10
 Identities = 34/85 (40%), Positives = 49/85 (57%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K +GNEF ++  +LKA  LYT AI    +N   Y NRAAA+  L   N+A+ D   +I +
Sbjct: 135 KSKGNEFMRSKQHLKAVELYTCAIALSRNNAIYYCNRAAAYTLLNMFNEAVEDCLKSIEI 194

Query: 323 KPDWEKGYFRKGCILEAMERYDEAL 397
            P++ K Y R G    A+ +Y +AL
Sbjct: 195 DPNYSKAYSRLGSAYFALGKYHDAL 219



>gb:CR380954_1651414 Candida glabrata strain CBS138 chromosome H
           complete sequence.
          Length = 583

 Score = 64.7 bits (156), Expect = 5e-10
 Identities = 37/94 (39%), Positives = 53/94 (56%), Gaps = 1/94 (1%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIK-KDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           K QGN  F A +Y KA  L+++AI+  +  N   YSNR+A +  L K  +AL DAE  + 
Sbjct: 8   KQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAEECVK 67

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
           + P W KGY R G     +   DEA  +++ AL+
Sbjct: 68  INPTWSKGYNRLGAAHLGLGDLDEAEGSYKKALE 101



 Score = 54.7 bits (130), Expect = 6e-07
 Identities = 27/89 (30%), Positives = 46/89 (51%)
 Frame = +2

Query: 149 QGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISLKP 328
           +G ++F  G++  A   YT+ IK+ P +   YSNRAAA   L+   +A+ D    I   P
Sbjct: 396 EGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEKDP 455

Query: 329 DWEKGYFRKGCILEAMERYDEALDAFQIA 415
           ++ + Y RK     A++ +  A++    A
Sbjct: 456 NFIRAYIRKATAQIAVKEFAAAIETLDAA 484



>gb:AY274387_1315133 Drosophila melanogaster strain Canton-S
           Hsp70/Hsp90 organizing protein (Hop) gene, partial
           cds.>gb:AY274388_1315134 Drosophila melanogaster strain
           3CPA103 Hsp70/Hsp90 organizing protein (Hop) gene,
           partial cds.
          Length = 322

 Score = 64.7 bits (156), Expect = 5e-10
 Identities = 35/94 (37%), Positives = 54/94 (57%)
 Frame = +2

Query: 62  TLTQISANFLKGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTL 241
           +L+++ A  +K +  M   + ++    K+QGN FFK G+Y  A   YT+AIK++P +P L
Sbjct: 230 SLSEVEAK-IKEEERMAYINPEKAEEEKEQGNLFFKKGDYSTAVKHYTEAIKRNPDDPKL 288

Query: 242 YSNRAAAFLHLVKLNKALADAEMTISLKPDWEKG 343
           YSNRAA +  L   +  L D +  I L   + KG
Sbjct: 289 YSNRAACYTKLAAFDLGLKDCDTCIKLDEKFIKG 322



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 19/44 (43%), Positives = 26/44 (59%)
 Frame = +2

Query: 299 DAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           DAE TI L P W KGY RKG     +  + +A +A+   LK++P
Sbjct: 2   DAEKTIQLNPTWPKGYSRKGAAAAGLNDFMKAFEAYNEGLKYDP 45



 Score = 35.0 bits (79), Expect = 0.45
 Identities = 25/102 (24%), Positives = 47/102 (46%), Gaps = 7/102 (6%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K+ GN  +K  ++  A   Y  AI+ DP++ T Y+N AA      +  + +   E  I +
Sbjct: 121 KELGNAAYKKKDFETALKHYHAAIEHDPTDITFYNNIAAVHFERKEYEECIKQCEKGIEV 180

Query: 323 ----KPDWE---KGYFRKGCILEAMERYDEALDAFQIALKHN 427
               + D++   K + R G     +E Y +A   ++ A+  +
Sbjct: 181 GRESRADFKLIAKSFARIGNTYRKLENYKQAKVYYEKAMSEH 222



>gb:AY274385_1315131 Drosophila melanogaster strain Z(H)1 isolate 1
           Hsp70/Hsp90 organizing protein (Hop) gene, partial
           cds.>gb:AY274386_1315132 Drosophila melanogaster strain
           Z(H)1 isolate 2 Hsp70/Hsp90 organizing protein (Hop)
           gene, partial cds.
          Length = 321

 Score = 64.7 bits (156), Expect = 5e-10
 Identities = 35/94 (37%), Positives = 54/94 (57%)
 Frame = +2

Query: 62  TLTQISANFLKGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTL 241
           +L+++ A  +K +  M   + ++    K+QGN FFK G+Y  A   YT+AIK++P +P L
Sbjct: 229 SLSEVEAK-IKEEERMAYINPEKAEEEKEQGNLFFKKGDYSTAVKHYTEAIKRNPDDPKL 287

Query: 242 YSNRAAAFLHLVKLNKALADAEMTISLKPDWEKG 343
           YSNRAA +  L   +  L D +  I L   + KG
Sbjct: 288 YSNRAACYTKLAAFDLGLKDCDTCIKLDEKFIKG 321



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 19/44 (43%), Positives = 26/44 (59%)
 Frame = +2

Query: 299 DAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           DAE TI L P W KGY RKG     +  + +A +A+   LK++P
Sbjct: 2   DAEKTIQLNPTWPKGYSRKGAAAAGLNDFMKAFEAYNEGLKYDP 45



 Score = 35.0 bits (79), Expect = 0.45
 Identities = 25/102 (24%), Positives = 47/102 (46%), Gaps = 7/102 (6%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K+ GN  +K  ++  A   Y  AI+ DP++ T Y+N AA      +  + +   E  I +
Sbjct: 120 KELGNAAYKKKDFETALKHYHAAIEHDPTDITFYNNIAAVHFERKEYEECIKQCEKGIEV 179

Query: 323 ----KPDWE---KGYFRKGCILEAMERYDEALDAFQIALKHN 427
               + D++   K + R G     +E Y +A   ++ A+  +
Sbjct: 180 GRESRADFKLIAKSFARIGNTYRKLENYKQAKVYYEKAMSEH 221



>gb:AY274384_1315130 Drosophila simulans strain DSR isolate 3
           Hsp70/Hsp90 organizing protein (Hop) gene, partial cds.
          Length = 322

 Score = 64.7 bits (156), Expect = 5e-10
 Identities = 35/94 (37%), Positives = 54/94 (57%)
 Frame = +2

Query: 62  TLTQISANFLKGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTL 241
           +L+++ A  +K +  M   + ++    K+QGN FFK G+Y  A   YT+AIK++P +P L
Sbjct: 230 SLSEVEAK-IKEEERMAYINPEKAEEEKEQGNLFFKKGDYSTAVKHYTEAIKRNPDDPKL 288

Query: 242 YSNRAAAFLHLVKLNKALADAEMTISLKPDWEKG 343
           YSNRAA +  L   +  L D +  I L   + KG
Sbjct: 289 YSNRAACYTKLAAFDLGLKDCDTCIKLDEKFIKG 322



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 19/44 (43%), Positives = 26/44 (59%)
 Frame = +2

Query: 299 DAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           DAE TI L P W KGY RKG     +  + +A +A+   LK++P
Sbjct: 2   DAEKTIQLNPTWPKGYSRKGAAAAGLNDFMKAFEAYNEGLKYDP 45



 Score = 35.4 bits (80), Expect = 0.35
 Identities = 25/102 (24%), Positives = 46/102 (45%), Gaps = 7/102 (6%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K+ GN  +K  ++  A   Y  AI+ DP++ T Y+N AA      +  + +   E  I +
Sbjct: 121 KELGNAAYKKKDFETALKHYNAAIEHDPTDITFYNNIAAVHFERKEYEECIKQCEKGIEV 180

Query: 323 ----KPDWE---KGYFRKGCILEAMERYDEALDAFQIALKHN 427
               + D+    K + R G     +E Y +A   ++ A+  +
Sbjct: 181 GRESRADFNLIAKSFARIGNTYRKLENYKQAKVFYEKAMSEH 222



>gb:AY274383_1315129 Drosophila simulans strain DSR isolate 2
           Hsp70/Hsp90 organizing protein (Hop) gene, partial cds.
          Length = 322

 Score = 64.7 bits (156), Expect = 5e-10
 Identities = 35/94 (37%), Positives = 54/94 (57%)
 Frame = +2

Query: 62  TLTQISANFLKGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTL 241
           +L+++ A  +K +  M   + ++    K+QGN FFK G+Y  A   YT+AIK++P +P L
Sbjct: 230 SLSEVEAK-IKEEERMAYINPEKAEEEKEQGNLFFKKGDYSTAVKHYTEAIKRNPDDPKL 288

Query: 242 YSNRAAAFLHLVKLNKALADAEMTISLKPDWEKG 343
           YSNRAA +  L   +  L D +  I L   + KG
Sbjct: 289 YSNRAACYTKLAAFDLGLKDCDTCIKLDEKFIKG 322



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 19/44 (43%), Positives = 26/44 (59%)
 Frame = +2

Query: 299 DAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           DAE TI L P W KGY RKG     +  + +A +A+   LK++P
Sbjct: 2   DAEKTIQLNPTWPKGYSRKGAAAAGLNDFMKAFEAYNEGLKYDP 45



 Score = 35.8 bits (81), Expect = 0.27
 Identities = 25/102 (24%), Positives = 47/102 (46%), Gaps = 7/102 (6%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K+ GN  +K  ++  A   Y  AI+ DP++ T Y+N AA      +  + +   E  I +
Sbjct: 121 KELGNAAYKKKDFETALKHYNAAIEHDPTDITFYNNIAAVHFERKEYEECIKQCEKGIEV 180

Query: 323 ----KPDWE---KGYFRKGCILEAMERYDEALDAFQIALKHN 427
               + D++   K + R G     +E Y +A   ++ A+  +
Sbjct: 181 GRESRADFKLIAKSFARIGNTYRKLENYKQAKVFYEKAMSEH 222



>gb:AY274382_1315128 Drosophila simulans strain DSR isolate 1
           Hsp70/Hsp90 organizing protein (Hop) gene, partial cds.
          Length = 322

 Score = 64.7 bits (156), Expect = 5e-10
 Identities = 35/94 (37%), Positives = 54/94 (57%)
 Frame = +2

Query: 62  TLTQISANFLKGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTL 241
           +L+++ A  +K +  M   + ++    K+QGN FFK G+Y  A   YT+AIK++P +P L
Sbjct: 230 SLSEVEAK-IKEEERMAYINPEKAEEEKEQGNLFFKKGDYSTAGKHYTEAIKRNPDDPKL 288

Query: 242 YSNRAAAFLHLVKLNKALADAEMTISLKPDWEKG 343
           YSNRAA +  L   +  L D +  I L   + KG
Sbjct: 289 YSNRAACYTKLAAFDLGLKDCDTCIKLDEKFIKG 322



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 19/44 (43%), Positives = 26/44 (59%)
 Frame = +2

Query: 299 DAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           DAE TI L P W KGY RKG     +  + +A +A+   LK++P
Sbjct: 2   DAEKTIQLNPTWPKGYSRKGAAAAGLNDFMKAFEAYNEGLKYDP 45



 Score = 35.8 bits (81), Expect = 0.27
 Identities = 25/102 (24%), Positives = 47/102 (46%), Gaps = 7/102 (6%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K+ GN  +K  ++  A   Y  AI+ DP++ T Y+N AA      +  + +   E  I +
Sbjct: 121 KELGNAAYKKKDFETALKHYNAAIEHDPTDITFYNNIAAVHFERKEYEECIKQCEKGIEV 180

Query: 323 ----KPDWE---KGYFRKGCILEAMERYDEALDAFQIALKHN 427
               + D++   K + R G     +E Y +A   ++ A+  +
Sbjct: 181 GRESRADFKLIAKSFARIGNTYRKLENYKQAKVFYEKAMSEH 222



>gb:BC033772_1981046 Homo sapiens DnaJ (Hsp40) homolog, subfamily C,
           member 7, mRNA (cDNA clone MGC:45296 IMAGE:3924081),
           complete cds.>gb:HSU46571_2024453 Human
           tetratricopeptide repeat protein (tpr2) mRNA, complete
           cds.
          Length = 484

 Score = 64.3 bits (155), Expect = 7e-10
 Identities = 36/106 (33%), Positives = 60/106 (56%), Gaps = 1/106 (0%)
 Frame = +2

Query: 107 MGDSDAKREV-SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKL 283
           + D +AKRE  + K+QGN ++   +Y +A   YT+AI   P N + Y NRAA  + L + 
Sbjct: 9   LDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRF 68

Query: 284 NKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
            +AL DA+ ++ L   + +G+ R+G    ++     A  +FQ AL+
Sbjct: 69  REALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALE 114



 Score = 58.9 bits (141), Expect = 3e-08
 Identities = 36/108 (33%), Positives = 54/108 (50%), Gaps = 4/108 (3%)
 Frame = +2

Query: 98  KTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDP----SNPTLYSNRAAAF 265
           K  +   +AK   + K+ GN+ FK GNY  A  LYT+A+  DP    +N  LY NR    
Sbjct: 235 KACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVN 294

Query: 266 LHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQ 409
             L KL+ A+ D    + L   + K Y R+       E+Y+EA+  ++
Sbjct: 295 SKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYE 342



>gb:CR382122_1655276 Kluyveromyces lactis strain NRRL Y-1140
           chromosome B of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 512

 Score = 64.3 bits (155), Expect = 7e-10
 Identities = 38/102 (37%), Positives = 53/102 (51%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           ++ + LK++GN+F K   Y KAA  YT+AI+ DP N  LYSNRA   L L     +L DA
Sbjct: 11  EKALELKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDA 70

Query: 305 EMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           +  I L  +  K Y R+      +  + +A     I LK  P
Sbjct: 71  KRAIELDNNNLKAYHRRAMSYIGLLEFRKARKDLIIVLKFKP 112



>gb:CR380951_1650053 Candida glabrata strain CBS138 chromosome E
           complete sequence.
          Length = 343

 Score = 64.3 bits (155), Expect = 7e-10
 Identities = 37/99 (37%), Positives = 60/99 (60%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKA 292
           ++ AK E +LK +GN+     ++  A A Y++AI+  P+N   Y+NRAAA   L + ++A
Sbjct: 88  ETKAKAE-ALKLEGNKAMAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEA 146

Query: 293 LADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQ 409
           + DAE  I + P + KGY R G    A  + +EAL+A++
Sbjct: 147 VVDAEKAIEIDPAYSKGYSRLGFAKYAQNKPEEALEAYK 185



>sp|Q99615|DJC7_HUMAN DnaJ homolog subfamily C member 7
           (Tetratricopeptide repeat protein 2) (TPR repeat protein
           2).>gb:BC011837_1973248 Homo sapiens DnaJ (Hsp40)
           homolog, subfamily C, member 7, mRNA (cDNA clone
           MGC:20075 IMAGE:3945721), complete cds.
          Length = 494

 Score = 64.3 bits (155), Expect = 7e-10
 Identities = 36/106 (33%), Positives = 60/106 (56%), Gaps = 1/106 (0%)
 Frame = +2

Query: 107 MGDSDAKREV-SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKL 283
           + D +AKRE  + K+QGN ++   +Y +A   YT+AI   P N + Y NRAA  + L + 
Sbjct: 19  LDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRF 78

Query: 284 NKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
            +AL DA+ ++ L   + +G+ R+G    ++     A  +FQ AL+
Sbjct: 79  REALGDAQQSVRLDDSFVRGHLREGKCHLSLGNAMAACRSFQRALE 124



 Score = 58.9 bits (141), Expect = 3e-08
 Identities = 36/108 (33%), Positives = 54/108 (50%), Gaps = 4/108 (3%)
 Frame = +2

Query: 98  KTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDP----SNPTLYSNRAAAF 265
           K  +   +AK   + K+ GN+ FK GNY  A  LYT+A+  DP    +N  LY NR    
Sbjct: 245 KACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVN 304

Query: 266 LHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQ 409
             L KL+ A+ D    + L   + K Y R+       E+Y+EA+  ++
Sbjct: 305 SKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYE 352



>gb:AP004999_1847033 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0040H05.
          Length = 386

 Score = 63.9 bits (154), Expect = 9e-10
 Identities = 33/102 (32%), Positives = 53/102 (51%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           ++   LK  GN+  +  +YL A   Y++A+   P + TL+SNR+  +  +    KAL DA
Sbjct: 260 RKATDLKSLGNKAVEKKDYLSATGFYSKALYLYPDDATLFSNRSLCWHRMGDGGKALLDA 319

Query: 305 EMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
                L+ DW K Y+R G  L  ++ Y+ A +A     K +P
Sbjct: 320 HECRKLRSDWPKAYYRLGAALMLLKDYESACEALYNGFKLDP 361



>gb:AP002745_1822731 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0489G09.>gb:AP002861_1823241 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0665D10.
          Length = 672

 Score = 63.9 bits (154), Expect = 9e-10
 Identities = 30/105 (28%), Positives = 53/105 (50%)
 Frame = +2

Query: 116 SDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKAL 295
           ++ K     +  GNE F +G + +A   Y + +K  P NP LY NRAA    L +  K++
Sbjct: 433 NNVKAVARARSLGNELFNSGKFSEACLAYGEGLKHHPVNPVLYCNRAACRFKLGQWEKSI 492

Query: 296 ADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            D    + ++P++ K   R+      MER+ E++  +++  K  P
Sbjct: 493 EDCNEALKIQPNYPKALLRRAASYGKMERWAESVKDYEVLRKELP 537



 Score = 46.6 bits (109), Expect = 2e-04
 Identities = 23/71 (32%), Positives = 39/71 (54%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK  GNE +K G + +A  LY +A+   P N     NRAAA + L ++ +A+ + E  + 
Sbjct: 203 LKKAGNEQYKKGYFEEALRLYDRALALCPDNAACRGNRAAALIGLRRIGEAVKECEEAVR 262

Query: 320 LKPDWEKGYFR 352
           + P + + + R
Sbjct: 263 IDPSYGRAHQR 273



>gb:ATT5E8_1556137 Arabidopsis thaliana DNA chromosome 5, BAC clone
           T5E8 (ESSA project).
          Length = 616

 Score = 63.9 bits (154), Expect = 9e-10
 Identities = 38/110 (34%), Positives = 55/110 (50%), Gaps = 2/110 (1%)
 Frame = +2

Query: 71  QISANFLKGKTTMGDSDAKREVS--LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLY 244
           Q  A        + D++   E S  +K++GN  +K   + KA   YT+AIK + +N T Y
Sbjct: 466 QDQAKLASNLAPVSDTNGNMEASEVMKEKGNAAYKGKQWNKAVNFYTEAIKLNGANATYY 525

Query: 245 SNRAAAFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEA 394
            NRAAAFL L    +A  D    + +     K Y R+G   E++ RY EA
Sbjct: 526 CNRAAAFLELCCFQQAEQDCTKAMLIDKKNVKAYLRRGTARESLVRYKEA 575



>gb:BC049337_2550192 Danio rerio translocase of outer mitochondrial
           membrane 34, mRNA (cDNA clone MGC:56645 IMAGE:5916123),
           complete cds.
          Length = 305

 Score = 63.5 bits (153), Expect = 1e-09
 Identities = 39/102 (38%), Positives = 53/102 (51%), Gaps = 8/102 (7%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAI--------KKDPSNPTLYSNRAAAFLHLVKLNKAL 295
           LK  GNE FKAG Y +A  LY+QAI        KK      LYSNRAA++L     N+ +
Sbjct: 13  LKQAGNECFKAGQYGEAVTLYSQAIQQLEKSGQKKTEDLGILYSNRAASYLKDGNCNECI 72

Query: 296 ADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
            D   ++ L P   K   R+    EA+ERY +A   ++  L+
Sbjct: 73  KDCTASLDLVPFGFKALLRRAAAFEALERYRQAYVDYKTVLQ 114



 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 37/135 (27%), Positives = 63/135 (46%)
 Frame = +2

Query: 26  LSETLRSKNSP*TLTQISANFLKGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYT 205
           + E L    SP + +Q +      K   G    K+  +LK++GN   K G + KA   YT
Sbjct: 155 VKEKLGQAASPASSSQQNNVIDDKKKAPGPDAVKKGRTLKEEGNALVKKGEHKKAMEKYT 214

Query: 206 QAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERY 385
           Q++ +DP+  T Y+NRA  +L L     A++D E  + L     K  +R+    + ++  
Sbjct: 215 QSLAQDPTEVTTYTNRALCYLALKMYKDAISDCEEALRLDSANIKALYRRAQAYKELKNK 274

Query: 386 DEALDAFQIALKHNP 430
              ++     LK +P
Sbjct: 275 KSCIEDLNSVLKIDP 289



>gb:AL929108_2504775 Zebrafish DNA sequence from clone CH211-239J9
           in linkage group 6 Contains the 3' part of a novel gene
           similar to human and mouse SPAG1 (sperm associated
           antigen 1), a novel gene similar to human and mouse
           COX6C (cytochrome c oxidase, subunit VIc), a novel gene,
           a novel gene similar to mouse and human MBC2 (membrane
           bound C2 domain containing protein), a novel gene
           similar to vertebrate ITGB4BP (integrin beta 4 binding
           protein), the 3' part of novel gene similar to
           vertebrate MMP24 (membrane-inserted matrix
           metalloproteinase 24) and two predicted CpG islands,
           complete sequence.
          Length = 127

 Score = 63.5 bits (153), Expect = 1e-09
 Identities = 39/102 (38%), Positives = 53/102 (51%), Gaps = 8/102 (7%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAI--------KKDPSNPTLYSNRAAAFLHLVKLNKAL 295
           LK  GNE FKAG Y +A  LY+QAI        KK      LYSNRAA++L     N+ +
Sbjct: 13  LKQAGNECFKAGQYGEAVTLYSQAIQQLEKSGQKKTEDLGILYSNRAASYLKDGNCNECI 72

Query: 296 ADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
            D   ++ L P   K   R+    EA+ERY +A   ++  L+
Sbjct: 73  KDCTASLDLVPFGFKALLRRAAAFEALERYRQAYVDYKTVLQ 114



>gb:AE016815_1746366 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome II, complete sequence.
          Length = 594

 Score = 63.5 bits (153), Expect = 1e-09
 Identities = 36/104 (34%), Positives = 56/104 (53%), Gaps = 1/104 (0%)
 Frame = +2

Query: 89  LKGKTTMGDSDAKR-EVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAF 265
           L G  T  +   ++  ++LKD+GNE FK   Y +A   Y  A+K    +P  YSNR+A +
Sbjct: 80  LSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLK-EDPVFYSNRSACY 138

Query: 266 LHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEAL 397
           + L KL K + D    + LKPD+ K   R+    E++  Y +A+
Sbjct: 139 VPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAM 182



>gb:AY274381_1315127 Drosophila yakuba strain 0261.0 Hsp70/Hsp90
           organizing protein (Hop) gene, partial cds.
          Length = 322

 Score = 63.5 bits (153), Expect = 1e-09
 Identities = 35/94 (37%), Positives = 53/94 (56%)
 Frame = +2

Query: 62  TLTQISANFLKGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTL 241
           +L+++ A   K +  M   + ++    K+QGN FFK G+Y  A   YT+AIK++P +P L
Sbjct: 230 SLSEVEAK-TKEEERMAYINPEKAEEEKEQGNLFFKKGDYSTAVKHYTEAIKRNPDDPKL 288

Query: 242 YSNRAAAFLHLVKLNKALADAEMTISLKPDWEKG 343
           YSNRAA +  L   +  L D +  I L   + KG
Sbjct: 289 YSNRAACYTKLAAFDLGLKDCDTCIKLDEKFIKG 322



 Score = 43.9 bits (102), Expect = 0.001
 Identities = 19/44 (43%), Positives = 26/44 (59%)
 Frame = +2

Query: 299 DAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           DAE TI L P W KGY RKG     +  + +A +A+   LK++P
Sbjct: 2   DAEKTIQLNPTWPKGYSRKGAAAAGLSDFMKAFEAYNEGLKYDP 45



 Score = 36.2 bits (82), Expect = 0.20
 Identities = 28/109 (25%), Positives = 50/109 (45%), Gaps = 7/109 (6%)
 Frame = +2

Query: 122 AKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALAD 301
           AK+E   K+ GN  +K   +  A   Y  AI+ DP++ T Y+N AA      +  + +  
Sbjct: 117 AKKE---KELGNAAYKKKEFETALKHYNAAIEHDPTDITFYNNIAAVHFERKEYEECIKQ 173

Query: 302 AEMTISL----KPDWE---KGYFRKGCILEAMERYDEALDAFQIALKHN 427
            E  I +    + D++   K + R G     +E Y +A   ++ A+  +
Sbjct: 174 CEKGIEVGRESRADFKLIAKSFARIGNTYRKLENYKQAKVYYEKAMSEH 222



>sp|Q95LY5|TTCC_MACFA Tetratricopeptide repeat protein 12 (TPR
           repeat protein 12) (Fragment).>gb:AB071056_1871121
           Macaca fascicularis testis cDNA clone:QtsA-14709, full
           insert sequence.
          Length = 577

 Score = 63.5 bits (153), Expect = 1e-09
 Identities = 34/98 (34%), Positives = 51/98 (52%)
 Frame = +2

Query: 137 SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTI 316
           +LKD+GNE F  GNY  A   Y++ ++K      LY+NRA A++ L    KAL D E  +
Sbjct: 108 ALKDKGNEAFAEGNYETAILHYSEGLEKLKDVKVLYTNRAQAYMKLKNYEKALVDCEWAL 167

Query: 317 SLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
                  K YF  G    A++ Y  + + ++  L+ NP
Sbjct: 168 KCDEKCTKAYFHMGRANLALKNYSVSRECYKKILEINP 205



>gb:AE017343_1755930 Cryptococcus neoformans var. neoformans JEC21
           chromosome 3, complete sequence.
          Length = 586

 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 33/106 (31%), Positives = 57/106 (53%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKA 292
           + +  + + LK   N+ FK  N+ K+   YTQAI  +P  PT ++NRA +   + +   A
Sbjct: 74  EEETAKALELKALANKAFKDKNFSKSIDFYTQAIALNPKEPTFWNNRAMSKAKMEEHGGA 133

Query: 293 LADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           ++DA   + L P + K ++R+G    A+ R  +A+  F+ AL   P
Sbjct: 134 ISDATKAVELNPSYAKAFYRRGLSQLAILRPTDAVSDFKKALAIEP 179



>gb:AE014134_1129523 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003655_1219630 Drosophila melanogaster
           chromosome 2L, section 64 of 83 of the complete
           sequence.>gb:AY094801_1297975 Drosophila melanogaster
           LD24721 full insert cDNA.
          Length = 331

 Score = 63.2 bits (152), Expect = 2e-09
 Identities = 32/98 (32%), Positives = 51/98 (52%)
 Frame = +2

Query: 137 SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTI 316
           S+K++GN   K   Y +A   Y +AI  DP NP  Y NRAAA + L +  +A+ D +  +
Sbjct: 118 SIKNEGNRLMKENKYNEALLQYNRAIAFDPKNPIFYCNRAAAHIRLGENERAVTDCKSAL 177

Query: 317 SLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
               ++ K Y R G     M  +++A  A+  A++  P
Sbjct: 178 VYNNNYSKAYCRLGVAYSNMGNFEKAEQAYAKAIELEP 215



>gb:AP006062_1860740 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0415D04.
          Length = 428

 Score = 62.8 bits (151), Expect = 2e-09
 Identities = 38/109 (34%), Positives = 55/109 (50%), Gaps = 3/109 (2%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPS---NPTLYSNRAAAFLHLVKL 283
           D   ++   LK Q  E F+   Y+ A   YT AI+   +     TL +NR+  +L L   
Sbjct: 296 DLSKRKSAELKLQAREAFEREEYMLAGQHYTNAIELTTNAHDKATLLANRSLCWLRLSTG 355

Query: 284 NKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           N ALADA M   L+P W K  +R+G     ++ Y +A +AF   LK +P
Sbjct: 356 NGALADANMCRMLRPSWPKACYRQGAAFMFLKDYGKACEAFADGLKLDP 404



>gb:CR859815_1183917 Pongo pygmaeus mRNA; cDNA DKFZp469O1034 (from
           clone DKFZp469O1034).
          Length = 494

 Score = 62.8 bits (151), Expect = 2e-09
 Identities = 36/106 (33%), Positives = 59/106 (55%), Gaps = 1/106 (0%)
 Frame = +2

Query: 107 MGDSDAKREV-SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKL 283
           + D +AKRE  + K+QGN ++   +Y +A   YT+AI   P N + Y NRAA  + L + 
Sbjct: 19  LDDQEAKREAETFKEQGNAYYAKKDYNEAYNYYTKAIDMCPKNASYYGNRAATLMMLGRF 78

Query: 284 NKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
            +AL DA+ ++ L   + +G  R+G    ++     A  +FQ AL+
Sbjct: 79  REALGDAQQSVRLDDSFVRGRLREGKCHLSLGNAMAACRSFQRALE 124



 Score = 58.9 bits (141), Expect = 3e-08
 Identities = 36/108 (33%), Positives = 54/108 (50%), Gaps = 4/108 (3%)
 Frame = +2

Query: 98  KTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDP----SNPTLYSNRAAAF 265
           K  +   +AK   + K+ GN+ FK GNY  A  LYT+A+  DP    +N  LY NR    
Sbjct: 245 KACIACRNAKALKAKKEDGNKAFKEGNYKLAYELYTEALGIDPNNIKTNAKLYCNRGTVN 304

Query: 266 LHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQ 409
             L KL+ A+ D    + L   + K Y R+       E+Y+EA+  ++
Sbjct: 305 SKLRKLDDAIEDCTNAVKLDDTYIKAYLRRAQCYMDTEQYEEAVRDYE 352



>gb:AE014188_968208 Plasmodium falciparum 3D7 chromosome 12,
           complete sequence.>gb:AE014851_1229600 Plasmodium
           falciparum 3D7 chromosome 12, section 8 of 9 of the
           complete sequence.
          Length = 676

 Score = 62.8 bits (151), Expect = 2e-09
 Identities = 41/124 (33%), Positives = 61/124 (49%), Gaps = 6/124 (4%)
 Frame = +2

Query: 77  SANFLKG---KTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSN---PT 238
           S  F++G   K    D   K    +KD GN +FK  +YL A   Y +A+KK         
Sbjct: 483 SDKFVEGDNQKHIQDDILNKSVEEIKDIGNNYFKNNDYLNAIYYYNKALKKCKDKNIKSI 542

Query: 239 LYSNRAAAFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIAL 418
           LYSNRAA  + L K N  + D   +I L  ++ K Y R+    E +++Y++A +    AL
Sbjct: 543 LYSNRAACNIFLKKWNTVIEDCNKSIHLNDNFAKSYIRRSNAYEQLQKYNDASNDLNKAL 602

Query: 419 KHNP 430
             +P
Sbjct: 603 TIDP 606



>pir|T37851|T37851 hypothetical protein SPAC17G6.19c - fission yeast
            (Schizosaccharomyces pombe)>gb:SPAC1142_1716320 S.pombe
           chromosome I cosmid c1142.>gb:SPAC17G6_1716764 S.pombe
           chromosome I cosmid c17G6.
          Length = 317

 Score = 62.8 bits (151), Expect = 2e-09
 Identities = 37/97 (38%), Positives = 54/97 (55%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK +GN    A +Y KA  LYT+AI+ DP++P  YSNRAAA+  L +   A+ DA   +S
Sbjct: 86  LKLEGNNAIAAKDYQKALDLYTKAIEIDPTSPVYYSNRAAAYNQLGQFENAVEDALTCLS 145

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L P   + + R G    ++     A DA++  L  +P
Sbjct: 146 LDPHHARAFGRLGRAKLSLGDAAAAADAYKKGLDFDP 182



>gb:BC051775_2550443 Danio rerio zgc:56076, mRNA (cDNA clone
           MGC:56076 IMAGE:5409937), complete cds.
          Length = 284

 Score = 62.4 bits (150), Expect = 3e-09
 Identities = 36/93 (38%), Positives = 54/93 (58%), Gaps = 1/93 (1%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK+QGN  F +  Y +A   Y++AI ++PS    Y+NRA  ++ L + +KALAD +  + 
Sbjct: 14  LKEQGNRLFLSRKYQEAVTCYSKAINRNPSVAVYYTNRALCYVKLQQYDKALADCKHALE 73

Query: 320 LKPDWEKGYFRKG-CILEAMERYDEALDAFQIA 415
           L     K +F  G C LE +E Y+EA+   Q A
Sbjct: 74  LDSQSVKAHFFLGQCQLE-LENYEEAIGNLQRA 105



>gb:AY428510_2532322 Danio rerio EKN1 mRNA, complete
           cds.>gb:BC065881_2554171 Danio rerio zgc:77853, mRNA
           (cDNA clone MGC:77853 IMAGE:7002321), complete cds.
          Length = 420

 Score = 62.4 bits (150), Expect = 3e-09
 Identities = 38/105 (36%), Positives = 55/105 (52%), Gaps = 8/105 (7%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LKD+G++ F AGN+L A   Y  AIK +   P L+SNRAA  L L  L+KA+ D+   + 
Sbjct: 289 LKDKGDKLFMAGNFLAAVNAYNLAIKLNRKMPALFSNRAACHLKLRNLHKAIEDSSQALE 348

Query: 320 LKPDWE--------KGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L             K + R+G     ++ Y E L  +Q AL+ +P
Sbjct: 349 LLTPAVSANASARLKAHVRRGTAFCQLQLYVEGLQDYQKALEMDP 393



>gb:BC057207_2102679 Mus musculus tetratricopeptide repeat domain 3,
           mRNA (cDNA clone IMAGE:5328878), partial cds.
          Length = 1165

 Score = 62.4 bits (150), Expect = 3e-09
 Identities = 35/88 (39%), Positives = 47/88 (53%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           +K +GNE F    +  A   YT+AI+  P N  LY NRA  FL + +   AL+D +  I 
Sbjct: 216 MKMRGNEEFSKEKFEIAVIYYTRAIEYRPENHLLYGNRALCFLRMGQFRNALSDGKRAIV 275

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDA 403
           LK  W KG++R    L  +  YD AL A
Sbjct: 276 LKNTWPKGHYRYCDALCMLGEYDWALQA 303



>gb:AB008516_2043414 Mus musculus mRNA for mtprd, complete cds.
          Length = 1979

 Score = 62.4 bits (150), Expect = 3e-09
 Identities = 35/88 (39%), Positives = 47/88 (53%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           +K +GNE F    +  A   YT+AI+  P N  LY NRA  FL + +   AL+D +  I 
Sbjct: 234 MKMRGNEEFSKEKFEIAVIYYTRAIEYRPENHLLYGNRALCFLRMGQFRNALSDGKRAIV 293

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDA 403
           LK  W KG++R    L  +  YD AL A
Sbjct: 294 LKNTWPKGHYRYCDALCMLGEYDWALQA 321



>gb:BC032355_1980421 Homo sapiens tetratricopeptide repeat domain
           12, mRNA (cDNA clone MGC:40285 IMAGE:5219117), complete
           cds.
          Length = 732

 Score = 62.4 bits (150), Expect = 3e-09
 Identities = 33/98 (33%), Positives = 51/98 (52%)
 Frame = +2

Query: 137 SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTI 316
           +LK++GNE F  GNY  A   Y++ ++K      LY+NRA A++ L    KAL D E  +
Sbjct: 108 ALKEKGNEAFAEGNYETAILRYSEGLEKLKDMKVLYTNRAQAYMKLEDYEKALVDCEWAL 167

Query: 317 SLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
                  K YF  G    A++ Y  + + ++  L+ NP
Sbjct: 168 KCDEKCTKAYFHMGKANLALKNYSVSRECYKKILEINP 205



>gb:AK000542_1907989 Homo sapiens cDNA FLJ20535 fis, clone KAT11013.
          Length = 680

 Score = 62.4 bits (150), Expect = 3e-09
 Identities = 33/98 (33%), Positives = 51/98 (52%)
 Frame = +2

Query: 137 SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTI 316
           +LK++GNE F  GNY  A   Y++ ++K      LY+NRA A++ L    KAL D E  +
Sbjct: 83  ALKEKGNEAFAEGNYETAILRYSEGLEKLKDMKVLYTNRAQAYMKLEDYEKALVDCEWAL 142

Query: 317 SLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
                  K YF  G    A++ Y  + + ++  L+ NP
Sbjct: 143 KCDEKCTKAYFHMGKANLALKNYSVSRECYKKILEINP 180



>gb:AF439974_1800032 Hordeum vulgare SGT1 (SGT1) mRNA, complete cds.
          Length = 373

 Score = 62.4 bits (150), Expect = 3e-09
 Identities = 34/91 (37%), Positives = 48/91 (52%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           L+ +  E F   ++  AA LYTQAI+  P+   LY++RA A + L    +A+ADA   I 
Sbjct: 9   LESKAKEAFVDDDFELAAELYTQAIEAGPATAELYADRAQAHIKLGSYTEAVADANKAIE 68

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQI 412
           L P   K Y RKG     +E Y  A  A ++
Sbjct: 69  LDPSMHKAYLRKGSACIKLEEYQTAKAALEV 99



>gb:AK088273_1175301 Mus musculus 2 days neonate thymus thymic cells
           cDNA, RIKEN full-length enriched library,
           clone:E430009H23 product:tetratricopeptide repeat
           domain, full insert sequence.
          Length = 1136

 Score = 62.4 bits (150), Expect = 3e-09
 Identities = 35/88 (39%), Positives = 47/88 (53%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           +K +GNE F    +  A   YT+AI+  P N  LY NRA  FL + +   AL+D +  I 
Sbjct: 216 MKMRGNEEFSKEKFEIAVIYYTRAIEYRPENHLLYGNRALCFLRMGQFRNALSDGKRAIV 275

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDA 403
           LK  W KG++R    L  +  YD AL A
Sbjct: 276 LKNTWPKGHYRYCDALCMLGEYDWALQA 303



>gb:AK053765_1170561 Mus musculus 0 day neonate eyeball cDNA, RIKEN
           full-length enriched library, clone:E130307L08
           product:tetratricopeptide repeat domain, full insert
           sequence.
          Length = 711

 Score = 62.4 bits (150), Expect = 3e-09
 Identities = 35/88 (39%), Positives = 47/88 (53%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           +K +GNE F    +  A   YT+AI+  P N  LY NRA  FL + +   AL+D +  I 
Sbjct: 253 MKMRGNEEFSKEKFEIAVIYYTRAIEYRPENHLLYGNRALCFLRMGQFRNALSDGKRAIV 312

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDA 403
           LK  W KG++R    L  +  YD AL A
Sbjct: 313 LKNTWPKGHYRYCDALCMLGEYDWALQA 340



>pir|JW0059|JW0059 mtprd protein - mouse
          Length = 1979

 Score = 62.4 bits (150), Expect = 3e-09
 Identities = 35/88 (39%), Positives = 47/88 (53%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           +K +GNE F    +  A   YT+AI+  P N  LY NRA  FL + +   AL+D +  I 
Sbjct: 234 MKMRGNEEFSKEKFEIAVIYYTRAIEYRPENHLLYGNRALCFLRMGQFRNALSDGKRAIV 293

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDA 403
           LK  W KG++R    L  +  YD AL A
Sbjct: 294 LKNTWPKGHYRYCDALCMLGEYDWALQA 321



>sp|Q9H892|TTCC_HUMAN Tetratricopeptide repeat protein 12 (TPR
           repeat protein 12).>gb:AX883367_1479306 Sequence 18272
           from Patent EP1074617.>gb:AK023921_1909792 Homo sapiens
           cDNA FLJ13859 fis, clone THYRO1001033, weakly similar to
           TRANSFORMATION-SENSITIVE PROTEIN IEF SSP 3521.
          Length = 705

 Score = 62.4 bits (150), Expect = 3e-09
 Identities = 33/98 (33%), Positives = 51/98 (52%)
 Frame = +2

Query: 137 SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTI 316
           +LK++GNE F  GNY  A   Y++ ++K      LY+NRA A++ L    KAL D E  +
Sbjct: 108 ALKEKGNEAFAEGNYETAILRYSEGLEKLKDMKVLYTNRAQAYMKLEDYEKALVDCEWAL 167

Query: 317 SLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
                  K YF  G    A++ Y  + + ++  L+ NP
Sbjct: 168 KCDEKCTKAYFHMGKANLALKNYSVSRECYKKILEINP 205



>gb:BC068391_2555077 Danio rerio zgc:85806, mRNA (cDNA clone
           MGC:85806 IMAGE:6961671), complete cds.
          Length = 472

 Score = 62.0 bits (149), Expect = 3e-09
 Identities = 37/108 (34%), Positives = 57/108 (52%), Gaps = 4/108 (3%)
 Frame = +2

Query: 98  KTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDP----SNPTLYSNRAAAF 265
           K  +   +AK   + K++GN+ FK G+Y +A  LYT+A+  DP    +N  LY NRA   
Sbjct: 230 KARLACRNAKALKAKKEEGNKAFKEGSYEEAYELYTEALTIDPNNIKTNAKLYCNRATVG 289

Query: 266 LHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQ 409
             L KL +A+ D    I L   + K Y R+       E+Y+EA+  ++
Sbjct: 290 SKLNKLEQAIEDCTKAIKLDETYIKAYLRRAQCYMDTEQYEEAVRDYE 337



 Score = 58.5 bits (140), Expect = 4e-08
 Identities = 33/107 (30%), Positives = 54/107 (50%), Gaps = 1/107 (0%)
 Frame = +2

Query: 113 DSDAKREVS-LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNK 289
           D + +RE    K+QGN ++   +Y +A   YT+AI   P N + Y NRAA  + L +  +
Sbjct: 6   DEELEREAEGFKEQGNAYYVKKDYAEAFNFYTKAIDLCPKNASYYGNRAATLMMLSRYRE 65

Query: 290 ALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           AL D++  + L   + KG+ R+G     +     A+   Q  L+  P
Sbjct: 66  ALEDSQQAVRLDDSFMKGHMREGKCHLLLGNAMAAIRCLQKVLEREP 112



>gb:AY144442_1583536 Sorghum bicolor BAC 95A23/98N8.1 Rph region,
           partial sequence.
          Length = 438

 Score = 62.0 bits (149), Expect = 3e-09
 Identities = 36/99 (36%), Positives = 57/99 (57%), Gaps = 2/99 (2%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSN--PTLYSNRAAAFLHLVKLNKALADAEMT 313
           LK +GN+ FK  +Y  A   Y+ AI K+ ++   TL+SNR+  ++ + + NKAL DAE  
Sbjct: 313 LKLEGNKAFKKKDYYTAVKFYSVAIMKNANSVDATLFSNRSLCWIKMGEGNKALIDAEAC 372

Query: 314 ISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
              +P W K  +R+G     ++ Y++A  AF   LK +P
Sbjct: 373 RLFQPYWAKACYRQGAAHMFLKDYEKACGAFLDGLKLDP 411



>gb:AB019230_1514151 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MEB5.
          Length = 589

 Score = 62.0 bits (149), Expect = 3e-09
 Identities = 37/96 (38%), Positives = 52/96 (54%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K++GN+ FK   + KA  LY++AIK   +N T YSNRAAA+L L    +A  D    I+L
Sbjct: 478 KEKGNQAFKEKLWQKAIGLYSEAIKLSDNNATYYSNRAAAYLELGGFLQAEEDCTKAITL 537

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
                K Y R+G   E +     A++ F+ AL   P
Sbjct: 538 DKKNVKAYLRRGTAREMLGDCKGAIEDFRYALVLEP 573



>gb:AE014297_1138737 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE014297_1138738 Drosophila melanogaster
           chromosome 3R, complete sequence.>gb:AE003684_1220730
           Drosophila melanogaster chromosome 3R, section 22 of 118
           of the complete sequence.>gb:AE003684_1220731 Drosophila
           melanogaster chromosome 3R, section 22 of 118 of the
           complete sequence.>gb:AY058356_1291510 Drosophila
           melanogaster GH12714 full length
           cDNA.>gb:DME271781_1379103 Drosophila melanogaster mRNA
           for protein phosphatase 5 (PPP5 gene).
          Length = 520

 Score = 62.0 bits (149), Expect = 3e-09
 Identities = 33/109 (30%), Positives = 53/109 (48%)
 Frame = +2

Query: 104 TMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKL 283
           T  + D       K+QGNE  K   + KA  +YT+AI+  P++   Y+NR+ A L     
Sbjct: 40  TKAELDFAAAEQYKNQGNEMLKTKEFSKAIDMYTKAIELHPNSAIYYANRSLAHLRQESF 99

Query: 284 NKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
             AL D    +   P + KGY+R+     ++ ++ +AL  F+   K  P
Sbjct: 100 GFALQDGVSAVKADPAYLKGYYRRAAAHMSLGKFKQALCDFEFVAKCRP 148



>gb:BC059538_2552515 Danio rerio translocase of outer mitochondrial
           membrane 70 homolog A (yeast), mRNA (cDNA clone
           MGC:73188 IMAGE:4787573), complete cds.
          Length = 578

 Score = 61.6 bits (148), Expect = 5e-09
 Identities = 35/100 (35%), Positives = 50/100 (50%), Gaps = 5/100 (5%)
 Frame = +2

Query: 116 SDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNP-----TLYSNRAAAFLHLVK 280
           S   R  S K++GN++FKAG Y  A   YT+AI   P        T Y NRAAA+   +K
Sbjct: 79  SPLDRAQSAKNKGNKYFKAGKYDHAIKCYTEAIGLCPKEKKGDLSTFYQNRAAAYEQQMK 138

Query: 281 LNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALD 400
             + + D    + L P + K  FR+   LE ++   E L+
Sbjct: 139 WTEVIQDCSQAVELNPRYVKALFRRAKALEKLDNKKECLE 178



>gb:AJ720999_2503186 Gallus gallus mRNA for hypothetical protein,
           clone 32b21.
          Length = 314

 Score = 61.6 bits (148), Expect = 5e-09
 Identities = 35/91 (38%), Positives = 49/91 (53%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K+QGN  F    Y +AAA Y +AI ++P     Y+NRA  +L + + +KALAD +  + L
Sbjct: 40  KEQGNRLFGGRKYPEAAAAYGRAINRNPLVAVYYTNRALCYLKMQQHDKALADCKRALEL 99

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIA 415
                K +F  G     ME YDEA+   Q A
Sbjct: 100 DGQSVKAHFFLGQCQMEMENYDEAIANLQRA 130



>gb:AC098598_1736783 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1007_H05, complete sequence.
          Length = 555

 Score = 61.6 bits (148), Expect = 5e-09
 Identities = 31/89 (34%), Positives = 49/89 (55%), Gaps = 2/89 (2%)
 Frame = +2

Query: 95  GKTTMG--DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFL 268
           G T +G   ++ +     + QGNE FKAG + +A+  Y + +K +PSNP LY NRAA + 
Sbjct: 444 GNTEVGRITNNIRLVAQARGQGNELFKAGKFAEASLAYGEGLKYEPSNPVLYCNRAACWS 503

Query: 269 HLVKLNKALADAEMTISLKPDWEKGYFRK 355
            L +  KA+ D    + + P + K   R+
Sbjct: 504 KLGRWMKAVEDCNEALKVHPGYTKALLRR 532



 Score = 48.5 bits (114), Expect = 4e-05
 Identities = 32/111 (28%), Positives = 53/111 (47%)
 Frame = +2

Query: 83  NFLKGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAA 262
           ++ +     G S   +EV+    GNE++K G+Y +A   Y QA+   P +    SNRAAA
Sbjct: 204 SYSRSPAPQGSSGGLQEVTRA--GNEWYKKGHYGEALRHYDQAVALCPDSAACRSNRAAA 261

Query: 263 FLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIA 415
            + L +L +AL + E  I   P   + + R   +       + A + F +A
Sbjct: 262 LIGLGRLAEALRECEEAIRRDPASGRAHSRLAALCLRFGMVERAREHFMLA 312



>gb:SPBC543_1720230 S.pombe chromosome II cosmid c543.
          Length = 476

 Score = 61.6 bits (148), Expect = 5e-09
 Identities = 33/97 (34%), Positives = 57/97 (58%), Gaps = 4/97 (4%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSN----PTLYSNRAAAFLHLVKLNKALADAEM 310
           K+QGN+ F+ GNY  A   Y++A++ DP N      LY NRA   L L +  +AL+D++ 
Sbjct: 227 KNQGNDLFRQGNYQDAYEKYSEALQIDPDNKETVAKLYMNRATVLLRLKRPEEALSDSDN 286

Query: 311 TISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
            +++   + KG   +    EA+E+++EA+   Q A++
Sbjct: 287 ALAIDSSYLKGLKVRAKAHEALEKWEEAVRDVQSAIE 323



 Score = 50.8 bits (120), Expect = 8e-06
 Identities = 33/112 (29%), Positives = 51/112 (45%), Gaps = 2/112 (1%)
 Frame = +2

Query: 65  LTQISANFLKGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIK--KDPSNPT 238
           +T++    +   T      A+     K  GN F+K   Y +A   YT+AI    D +   
Sbjct: 1   MTEVETTHMNAGTESQQEPAELAEKQKAIGNAFYKEKKYAEAIKAYTEAIDLGSDSALAI 60

Query: 239 LYSNRAAAFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEA 394
            YSNRAA ++ + +   AL DA+ +  +KPD  K   R     E +   +EA
Sbjct: 61  YYSNRAATYMQIGEFELALCDAKQSDRIKPDVPKTQSRIRQAYEGLSILNEA 112



>gb:CR382128_1660617 Yarrowia lipolytica chromosome B of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 479

 Score = 61.6 bits (148), Expect = 5e-09
 Identities = 34/97 (35%), Positives = 54/97 (55%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK+QGN+   +G+Y  A  LYTQAI+ +P +   Y+NRA A +       A+ D+   I 
Sbjct: 6   LKNQGNKALLSGHYNDAVDLYTQAIELNPQSAVYYANRAQAHIKNEAYGVAIEDSSKAIE 65

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L P + K YFR+     A+ ++ +AL  F+  ++  P
Sbjct: 66  LDPTYIKAYFRRAVSNTAIIKHKDALVDFKKVVQLAP 102



>gb:CR382121_1654574 Kluyveromyces lactis strain NRRL Y-1140
           chromosome A of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 581

 Score = 61.6 bits (148), Expect = 5e-09
 Identities = 34/94 (36%), Positives = 52/94 (55%), Gaps = 1/94 (1%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIK-KDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           K +GN+ F + +Y KA  L+T+AI+  +  N  L+SNR+A +       KAL DA   + 
Sbjct: 7   KQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDANECVK 66

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
           + P W KGY R G     +   DEA  +++ AL+
Sbjct: 67  INPSWAKGYNRLGAAHYGLGDLDEAEQSYKKALE 100



 Score = 61.2 bits (147), Expect = 6e-09
 Identities = 38/130 (29%), Positives = 65/130 (50%), Gaps = 2/130 (1%)
 Frame = +2

Query: 32  ETLRSKNSP*TLTQI--SANFLKGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYT 205
           ++L    +P  LT++  +   LK K      D ++    + QG E+F   ++ KA   YT
Sbjct: 354 KSLTEHRTPDILTKLRNTEKELKQKEAESYMDPEKAEEARLQGKEYFTKADWPKAVEAYT 413

Query: 206 QAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERY 385
           + IK++P++   YSNRAAA   L+    A+ D +  I   P++ + Y RK     A++ Y
Sbjct: 414 EMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKDPNFVRAYIRKATGQIAIKDY 473

Query: 386 DEALDAFQIA 415
             A++    A
Sbjct: 474 AGAIETLDSA 483



>gb:BT001725_1356498 Drosophila melanogaster RE69804 full insert
           cDNA.
          Length = 508

 Score = 61.6 bits (148), Expect = 5e-09
 Identities = 31/70 (44%), Positives = 39/70 (55%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K  GN+ +KA NY  A  LYT AI   P +   Y NRAA ++ L+  N AL DA   I +
Sbjct: 53  KKLGNDQYKAQNYQNALKLYTDAISLCPDSAAYYGNRAACYMMLLNYNSALTDARHAIRI 112

Query: 323 KPDWEKGYFR 352
            P +EK Y R
Sbjct: 113 DPGFEKAYVR 122



 Score = 53.5 bits (127), Expect = 1e-06
 Identities = 30/106 (28%), Positives = 53/106 (50%), Gaps = 4/106 (3%)
 Frame = +2

Query: 116 SDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYS----NRAAAFLHLVKL 283
           S  K+   +K+ GN  FK+G Y +A  +YT A+K D  N  + S    NRA     +  L
Sbjct: 272 SKCKQLKEMKENGNMLFKSGRYREAHVIYTDALKIDEHNKDINSKLLYNRALVNTRIGNL 331

Query: 284 NKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
            +A+AD    + L   + K    +      +E+++E++  ++ AL+
Sbjct: 332 REAVADCNRVLELNSQYLKALLLRARCYNDLEKFEESVADYETALQ 377



>gb:AY052144_1290738 Drosophila melanogaster SD10334 full length
           cDNA.
          Length = 947

 Score = 61.6 bits (148), Expect = 5e-09
 Identities = 38/112 (33%), Positives = 55/112 (49%), Gaps = 3/112 (2%)
 Frame = +2

Query: 104 TMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTL---YSNRAAAFLHL 274
           T+   +     S KD+GNE FKA  + +A   Y +AIK    +  L   Y NRAAA+L L
Sbjct: 4   TINSEEVSDAGSYKDKGNEAFKASRWEEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLKL 63

Query: 275 VKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            K   A+ D   ++   P   K  FR+    EA+E+++EA        K +P
Sbjct: 64  GKYENAVEDCTESLKAAPGDPKALFRRAQAYEALEKFEEAYKDATALFKADP 115



>gb:AE014297_1138414 Drosophila melanogaster chromosome 3R, complete
           sequence.>gb:AE003677_1220407 Drosophila melanogaster
           chromosome 3R, section 15 of 118 of the complete
           sequence.
          Length = 947

 Score = 61.6 bits (148), Expect = 5e-09
 Identities = 38/112 (33%), Positives = 55/112 (49%), Gaps = 3/112 (2%)
 Frame = +2

Query: 104 TMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTL---YSNRAAAFLHL 274
           T+   +     S KD+GNE FKA  + +A   Y +AIK    +  L   Y NRAAA+L L
Sbjct: 4   TINSEEVSDAGSYKDKGNEAFKASRWEEAVEHYGKAIKAGSKHKELAVFYKNRAAAYLKL 63

Query: 275 VKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            K   A+ D   ++   P   K  FR+    EA+E+++EA        K +P
Sbjct: 64  GKYENAVEDCTESLKAAPGDPKALFRRAQAYEALEKFEEAYKDATALFKADP 115



>gb:AE014134_1129407 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003651_1219514 Drosophila melanogaster
           chromosome 2L, section 60 of 83 of the complete
           sequence.
          Length = 464

 Score = 61.6 bits (148), Expect = 5e-09
 Identities = 31/70 (44%), Positives = 39/70 (55%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K  GN+ +KA NY  A  LYT AI   P +   Y NRAA ++ L+  N AL DA   I +
Sbjct: 9   KKLGNDQYKAQNYQNALKLYTDAISLCPDSAAYYGNRAACYMMLLNYNSALTDARHAIRI 68

Query: 323 KPDWEKGYFR 352
            P +EK Y R
Sbjct: 69  DPGFEKAYVR 78



 Score = 53.5 bits (127), Expect = 1e-06
 Identities = 30/106 (28%), Positives = 53/106 (50%), Gaps = 4/106 (3%)
 Frame = +2

Query: 116 SDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYS----NRAAAFLHLVKL 283
           S  K+   +K+ GN  FK+G Y +A  +YT A+K D  N  + S    NRA     +  L
Sbjct: 228 SKCKQLKEMKENGNMLFKSGRYREAHVIYTDALKIDEHNKDINSKLLYNRALVNTRIGNL 287

Query: 284 NKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
            +A+AD    + L   + K    +      +E+++E++  ++ AL+
Sbjct: 288 REAVADCNRVLELNSQYLKALLLRARCYNDLEKFEESVADYETALQ 333



>gb:AE014134_1129406 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003651_1219513 Drosophila melanogaster
           chromosome 2L, section 60 of 83 of the complete
           sequence.>gb:AF199022_1250020 Drosophila melanogaster
           tetratricopeptide repeat protein 2 (dtpr2) mRNA,
           complete cds.
          Length = 508

 Score = 61.6 bits (148), Expect = 5e-09
 Identities = 31/70 (44%), Positives = 39/70 (55%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K  GN+ +KA NY  A  LYT AI   P +   Y NRAA ++ L+  N AL DA   I +
Sbjct: 53  KKLGNDQYKAQNYQNALKLYTDAISLCPDSAAYYGNRAACYMMLLNYNSALTDARHAIRI 112

Query: 323 KPDWEKGYFR 352
            P +EK Y R
Sbjct: 113 DPGFEKAYVR 122



 Score = 53.5 bits (127), Expect = 1e-06
 Identities = 30/106 (28%), Positives = 53/106 (50%), Gaps = 4/106 (3%)
 Frame = +2

Query: 116 SDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYS----NRAAAFLHLVKL 283
           S  K+   +K+ GN  FK+G Y +A  +YT A+K D  N  + S    NRA     +  L
Sbjct: 272 SKCKQLKEMKENGNMLFKSGRYREAHVIYTDALKIDEHNKDINSKLLYNRALVNTRIGNL 331

Query: 284 NKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALK 421
            +A+AD    + L   + K    +      +E+++E++  ++ AL+
Sbjct: 332 REAVADCNRVLELNSQYLKALLLRARCYNDLEKFEESVADYETALQ 377



>gb:BA000040_729568 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 458

 Score = 61.6 bits (148), Expect = 5e-09
 Identities = 34/95 (35%), Positives = 55/95 (57%)
 Frame = +2

Query: 146 DQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISLK 325
           D+G  ++  G+  KA    ++A++ DP+ P  Y+NR AA+  L +L+K++ADA   I L 
Sbjct: 177 DRGVTYYLGGDNEKAIRDLSEALRLDPNRPRTYTNRGAAYKKLGQLDKSVADAAEAIRLD 236

Query: 326 PDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           P   + Y  +G  L AM  YD+A+  +  AL+  P
Sbjct: 237 PKVPEYYDNRGLSLAAMGDYDKAIADYDQALRLAP 271



 Score = 43.1 bits (100), Expect = 0.002
 Identities = 28/104 (26%), Positives = 48/104 (46%)
 Frame = +2

Query: 119 DAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALA 298
           D  R  +  ++G  + K G   K+ A   +AI+ DP  P  Y NR  +   +   +KA+A
Sbjct: 202 DPNRPRTYTNRGAAYKKLGQLDKSVADAAEAIRLDPKVPEYYDNRGLSLAAMGDYDKAIA 261

Query: 299 DAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           D +  + L P     +  +G   +    +  AL  ++ ALK +P
Sbjct: 262 DYDQALRLAPK-PNFFTNRGDSYQFKGEFGAALSDYESALKLDP 304



 Score = 39.3 bits (90), Expect = 0.024
 Identities = 29/105 (27%), Positives = 52/105 (49%), Gaps = 1/105 (0%)
 Frame = +2

Query: 119 DAKREVSLKDQGNEFFKAGNYL-KAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKAL 295
           D K   + + +G+   +AG  L +AAA  ++AI+ DP +   Y  R   +    +L++AL
Sbjct: 99  DGKNAKAWRLRGDLLREAGGDLNRAAADLSKAIELDPQDAESYELRGVVYTSQRRLDRAL 158

Query: 296 ADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           AD +  I LKP   + +  +G         ++A+     AL+ +P
Sbjct: 159 ADYDQAIKLKPGDAQAWSDRGVTYYLGGDNEKAIRDLSEALRLDP 203



 Score = 38.9 bits (89), Expect = 0.031
 Identities = 20/61 (32%), Positives = 33/61 (54%)
 Frame = +2

Query: 146 DQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISLK 325
           ++G+ +   G +  A + Y  A+K DP+    Y+NRA  +  + +  KALAD E  + L 
Sbjct: 278 NRGDSYQFKGEFGAALSDYESALKLDPNFAQTYNNRAVLYKKMGERRKALADYETALKLD 337

Query: 326 P 328
           P
Sbjct: 338 P 338



>gb:AY428506_2084918 Rattus norvegicus EKN1 mRNA, complete
           cds.>gb:BC085838_2109397 Rattus norvegicus dyslexia
           susceptibility 1 candidate 1 homolog (human), mRNA (cDNA
           clone MGC:94521 IMAGE:7135744), complete cds.
          Length = 420

 Score = 61.2 bits (147), Expect = 6e-09
 Identities = 42/117 (35%), Positives = 56/117 (47%), Gaps = 12/117 (10%)
 Frame = +2

Query: 116 SDAKREVS----LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKL 283
           SD K E      LKD+GN+ F   NYL A   Y  AI+ +   P LY NRAA  L L  L
Sbjct: 279 SDLKEEEKNPDWLKDKGNKLFATENYLAAIDAYNLAIRLNRKIPVLYLNRAACHLKLKNL 338

Query: 284 NKALADAEMTISLKPD--------WEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           +KA+ D+   + L             K + R+G     +E Y E L  ++ ALK +P
Sbjct: 339 HKAIEDSSKALELLTPPVADNANARMKAHVRRGTAFCQLELYVEGLQDYEAALKIDP 395



>gb:AK122356_2069021 Mus musculus mRNA for mKIAA0719 protein.
          Length = 626

 Score = 61.2 bits (147), Expect = 6e-09
 Identities = 35/100 (35%), Positives = 50/100 (50%), Gaps = 5/100 (5%)
 Frame = +2

Query: 116 SDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNP-----TLYSNRAAAFLHLVK 280
           S   R  + K++GN++FKAG Y +A   YT+AI   P+       T Y NRAAAF  L K
Sbjct: 127 SSLDRAQAAKNKGNKYFKAGKYEQAIQCYTEAISLCPTEKNVDLSTFYQNRAAAFEQLQK 186

Query: 281 LNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALD 400
             +   D    + L P + K  FR+    E ++   E L+
Sbjct: 187 WKEVAQDCTKAVELNPKYVKALFRRAKAHEKLDNKKECLE 226



>gb:AB162856_2049387 Rattus norvegicus mRNA for TOM70, complete cds.
          Length = 610

 Score = 61.2 bits (147), Expect = 6e-09
 Identities = 35/100 (35%), Positives = 50/100 (50%), Gaps = 5/100 (5%)
 Frame = +2

Query: 116 SDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNP-----TLYSNRAAAFLHLVK 280
           S   R  + K++GN++FKAG Y +A   YT+AI   P+       T Y NRAAAF  L K
Sbjct: 111 SSLDRAQAAKNKGNKYFKAGKYEQAIQCYTEAISLCPTEKNADLSTFYQNRAAAFEQLQK 170

Query: 281 LNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALD 400
             +   D    + L P + K  FR+    E ++   E L+
Sbjct: 171 WKEVAQDCTKAVELNPKYVKALFRRAKAHEKLDNKKECLE 210



>gb:CR382134_1667198 Debaryomyces hansenii chromosome B of strain
           CBS767 of Debaryomyces hansenii.
          Length = 321

 Score = 61.2 bits (147), Expect = 6e-09
 Identities = 37/100 (37%), Positives = 56/100 (56%), Gaps = 3/100 (3%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK QGN+ F    + KAA +Y  AIK D +NP LYSNRA  F+     ++AL D +  +S
Sbjct: 7   LKAQGNKAFANKEFKKAAKIYRDAIKLDSTNPVLYSNRALCFIKEQDWDRALRDCKGGLS 66

Query: 320 LKPDWE---KGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L P+     K  +R+G   + +     A++ F+ A+K +P
Sbjct: 67  LSPNVSTKVKLIYRQGIAHKNLNDILHAIECFKQAVKIDP 106



>gb:AY144974_1583765 Saccharomyces castellii clone Contig1491 TOM70
           gene, complete cds.
          Length = 625

 Score = 61.2 bits (147), Expect = 6e-09
 Identities = 30/95 (31%), Positives = 53/95 (55%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKA 292
           +   K  + LKD+GN++FKA +Y  A   Y  A+  +  +P  YSN +A ++ L +L+K 
Sbjct: 116 EEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLN-KDPIFYSNISACYVSLGQLDKV 174

Query: 293 LADAEMTISLKPDWEKGYFRKGCILEAMERYDEAL 397
           +  +   + L P++ K   R+    E++E Y +AL
Sbjct: 175 IESSTKALELNPNYSKALLRRASANESLENYSDAL 209



>gb:AK083586_1174011 Mus musculus 9 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:D030049M20
           product:unknown EST, full insert
           sequence.>gb:BC057096_2102590 Mus musculus translocase
           of outer mitochondrial membrane 70 homolog A (yeast),
           mRNA (cDNA clone MGC:64791 IMAGE:5709110), complete cds.
          Length = 611

 Score = 61.2 bits (147), Expect = 6e-09
 Identities = 35/100 (35%), Positives = 50/100 (50%), Gaps = 5/100 (5%)
 Frame = +2

Query: 116 SDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNP-----TLYSNRAAAFLHLVK 280
           S   R  + K++GN++FKAG Y +A   YT+AI   P+       T Y NRAAAF  L K
Sbjct: 112 SSLDRAQAAKNKGNKYFKAGKYEQAIQCYTEAISLCPTEKNVDLSTFYQNRAAAFEQLQK 171

Query: 281 LNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALD 400
             +   D    + L P + K  FR+    E ++   E L+
Sbjct: 172 WKEVAQDCTKAVELNPKYVKALFRRAKAHEKLDNKKECLE 211



>gb:AK076457_1171399 Mus musculus 0 day neonate head cDNA, RIKEN
           full-length enriched library, clone:4833406G21
           product:similar to THYRO1001033 PROTEIN [Homo sapiens],
           full insert sequence.
          Length = 216

 Score = 61.2 bits (147), Expect = 6e-09
 Identities = 33/98 (33%), Positives = 51/98 (52%)
 Frame = +2

Query: 137 SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTI 316
           +LK++GNE F  G+Y  A   Y++ + K      LY+NRA AF+ L    KAL D +  +
Sbjct: 41  ALKEKGNEAFVRGDYETAIFFYSEGLGKLKDMKVLYTNRAQAFIKLGDYQKALVDCDWAL 100

Query: 317 SLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
               +  K YF  G    A++ Y +A + +Q   + NP
Sbjct: 101 KCDENCTKAYFHMGKAHVALKNYSKAKECYQKIEEINP 138



>sp|Q8BW49|TTCC_MOUSE Tetratricopeptide repeat protein 12 (TPR
           repeat protein 12).>gb:AK054350_1170792 Mus musculus 2
           days pregnant adult female ovary cDNA, RIKEN full-length
           enriched library, clone:E330017O07 product:similar to
           THYRO1001033 PROTEIN [Homo sapiens], full insert
           sequence.>gb:BC056616_2102429 Mus musculus
           tetratricopeptide repeat domain 12, mRNA (cDNA clone
           MGC:67683 IMAGE:4974294), complete cds.
          Length = 704

 Score = 61.2 bits (147), Expect = 6e-09
 Identities = 33/98 (33%), Positives = 51/98 (52%)
 Frame = +2

Query: 137 SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTI 316
           +LK++GNE F  G+Y  A   Y++ + K      LY+NRA AF+ L    KAL D +  +
Sbjct: 107 ALKEKGNEAFVRGDYETAIFFYSEGLGKLKDMKVLYTNRAQAFIKLGDYQKALVDCDWAL 166

Query: 317 SLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
               +  K YF  G    A++ Y +A + +Q   + NP
Sbjct: 167 KCDENCTKAYFHMGKAHVALKNYSKAKECYQKIEEINP 204



>gb:AP005317_1850502 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0579G08.
          Length = 183

 Score = 60.8 bits (146), Expect = 8e-09
 Identities = 34/96 (35%), Positives = 53/96 (55%)
 Frame = +2

Query: 143 KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISL 322
           K QG E  K  +Y  A  +YT+AI  +  + +L+SNR+  +L L +  KAL DAE    +
Sbjct: 64  KFQGREAVKNKDYRGAMHIYTKAIALNTRDASLFSNRSLCWLKLGEGEKALIDAEACRMM 123

Query: 323 KPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           +P+W +  +R+G  L  ++ Y  A  +F   LK  P
Sbjct: 124 QPNWPEACYRQGAALMLLKDYKNACSSFLDGLKLEP 159



>gb:BT004630_1637664 Arabidopsis thaliana At4g08320 gene, complete
           cds.
          Length = 427

 Score = 60.8 bits (146), Expect = 8e-09
 Identities = 35/99 (35%), Positives = 55/99 (55%), Gaps = 1/99 (1%)
 Frame = +2

Query: 137 SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTI 316
           +LK QGN+  ++  YL+A  LY+ AI     N   Y NRAAA+  +   ++A+ D   +I
Sbjct: 177 TLKCQGNKAMQSNLYLEAVELYSFAIALTDKNAVFYCNRAAAYTQINMCSEAIKDCLKSI 236

Query: 317 SLKPDWEKGYFRKGCILEAMERYDEALD-AFQIALKHNP 430
            + P++ K Y R G    A  +Y EA++  F+ AL  +P
Sbjct: 237 EIDPNYSKAYSRLGLAYYAQGKYAEAIEKGFKKALLLDP 275



>pir|T14186|T14186 hypothetical protein T28D5.10 - Arabidopsis
           thaliana  (fragment)
          Length = 382

 Score = 60.8 bits (146), Expect = 8e-09
 Identities = 35/99 (35%), Positives = 55/99 (55%), Gaps = 1/99 (1%)
 Frame = +2

Query: 137 SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTI 316
           +LK QGN+  ++  YL+A  LY+ AI     N   Y NRAAA+  +   ++A+ D   +I
Sbjct: 132 TLKCQGNKAMQSNLYLEAVELYSFAIALTDKNAVFYCNRAAAYTQINMCSEAIKDCLKSI 191

Query: 317 SLKPDWEKGYFRKGCILEAMERYDEALD-AFQIALKHNP 430
            + P++ K Y R G    A  +Y EA++  F+ AL  +P
Sbjct: 192 EIDPNYSKAYSRLGLAYYAQGKYAEAIEKGFKKALLLDP 230



>pir|E85082|E85082 hypothetical protein AT4g08320 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV23_1544548 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           23.>gb:ATT28D5_1555561 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T28D5, partial sequence (ESSA
           project).
          Length = 382

 Score = 60.8 bits (146), Expect = 8e-09
 Identities = 35/99 (35%), Positives = 55/99 (55%), Gaps = 1/99 (1%)
 Frame = +2

Query: 137 SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTI 316
           +LK QGN+  ++  YL+A  LY+ AI     N   Y NRAAA+  +   ++A+ D   +I
Sbjct: 132 TLKCQGNKAMQSNLYLEAVELYSFAIALTDKNAVFYCNRAAAYTQINMCSEAIKDCLKSI 191

Query: 317 SLKPDWEKGYFRKGCILEAMERYDEALD-AFQIALKHNP 430
            + P++ K Y R G    A  +Y EA++  F+ AL  +P
Sbjct: 192 EIDPNYSKAYSRLGLAYYAQGKYAEAIEKGFKKALLLDP 230



>pir|T46576|T46576 phosphoprotein phosphatase (EC 3.1.3.16) ppt-1
           [similarity] - Neurospora crassa>gb:NCB20D17_1689634
           Neurospora crassa DNA linkage group V BAC clone
           B20D17.>gb:NCU89985_1690714 Neurospora crassa
           serine/threonine protein phosphatase PPT1 (ppt-1) mRNA,
           complete cds.
          Length = 479

 Score = 60.8 bits (146), Expect = 8e-09
 Identities = 33/102 (32%), Positives = 54/102 (52%)
 Frame = +2

Query: 125 KREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADA 304
           ++ ++ K++GN+ F A ++ KA   Y +AI+ +   PT +SNRA A L       A+ DA
Sbjct: 6   EQAIAFKNEGNKAFAAHDWPKAIEFYDKAIELNDKEPTFWSNRAQAHLKTEAYGYAIRDA 65

Query: 305 EMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
              I L P + K Y+R+     A+    EA+  F+  +K  P
Sbjct: 66  TKAIELNPGFVKAYYRRATAYAAILNPKEAVKDFKTCVKIAP 107



>sp|P38825|YHR7_YEAST Hypothetical 71.9 kDa protein in ERP5-ORC6
           intergenic region.>pir|S48959|S48959 mitochondrial outer
           membrane protein TOM71 - yeast  (Saccharomyces
           cerevisiae)>gb:YSCH8263_1729099 Saccharomyces cerevisiae
           chromosome VIII cosmid 8263.
          Length = 639

 Score = 60.8 bits (146), Expect = 8e-09
 Identities = 29/88 (32%), Positives = 47/88 (53%)
 Frame = +2

Query: 134 VSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMT 313
           V LK++GN FF A N+ +A   Y  AI+ DP+ P  YSN +A ++    L K +      
Sbjct: 128 VQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKA 187

Query: 314 ISLKPDWEKGYFRKGCILEAMERYDEAL 397
           + +KPD  K   R+    E++  + +A+
Sbjct: 188 LEIKPDHSKALLRRASANESLGNFTDAM 215



>sp|Q863A4|DYX1_PONPY Dyslexia susceptibility 1 candidate gene 1
           protein homolog.>gb:AY178610S9_1937884 Pongo pygmaeus
           EKN1 (EKN1) gene, exon 10 and complete cds.
          Length = 420

 Score = 60.8 bits (146), Expect = 8e-09
 Identities = 39/105 (37%), Positives = 54/105 (51%), Gaps = 8/105 (7%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LKD+GN+ F   NYL A   Y  AI+ +   P LY NRAA  L L  L+KA+ D+   + 
Sbjct: 293 LKDKGNKLFATENYLAAINAYNLAIRLNNKMPLLYLNRAACHLKLKNLHKAIEDSSKALE 352

Query: 320 L--KPDWE------KGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L   P  +      K + R+G     +E Y E L  ++ ALK +P
Sbjct: 353 LLMPPVTDNANARMKAHVRRGTAFCQLELYVEGLQDYEAALKIDP 397



>sp|Q863A7|DYX1_PANTR Dyslexia susceptibility 1 candidate gene 1
           protein homolog.>gb:AY178583S9_1937881 Pan troglodytes
           EKN1 (EKN1) gene, exon 10 and complete cds.
          Length = 420

 Score = 60.8 bits (146), Expect = 8e-09
 Identities = 39/105 (37%), Positives = 54/105 (51%), Gaps = 8/105 (7%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LKD+GN+ F   NYL A   Y  AI+ +   P LY NRAA  L L  L+KA+ D+   + 
Sbjct: 293 LKDKGNKLFATENYLAAINAYNLAIRLNNKMPLLYLNRAACHLKLKNLHKAIEDSSKALE 352

Query: 320 L--KPDWE------KGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L   P  +      K + R+G     +E Y E L  ++ ALK +P
Sbjct: 353 LLMPPVTDNANARMKAHVRRGTAFCQLELYVEGLQDYEAALKIDP 397



>sp|Q863A6|DYX1_PANPA Dyslexia susceptibility 1 candidate gene 1
           protein homolog.>gb:AY178592S9_1937882 Pan paniscus EKN1
           (EKN1) gene, exon 10 and complete cds.
          Length = 420

 Score = 60.8 bits (146), Expect = 8e-09
 Identities = 39/105 (37%), Positives = 54/105 (51%), Gaps = 8/105 (7%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LKD+GN+ F   NYL A   Y  AI+ +   P LY NRAA  L L  L+KA+ D+   + 
Sbjct: 293 LKDKGNKLFATENYLAAINAYNLAIRLNNKMPLLYLNRAACHLKLKNLHKAIEDSSKALE 352

Query: 320 L--KPDWE------KGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L   P  +      K + R+G     +E Y E L  ++ ALK +P
Sbjct: 353 LLMPPVTDNANARMKAHVRRGTAFCQLELYVEGLQDYEAALKIDP 397



>sp|Q8WXU2|DYX1_HUMAN Dyslexia susceptibility 1 candidate gene 1
           protein.>gb:AF337549_1897357 Homo sapiens EKN1 (EKN1)
           mRNA, complete cds.
          Length = 420

 Score = 60.8 bits (146), Expect = 8e-09
 Identities = 39/105 (37%), Positives = 54/105 (51%), Gaps = 8/105 (7%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LKD+GN+ F   NYL A   Y  AI+ +   P LY NRAA  L L  L+KA+ D+   + 
Sbjct: 293 LKDKGNKLFATENYLAAINAYNLAIRLNNKMPLLYLNRAACHLKLKNLHKAIEDSSKALE 352

Query: 320 L--KPDWE------KGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L   P  +      K + R+G     +E Y E L  ++ ALK +P
Sbjct: 353 LLMPPVTDNANARMKAHVRRGTAFCQLELYVEGLQDYEAALKIDP 397



>sp|Q863A5|DYX1_GORGO Dyslexia susceptibility 1 candidate gene 1
           protein homolog.>gb:AY178601S9_1937883 Gorilla gorilla
           EKN1 (EKN1) gene, exon 10 and complete cds.
          Length = 420

 Score = 60.8 bits (146), Expect = 8e-09
 Identities = 39/105 (37%), Positives = 54/105 (51%), Gaps = 8/105 (7%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LKD+GN+ F   NYL A   Y  AI+ +   P LY NRAA  L L  L+KA+ D+   + 
Sbjct: 293 LKDKGNKLFATENYLAAINAYNLAIRLNNKMPLLYLNRAACHLKLKNLHKAIEDSSKALE 352

Query: 320 L--KPDWE------KGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L   P  +      K + R+G     +E Y E L  ++ ALK +P
Sbjct: 353 LLMPPVTDNANARMKAHVRRGTAFCQLELYVEGLQDYEAALKIDP 397



>gb:BC075517_2558618 Xenopus tropicalis DnaJ (Hsp40) homolog,
           subfamily C, member 7, mRNA (cDNA clone MGC:89403
           IMAGE:6989707), complete cds.
          Length = 493

 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 37/108 (34%), Positives = 55/108 (50%), Gaps = 4/108 (3%)
 Frame = +2

Query: 98  KTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSN----PTLYSNRAAAF 265
           K  +   +AK   + K++GN+ FK GNY  A  LY++A+  DP+N      LY NR    
Sbjct: 244 KARLACRNAKALKAKKEEGNQAFKDGNYDLAHRLYSEALCIDPNNIKTNAKLYCNRGTVN 303

Query: 266 LHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQ 409
             L KLN+A+ D    I L   + K Y R+       E Y+EA+  ++
Sbjct: 304 AKLKKLNEAIEDCTNAIKLDDTYIKAYLRRAQCYTDTELYEEAVRDYE 351



 Score = 54.7 bits (130), Expect = 6e-07
 Identities = 30/83 (36%), Positives = 48/83 (57%), Gaps = 1/83 (1%)
 Frame = +2

Query: 113 DSDAKREV-SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNK 289
           D + +RE  + K++GN F+   +Y +A   YT+AI     N + Y NRAA  + L K  +
Sbjct: 20  DEEREREAEACKEKGNVFYAKKDYNEAYNYYTKAIDWSRKNASYYGNRAATLMMLSKYRE 79

Query: 290 ALADAEMTISLKPDWEKGYFRKG 358
           AL DA+ ++ L   + KG+ R+G
Sbjct: 80  ALEDAQQSVRLDDAFVKGHQREG 102



>gb:BC065555_1986884 Homo sapiens translocase of outer mitochondrial
           membrane 70 homolog A (yeast), mRNA (cDNA clone
           MGC:75021 IMAGE:6067022), complete cds.
          Length = 607

 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 34/96 (35%), Positives = 49/96 (51%), Gaps = 5/96 (5%)
 Frame = +2

Query: 128 REVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNP-----TLYSNRAAAFLHLVKLNKA 292
           R  + K++GN++FKAG Y +A   YT+AI   P+       T Y NRAAAF  L K  + 
Sbjct: 112 RAQAAKNKGNKYFKAGKYEQAIQCYTEAISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEV 171

Query: 293 LADAEMTISLKPDWEKGYFRKGCILEAMERYDEALD 400
             D    + L P + K  FR+    E ++   E L+
Sbjct: 172 AQDCTKAVELNPKYVKALFRRAKAHEKLDNKKECLE 207



 Score = 32.0 bits (71), Expect = 3.8
 Identities = 24/94 (25%), Positives = 41/94 (43%), Gaps = 13/94 (13%)
 Frame = +2

Query: 89  LKGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQ-------------AIKKDPS 229
           L G       D  + +SLK+  N   +A   +K  ++Y Q             A   DP 
Sbjct: 340 LIGNANAAKPDLDKVISLKE-ANVKLRANALIKRGSMYMQQQQPLLSTQDFNMAADIDPQ 398

Query: 230 NPTLYSNRAAAFLHLVKLNKALADAEMTISLKPD 331
           N  +Y +R    + L ++ +A+AD +  I L+P+
Sbjct: 399 NADVYHHRGQLKILLDQVEEAVADFDECIRLRPE 432



>gb:AB018262_1864905 Homo sapiens mRNA for KIAA0719 protein, partial
           cds.
          Length = 624

 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 34/96 (35%), Positives = 49/96 (51%), Gaps = 5/96 (5%)
 Frame = +2

Query: 128 REVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNP-----TLYSNRAAAFLHLVKLNKA 292
           R  + K++GN++FKAG Y +A   YT+AI   P+       T Y NRAAAF  L K  + 
Sbjct: 129 RAQAAKNKGNKYFKAGKYEQAIQCYTEAISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEV 188

Query: 293 LADAEMTISLKPDWEKGYFRKGCILEAMERYDEALD 400
             D    + L P + K  FR+    E ++   E L+
Sbjct: 189 AQDCTKAVELNPKYVKALFRRAKAHEKLDNKKECLE 224



 Score = 32.0 bits (71), Expect = 3.8
 Identities = 24/94 (25%), Positives = 41/94 (43%), Gaps = 13/94 (13%)
 Frame = +2

Query: 89  LKGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQ-------------AIKKDPS 229
           L G       D  + +SLK+  N   +A   +K  ++Y Q             A   DP 
Sbjct: 357 LIGNANAAKPDLDKVISLKE-ANVKLRANALIKRGSMYMQQQQPLLSTQDFNMAADIDPQ 415

Query: 230 NPTLYSNRAAAFLHLVKLNKALADAEMTISLKPD 331
           N  +Y +R    + L ++ +A+AD +  I L+P+
Sbjct: 416 NADVYHHRGQLKILLDQVEEAVADFDECIRLRPE 449



>gb:AP004119_1837859 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1288_G09.>gb:AP005012_1847256 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, PAC
           clone:P0627E03.
          Length = 217

 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 29/103 (28%), Positives = 54/103 (52%)
 Frame = +2

Query: 122 AKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALAD 301
           AK   S + +GN+ FKA  + +A A Y + + ++  N  L  NRAA    L +  KA+ D
Sbjct: 85  AKVVASARLRGNDLFKASRFAEACAAYCEGLDRETGNAVLLCNRAACHARLARYEKAVED 144

Query: 302 AEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
               ++++P + K   R+      +ER++ +L  +Q+ ++  P
Sbjct: 145 CNGALAMRPAYSKARLRRADCNVKLERWEASLRDYQVLIQELP 187



>gb:AF192467_1775516 Oryza sativa Sgt1 (Sgt1) mRNA, complete cds.
          Length = 367

 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 33/91 (36%), Positives = 47/91 (51%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           L+ +    F   ++  AA LYTQAI+  P+   LY++RA A + L    +A+ADA   I 
Sbjct: 9   LESKAKAAFVDDDFELAAELYTQAIEASPATAELYADRAQAHIKLGNYTEAVADANKAIE 68

Query: 320 LKPDWEKGYFRKGCILEAMERYDEALDAFQI 412
           L P   K Y RKG     +E Y  A  A ++
Sbjct: 69  LDPSMHKAYLRKGAACIRLEEYQTAKAALEL 99



 Score = 33.9 bits (76), Expect = 1.0
 Identities = 20/58 (34%), Positives = 28/58 (48%)
 Frame = +2

Query: 146 DQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           D+     K GNY +A A   +AI+ DPS    Y  + AA + L +   A A  E+  S
Sbjct: 45  DRAQAHIKLGNYTEAVADANKAIELDPSMHKAYLRKGAACIRLEEYQTAKAALELGYS 102



>gb:BT003919_1637044 Arabidopsis thaliana clone RAFL15-17-L17
           (R20677) unknown protein (At3g58620) mRNA, complete
           cds.>gb:BT005006_1637952 Arabidopsis thaliana clone
           U20677 unknown protein (At3g58620) mRNA, complete cds.
          Length = 682

 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 28/105 (26%), Positives = 52/105 (49%)
 Frame = +2

Query: 116 SDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKAL 295
           ++ K     + +GNE F +G Y +A+  Y   +K D  N  LY NRAA +  L    K++
Sbjct: 444 NNVKNVAKARTRGNELFSSGRYSEASVAYGDGLKLDAFNSVLYCNRAACWFKLGMWEKSV 503

Query: 296 ADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            D    + ++P + K   R+      + R+++A+  +++  K  P
Sbjct: 504 DDCNQALRIQPSYTKALLRRAASYGKLGRWEDAVRDYEVLRKELP 548



 Score = 52.0 bits (123), Expect = 4e-06
 Identities = 29/87 (33%), Positives = 43/87 (49%)
 Frame = +2

Query: 92  KGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLH 271
           K    M DS+      +K  GN  ++ GNY +A ALY +AI   P NP   SNRAAA   
Sbjct: 203 KAAAEMSDSE-----EVKKAGNVMYRKGNYAEALALYDRAISLSPENPAYRSNRAAALAA 257

Query: 272 LVKLNKALADAEMTISLKPDWEKGYFR 352
             +L +A+ +    +   P + + + R
Sbjct: 258 SGRLEEAVKECLEAVRCDPSYARAHQR 284



>pir|T45682|T45682 hypothetical protein F14P22.210 - Arabidopsis
           thaliana>gb:ATF14P22_1548630 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F14P22.
          Length = 677

 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 28/105 (26%), Positives = 52/105 (49%)
 Frame = +2

Query: 116 SDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKAL 295
           ++ K     + +GNE F +G Y +A+  Y   +K D  N  LY NRAA +  L    K++
Sbjct: 444 NNVKNVAKARTRGNELFSSGRYSEASVAYGDGLKLDAFNSVLYCNRAACWFKLGMWEKSV 503

Query: 296 ADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            D    + ++P + K   R+      + R+++A+  +++  K  P
Sbjct: 504 DDCNQALRIQPSYTKALLRRAASYGKLGRWEDAVRDYEVLRKELP 548



 Score = 52.0 bits (123), Expect = 4e-06
 Identities = 29/87 (33%), Positives = 43/87 (49%)
 Frame = +2

Query: 92  KGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLH 271
           K    M DS+      +K  GN  ++ GNY +A ALY +AI   P NP   SNRAAA   
Sbjct: 203 KAAAEMSDSE-----EVKKAGNVMYRKGNYAEALALYDRAISLSPENPAYRSNRAAALAA 257

Query: 272 LVKLNKALADAEMTISLKPDWEKGYFR 352
             +L +A+ +    +   P + + + R
Sbjct: 258 SGRLEEAVKECLEAVRCDPSYARAHQR 284



>sp|O94826|OM70_HUMAN Mitochondrial precursor proteins import
           receptor (Translocase of outer membrane
           TOM70).>gb:BC003633_1968943 Homo sapiens translocase of
           outer mitochondrial membrane 70 homolog A (yeast), mRNA
           (cDNA clone MGC:3766 IMAGE:3605218), complete
           cds.>gb:BC052994_1984908 Homo sapiens translocase of
           outer mitochondrial membrane 70 homolog A (yeast), mRNA
           (cDNA clone MGC:60332 IMAGE:5549394), complete cds.
          Length = 608

 Score = 60.5 bits (145), Expect = 1e-08
 Identities = 34/96 (35%), Positives = 49/96 (51%), Gaps = 5/96 (5%)
 Frame = +2

Query: 128 REVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNP-----TLYSNRAAAFLHLVKLNKA 292
           R  + K++GN++FKAG Y +A   YT+AI   P+       T Y NRAAAF  L K  + 
Sbjct: 113 RAQAAKNKGNKYFKAGKYEQAIQCYTEAISLCPTEKNVDLSTFYQNRAAAFEQLQKWKEV 172

Query: 293 LADAEMTISLKPDWEKGYFRKGCILEAMERYDEALD 400
             D    + L P + K  FR+    E ++   E L+
Sbjct: 173 AQDCTKAVELNPKYVKALFRRAKAHEKLDNKKECLE 208



 Score = 32.0 bits (71), Expect = 3.8
 Identities = 24/94 (25%), Positives = 41/94 (43%), Gaps = 13/94 (13%)
 Frame = +2

Query: 89  LKGKTTMGDSDAKREVSLKDQGNEFFKAGNYLKAAALYTQ-------------AIKKDPS 229
           L G       D  + +SLK+  N   +A   +K  ++Y Q             A   DP 
Sbjct: 341 LIGNANAAKPDLDKVISLKE-ANVKLRANALIKRGSMYMQQQQPLLSTQDFNMAADIDPQ 399

Query: 230 NPTLYSNRAAAFLHLVKLNKALADAEMTISLKPD 331
           N  +Y +R    + L ++ +A+AD +  I L+P+
Sbjct: 400 NADVYHHRGQLKILLDQVEEAVADFDECIRLRPE 433



>gb:AY464142_2085482 Mus musculus EKN1 splice variant mRNA, complete
           cds, alternatively spliced.
          Length = 300

 Score = 60.1 bits (144), Expect = 1e-08
 Identities = 38/105 (36%), Positives = 52/105 (49%), Gaps = 8/105 (7%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LKD+GN+ F   NYL A   Y  AI+ +   P LY NRAA  L L  L+KA+ D+   + 
Sbjct: 171 LKDKGNKLFATENYLAAVDAYNLAIRLNCKIPLLYLNRAACHLKLKNLHKAIEDSSKALE 230

Query: 320 LKPD--------WEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L             K + R+G     +E Y E L  ++ ALK +P
Sbjct: 231 LLTPPVADNANARMKAHVRRGTAFCQLELYVEGLQDYEAALKIDP 275



>gb:AY428507_2084919 Mus musculus EKN1 mRNA, complete cds,
           alternatively spliced.
          Length = 420

 Score = 60.1 bits (144), Expect = 1e-08
 Identities = 38/105 (36%), Positives = 52/105 (49%), Gaps = 8/105 (7%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LKD+GN+ F   NYL A   Y  AI+ +   P LY NRAA  L L  L+KA+ D+   + 
Sbjct: 291 LKDKGNKLFATENYLAAVDAYNLAIRLNCKIPLLYLNRAACHLKLKNLHKAIEDSSKALE 350

Query: 320 LKPD--------WEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L             K + R+G     +E Y E L  ++ ALK +P
Sbjct: 351 LLTPPVADNANARMKAHVRRGTAFCQLELYVEGLQDYEAALKIDP 395



>gb:D83327_1994975 Homo sapiens DCRR1 mRNA, partial cds.
          Length = 1941

 Score = 60.1 bits (144), Expect = 1e-08
 Identities = 40/108 (37%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = +2

Query: 83  NFLKGKTTMGDSDAKREVSL-KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAA 259
           N L+   T    D   E  L K +GNE F    +  A   YT+AI+  P N  LY NRA 
Sbjct: 130 NLLEELKTQSCMDCIEEGELMKMKGNEEFSKERFDIAIIYYTRAIEYRPENYLLYGNRAL 189

Query: 260 AFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDA 403
            FL   +   AL D +    LK  W KG++R    L  +  YD AL A
Sbjct: 190 CFLRTGQFRNALGDGKRATILKNTWPKGHYRYCDALSMLGEYDWALQA 237



>gb:BC063033_1986085 Homo sapiens tetratricopeptide repeat domain 3,
           mRNA (cDNA clone IMAGE:4525077), partial cds.
          Length = 782

 Score = 60.1 bits (144), Expect = 1e-08
 Identities = 40/108 (37%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = +2

Query: 83  NFLKGKTTMGDSDAKREVSL-KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAA 259
           N L+   T    D   E  L K +GNE F    +  A   YT+AI+  P N  LY NRA 
Sbjct: 214 NLLEELKTQSCMDCIEEGELMKMKGNEEFSKERFDIAIIYYTRAIEYRPENYLLYGNRAL 273

Query: 260 AFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDA 403
            FL   +   AL D +    LK  W KG++R    L  +  YD AL A
Sbjct: 274 CFLRTGQFRNALGDGKRATILKNTWPKGHYRYCDALSMLGEYDWALQA 321



>gb:AF039689_1878196 Homo sapiens antigen NY-CO-7 (NY-CO-7) mRNA,
           complete cds.
          Length = 303

 Score = 60.1 bits (144), Expect = 1e-08
 Identities = 38/93 (40%), Positives = 51/93 (54%), Gaps = 1/93 (1%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK+QGN  F    Y +AAA Y +AI ++P     Y+NRA  +L + +  +ALAD    + 
Sbjct: 29  LKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALE 88

Query: 320 LKPDWEKGYFRKG-CILEAMERYDEALDAFQIA 415
           L     K +F  G C LE ME YDEA+   Q A
Sbjct: 89  LDGQSVKAHFFLGQCQLE-MESYDEAIANLQRA 120



>gb:AE006464_1875625 Homo sapiens 16p13.3 sequence section 3 of
           8.>gb:AF432221_1902042 Homo sapiens CLL-associated
           antigen KW-8 mRNA, complete cds.>gb:BC007545_1970801
           Homo sapiens STIP1 homology and U-box containing protein
           1, mRNA (cDNA clone MGC:15444 IMAGE:2959735), complete
           cds.>gb:BC017178_1975936 Homo sapiens STIP1 homology and
           U-box containing protein 1, mRNA (cDNA clone MGC:1397
           IMAGE:3346811), complete cds.>gb:BC022788_1977975 Homo
           sapiens STIP1 homology and U-box containing protein 1,
           mRNA (cDNA clone MGC:15443 IMAGE:2959735), complete
           cds.>gb:BC063617_1986289 Homo sapiens STIP1 homology and
           U-box containing protein 1, mRNA (cDNA clone MGC:70877
           IMAGE:3847168), complete cds.
          Length = 303

 Score = 60.1 bits (144), Expect = 1e-08
 Identities = 38/93 (40%), Positives = 51/93 (54%), Gaps = 1/93 (1%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK+QGN  F    Y +AAA Y +AI ++P     Y+NRA  +L + +  +ALAD    + 
Sbjct: 29  LKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALE 88

Query: 320 LKPDWEKGYFRKG-CILEAMERYDEALDAFQIA 415
           L     K +F  G C LE ME YDEA+   Q A
Sbjct: 89  LDGQSVKAHFFLGQCQLE-MESYDEAIANLQRA 120



>gb:AY144871_1583662 Saccharomyces bayanus clone Contig2068 TOM71
           gene, partial cds.
          Length = 595

 Score = 60.1 bits (144), Expect = 1e-08
 Identities = 29/88 (32%), Positives = 48/88 (54%)
 Frame = +2

Query: 134 VSLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMT 313
           V LKD+GN FF A ++  A   Y  AI+ DP++P  YSN +A ++    L+K +      
Sbjct: 132 VQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKA 191

Query: 314 ISLKPDWEKGYFRKGCILEAMERYDEAL 397
           + +KPD  K   R+    E++  + +A+
Sbjct: 192 LEIKPDHSKALLRRASANESLGNFTDAM 219



>gb:AB013395_1512162 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MQN23.>gb:BT015361_1642189 Arabidopsis thaliana
           At5g65160 gene, complete cds.>gb:BT015891_1642509
           Arabidopsis thaliana At5g65160 gene, complete cds.
          Length = 593

 Score = 60.1 bits (144), Expect = 1e-08
 Identities = 29/94 (30%), Positives = 52/94 (55%)
 Frame = +2

Query: 149 QGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTISLKP 328
           +GNE FK+G + +A A Y + +  DP N  L  NRAA    L + +K++ D    +S++P
Sbjct: 476 KGNELFKSGRFQEACAAYGEGLDHDPRNSVLLCNRAACRSKLGQFDKSIEDCTAALSVRP 535

Query: 329 DWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
            + K   R+      +E+++ A+  ++I  K +P
Sbjct: 536 GYGKARLRRADCNAKIEKWELAVGDYEILKKESP 569



 Score = 51.2 bits (121), Expect = 6e-06
 Identities = 27/91 (29%), Positives = 50/91 (54%)
 Frame = +2

Query: 137 SLKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTI 316
           +LK  GNE +K GN+ +A ALY  AI  DP+     SN++AA   L ++  A+ +    I
Sbjct: 238 TLKIMGNEDYKNGNFAEALALYDAAIAIDPNKAAYRSNKSAALTALGRILDAVFECREAI 297

Query: 317 SLKPDWEKGYFRKGCILEAMERYDEALDAFQ 409
            ++P + + + R G +   +   ++++  F+
Sbjct: 298 RIEPHYHRAHHRLGNLYLRLGEVEKSIYHFK 328



>gb:AK005832_1153253 Mus musculus adult male testis cDNA, RIKEN
           full-length enriched library, clone:1700010I24
           product:EKN1 homolog [Homo sapiens], full insert
           sequence.>gb:AK015345_1158353 Mus musculus adult male
           testis cDNA, RIKEN full-length enriched library,
           clone:4930439O17 product:EKN1 homolog [Homo sapiens],
           full insert sequence.
          Length = 150

 Score = 60.1 bits (144), Expect = 1e-08
 Identities = 38/105 (36%), Positives = 52/105 (49%), Gaps = 8/105 (7%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LKD+GN+ F   NYL A   Y  AI+ +   P LY NRAA  L L  L+KA+ D+   + 
Sbjct: 21  LKDKGNKLFATENYLAAVDAYNLAIRLNCKIPLLYLNRAACHLKLKNLHKAIEDSSKALE 80

Query: 320 LKPD--------WEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L             K + R+G     +E Y E L  ++ ALK +P
Sbjct: 81  LLTPPVADNANARMKAHVRRGTAFCQLELYVEGLQDYEAALKIDP 125



>gb:AK004464_1152361 Mus musculus 18-day embryo whole body cDNA,
           RIKEN full-length enriched library, clone:1190003C14
           product:STIP1 homology and U-Box containing protein 1,
           full insert sequence.>gb:AK045776_1167536 Mus musculus
           adult male corpora quadrigemina cDNA, RIKEN full-length
           enriched library, clone:B230310J16 product:STIP1
           homology and U-Box containing protein 1, full insert
           sequence.>gb:AF129086_2055642 Mus musculus carboxy
           terminus of Hsp70-interacting protein (Chip) mRNA,
           complete cds.>gb:BC027427_2095976 Mus musculus STIP1
           homology and U-Box containing protein 1, mRNA (cDNA
           clone MGC:35920 IMAGE:4191866), complete
           cds.>gb:BC038939_2098343 Mus musculus STIP1 homology and
           U-Box containing protein 1, mRNA (cDNA clone MGC:46850
           IMAGE:2598940), complete cds.
          Length = 304

 Score = 60.1 bits (144), Expect = 1e-08
 Identities = 38/93 (40%), Positives = 51/93 (54%), Gaps = 1/93 (1%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK+QGN  F    Y +AAA Y +AI ++P     Y+NRA  +L + +  +ALAD    + 
Sbjct: 30  LKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALE 89

Query: 320 LKPDWEKGYFRKG-CILEAMERYDEALDAFQIA 415
           L     K +F  G C LE ME YDEA+   Q A
Sbjct: 90  LDGQSVKAHFFLGQCQLE-MESYDEAIANLQRA 121



>gb:AK002752_1151419 Mus musculus adult male kidney cDNA, RIKEN
           full-length enriched library, clone:0610033N24
           product:STIP1 homology and U-Box containing protein 1,
           full insert sequence.
          Length = 304

 Score = 60.1 bits (144), Expect = 1e-08
 Identities = 38/93 (40%), Positives = 51/93 (54%), Gaps = 1/93 (1%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LK+QGN  F    Y +AAA Y +AI ++P     Y+NRA  +L + +  +ALAD    + 
Sbjct: 30  LKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALE 89

Query: 320 LKPDWEKGYFRKG-CILEAMERYDEALDAFQIA 415
           L     K +F  G C LE ME YDEA+   Q A
Sbjct: 90  LDGQSVKAHFFLGQCQLE-MESYDEAIANLQRA 121



>sp|P53804|TTC3_HUMAN Tetratricopeptide repeat protein 3 (TPR repeat
           protein D).>pir|JC5020|JC5020 tetratricopeptide repeat
           protein - human>gb:D84294_1995027 Human mRNA for TPRDI,
           complete cds.>gb:HUMTPRD_2037845 Homo sapiens mRNA for
           TPRD, complete cds.
          Length = 2025

 Score = 60.1 bits (144), Expect = 1e-08
 Identities = 40/108 (37%), Positives = 50/108 (46%), Gaps = 1/108 (0%)
 Frame = +2

Query: 83  NFLKGKTTMGDSDAKREVSL-KDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAA 259
           N L+   T    D   E  L K +GNE F    +  A   YT+AI+  P N  LY NRA 
Sbjct: 214 NLLEELKTQSCMDCIEEGELMKMKGNEEFSKERFDIAIIYYTRAIEYRPENYLLYGNRAL 273

Query: 260 AFLHLVKLNKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDA 403
            FL   +   AL D +    LK  W KG++R    L  +  YD AL A
Sbjct: 274 CFLRTGQFRNALGDGKRATILKNTWPKGHYRYCDALSMLGEYDWALQA 321



>sp|Q8R368|DYX1_MOUSE Dyslexia susceptibility 1 candidate gene 1
           protein homolog.>gb:BC026462_2095347 Mus musculus
           dyslexia susceptibility 1 candidate 1 homolog (human),
           mRNA (cDNA clone MGC:31465 IMAGE:4483015), complete cds.
          Length = 420

 Score = 60.1 bits (144), Expect = 1e-08
 Identities = 38/105 (36%), Positives = 52/105 (49%), Gaps = 8/105 (7%)
 Frame = +2

Query: 140 LKDQGNEFFKAGNYLKAAALYTQAIKKDPSNPTLYSNRAAAFLHLVKLNKALADAEMTIS 319
           LKD+GN+ F   NYL A   Y  AI+ +   P LY NRAA  L L  L+KA+ D+   + 
Sbjct: 291 LKDKGNKLFATENYLAAVDAYNLAIRLNCKIPLLYLNRAACHLKLKNLHKAIEDSSKALE 350

Query: 320 LKPD--------WEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
           L             K + R+G     +E Y E L  ++ ALK +P
Sbjct: 351 LLTPPVADNANARMKAHVRRGTAFCQLELYVEGLQDYEAALKIDP 395



>gb:AP005563_1854107 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OJ1227_D07.
          Length = 376

 Score = 59.7 bits (143), Expect = 2e-08
 Identities = 37/109 (33%), Positives = 54/109 (49%), Gaps = 3/109 (2%)
 Frame = +2

Query: 113 DSDAKREVSLKDQGNEFFKAGNYLKAAALYTQAIKKDPS---NPTLYSNRAAAFLHLVKL 283
           D   ++   LK Q  E F+  +Y  A   YT AI+   S     TL +NR+  +L L   
Sbjct: 243 DLSKRKSAELKLQAREAFERNDYALAVQHYTNAIELSTSAHDKATLLANRSLCWLRLSTG 302

Query: 284 NKALADAEMTISLKPDWEKGYFRKGCILEAMERYDEALDAFQIALKHNP 430
             A+ADA M   L+P W K  +R+G     ++ Y +A +AF   LK +P
Sbjct: 303 IGAIADANMCRMLRPSWPKACYRQGAAFMFIKDYGKACEAFADGLKLDP 351


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 406,324,225
Number of Sequences: 1806583
Number of extensions: 7620124
Number of successful extensions: 23746
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 21854
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 23416
length of database: 581,917,975
effective HSP length: 106
effective length of database: 390,420,177
effective search space used: 14445546549
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)