BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig4792
         (820 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY800655_1628603 Arabidopsis thaliana clone H0000001203 hypot...   143   4e-33   
gb:AB013389_1512064 Arabidopsis thaliana genomic DNA, chromosome...   143   4e-33   
gb:AK118076_1816076 Arabidopsis thaliana At2g23700 mRNA for unkn...   130   4e-29   
gb:AC004482_1531763 Arabidopsis thaliana chromosome 2 clone F27L...   130   4e-29   
pir|T02421|T02421 hypothetical protein At2g23700 [imported] - Ar...   117   2e-25   Arabidopsis thaliana [mouse-ear cress]
gb:AC103891_1737303 Oryza sativa (japonica cultivar-group) chrom...   104   2e-21   
gb:AC107207_1738368 Oryza sativa chromosome 3 BAC OSJNBb0106M04 ...    96   8e-19   
gb:AY206499_1589526 Antirrhinum majus putative ternary complex f...    93   7e-18   
pir|E86343|E86343 T22I11.12 protein - Arabidopsis thaliana>gb:AE...    59   1e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AB018117_1513867 Arabidopsis thaliana genomic DNA, chromosome...    58   2e-07   
gb:AP002039_1821570 Arabidopsis thaliana genomic DNA, chromosome...    54   5e-06   
gb:AY060575_1564881 Arabidopsis thaliana At1g76620/F14G6_22 mRNA...    53   8e-06   
pir|D96794|D96794 unknown protein F14G6.22 [imported] - Arabidop...    53   8e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1023816 Oryza sativa (japonica cultivar-group) chrom...    52   2e-05   
gb:AP004761_1844584 Oryza sativa (japonica cultivar-group) genom...    42   0.014   
gb:AY600521_1617283 Arabidopsis thaliana hypothetical protein (A...    41   0.031   
gb:AY600520_1617282 Arabidopsis thaliana hypothetical protein (A...    41   0.031   
gb:AY600519_1617281 Arabidopsis thaliana hypothetical protein (A...    41   0.031   
gb:AC068324_1540374 Arabidopsis thaliana chromosome 1 BAC F13A11...    41   0.031   
pir|A86303|A86303 hypothetical protein F17F16.4 - Arabidopsis th...    40   0.040   Arabidopsis thaliana [mouse-ear cress]
gb:AY126989_1580446 Arabidopsis thaliana At1g16750/F19K19_26 mRN...    39   0.12    
gb:AY075621_1567765 Arabidopsis thaliana AT4g37080/C7A10_280 mRN...    39   0.15    
pir|A85438|A85438 hypothetical protein AT4g37080 [imported] - Ar...    39   0.15    Arabidopsis thaliana [mouse-ear cress]
gb:AP004154_1838283 Oryza sativa (japonica cultivar-group) genom...    38   0.20    
gb:AB026645_1517173 Arabidopsis thaliana genomic DNA, chromosome...    38   0.20    
pir|G96497|G96497 hypothetical protein F2H10.4 [imported] - Arab...    38   0.26    Arabidopsis thaliana [mouse-ear cress]
gb:AB007647_1510178 Arabidopsis thaliana genomic DNA, chromosome...    37   0.34    
gb:CR382121_1654598 Kluyveromyces lactis strain NRRL Y-1140 chro...    36   0.99    
gb:AY454095_1327715 Plasmodium vivax isolate SalI merozoite surf...    35   1.3     
gb:AY454082_1327702 Plasmodium vivax isolate Br69 merozoite surf...    35   1.3     
gb:BC066506_2554393 Danio rerio zgc:55951, mRNA (cDNA clone MGC:...    35   2.2     
gb:AP005678_1855845 Oryza sativa (japonica cultivar-group) genom...    35   2.2     
gb:GGU43502_2573658 Gallus gallus insulin receptor substrate 1 (...    34   2.9     
gb:AP005755_1857276 Oryza sativa (japonica cultivar-group) genom...    34   2.9     
gb:AF209743_1251167 Drosophila melanogaster XPC-like protein (mu...    34   2.9     
gb:AE013599_1131985 Drosophila melanogaster chromosome 2R, compl...    34   2.9     
gb:AE013599_1131984 Drosophila melanogaster chromosome 2R, compl...    34   2.9     
pir|JC5209|JC5209 insulin receptor substrate 1 - chicken               34   2.9     Gallus gallus [bantam]
gb:AY231828_1177121 Drosophila yakuba clone yak-em_GM130 mRNA se...    34   3.8     
gb:AY454096_1327716 Plasmodium vivax isolate SL merozoite surfac...    33   4.9     
gb:AP006618_557889 Nocardia farcinica IFM 10152 DNA, complete ge...    33   4.9     
sp|Q8HZ58|HCR_PONPY|HCR_PONPY Alpha helical coiled-coil rod protein.>gb:AY...    33   4.9     Pongo pygmaeus [orang utan]
gb:CTR399534_2397847 Citrus tristeza virus (CTV) partial mRNA fo...    33   6.4     
gb:BC088245_2110440 Rattus norvegicus cDNA clone IMAGE:7368069, ...    33   6.4     
gb:CR457227_1993434 Homo sapiens full open reading frame cDNA cl...    33   6.4     
gb:AL662844_1931714 Human DNA sequence from clone XXbac-299F13 o...    33   6.4     
gb:AL662833_1931665 Human DNA sequence from clone XXbac-101P6 on...    33   6.4     
gb:AL662833_1931664 Human DNA sequence from clone XXbac-101P6 on...    33   6.4     
gb:AK000533_1907983 Homo sapiens cDNA FLJ20526 fis, clone KAT10627.    33   6.4     
gb:AK000217_1907763 Homo sapiens cDNA FLJ20210 fis, clone COLF1787.    33   6.4     
gb:AF216493_1890465 Homo sapiens a-helical protein (HCR) mRNA, c...    33   6.4     
gb:AB112474_1873701 Homo sapiens SBP mRNA for StAR protein bindi...    33   6.4     
gb:AB029343_1865911 Homo sapiens HCR (a-helix coiled-coil rod ho...    33   6.4     
gb:AB029331_1865910 Homo sapiens HCR (a-helix coiled-coil rod ho...    33   6.4     
sp|Q8HZ60|HCR_PANTR|HCR_PANTR Alpha helical coiled-coil rod protein.>gb:AY...    33   6.4     Pan troglodytes
sp|Q8HZ57|HCR_PANPA|HCR_PANPA Alpha helical coiled-coil rod protein.>gb:AY...    33   6.4     Pan paniscus [bonobo]
sp|Q8TD31|HCR_HUMAN|HCR_HUMAN Alpha helical coiled-coil rod protein (Putat...    33   6.4     Homo sapiens [man]
sp|Q8HZ59|HCR_GORGO|HCR_GORGO Alpha helical coiled-coil rod protein.>gb:AY...    33   6.4     Gorilla gorilla gorilla [lowland gorilla]
gb:ARMIL2_2143484 Artificial mouse mIL2 gene for interleukin 2.        33   8.4     
gb:AB128049_1873956 Macaca mulatta genes, MHC class I region, pa...    33   8.4     
gb:LMFL7069_1388340 Leishmania major Friedlin chromosome 21 cosm...    33   8.4     
pir|T05193|T05193 hypothetical protein F4I10.60 - Arabidopsis th...    33   8.4     Arabidopsis thaliana [mouse-ear cress]
sp|P04351|IL2_MOUSE|IL2_MOUSE Interleukin-2 precursor (IL-2) (T-cell growt...    33   8.4     Mus musculus [mouse]


>gb:AY800655_1628603 Arabidopsis thaliana clone H0000001203
           hypothetical protein (AT5G66600) mRNA, complete cds.
          Length = 614

 Score =  143 bits (360), Expect = 4e-33
 Identities = 92/164 (56%), Positives = 111/164 (67%), Gaps = 7/164 (4%)
 Frame = +2

Query: 350 HKRSKS--FPDSVKT-GHDSFRCSPEASPELKLDMEHSDDCFESKKKQSSTAEVQSSLTQ 520
           HKRSKS  FP+  +  G  +   S EAS  +KLDM  S+   ESK  Q  +   ++SL Q
Sbjct: 21  HKRSKSASFPEKKRVEGDKTSNSSHEASQRMKLDMGRSN---ESKHNQYHS-NTETSLKQ 76

Query: 521 EIMQLEKRLQTQVAVRCALEKALGYRSTCQKTADE---ISIPKPATELIREIAVLEFEVG 691
           EI  LE RLQ Q  VRCALEKALGYR+       E   I++PKPAT+LI+++AVLE EV 
Sbjct: 77  EITHLETRLQDQFKVRCALEKALGYRTASSYVLTETNDIAMPKPATDLIKDVAVLEMEVI 136

Query: 692 HLEQYLLSLYRKAFDQQISTSSPSRIDDKLKS-LVGTPRRRLDF 820
           HLEQYLLSLYRKAF+QQIS+ SP+  + K KS  V TPRRRLDF
Sbjct: 137 HLEQYLLSLYRKAFEQQISSVSPNLENKKPKSPPVTTPRRRLDF 180



>gb:AB013389_1512064 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K1F13.
          Length = 614

 Score =  143 bits (360), Expect = 4e-33
 Identities = 92/164 (56%), Positives = 111/164 (67%), Gaps = 7/164 (4%)
 Frame = +2

Query: 350 HKRSKS--FPDSVKT-GHDSFRCSPEASPELKLDMEHSDDCFESKKKQSSTAEVQSSLTQ 520
           HKRSKS  FP+  +  G  +   S EAS  +KLDM  S+   ESK  Q  +   ++SL Q
Sbjct: 21  HKRSKSASFPEKKRVEGDKTSNSSHEASQRMKLDMGRSN---ESKHNQYHS-NTETSLKQ 76

Query: 521 EIMQLEKRLQTQVAVRCALEKALGYRSTCQKTADE---ISIPKPATELIREIAVLEFEVG 691
           EI  LE RLQ Q  VRCALEKALGYR+       E   I++PKPAT+LI+++AVLE EV 
Sbjct: 77  EITHLETRLQDQFKVRCALEKALGYRTASSYVLTETNDIAMPKPATDLIKDVAVLEMEVI 136

Query: 692 HLEQYLLSLYRKAFDQQISTSSPSRIDDKLKS-LVGTPRRRLDF 820
           HLEQYLLSLYRKAF+QQIS+ SP+  + K KS  V TPRRRLDF
Sbjct: 137 HLEQYLLSLYRKAFEQQISSVSPNLENKKPKSPPVTTPRRRLDF 180



>gb:AK118076_1816076 Arabidopsis thaliana At2g23700 mRNA for unknown
           protein, complete cds, clone: RAFL19-32-K14.
          Length = 707

 Score =  130 bits (326), Expect = 4e-29
 Identities = 81/141 (57%), Positives = 94/141 (66%), Gaps = 4/141 (2%)
 Frame = +2

Query: 350 HKRSKS--FPDSVKT-GHDSFRCSPEASPELKLDMEH-SDDCFESKKKQSSTAEVQSSLT 517
           HKRSKS   P+  K    +S   S +AS  LKLD+    D  FE KK  S   + +SSL 
Sbjct: 13  HKRSKSCTVPEKKKLEDENSIDSSLDASQRLKLDLPRCGDKSFEMKKDLSPDVKFKSSLK 72

Query: 518 QEIMQLEKRLQTQVAVRCALEKALGYRSTCQKTADEISIPKPATELIREIAVLEFEVGHL 697
           QEI +LEKRLQ Q  VR ALEKALGY++  +    + S PKP TELI+EIAVLE EV HL
Sbjct: 73  QEIQELEKRLQNQFDVRGALEKALGYKTPSRDIKGD-STPKPPTELIKEIAVLELEVSHL 131

Query: 698 EQYLLSLYRKAFDQQISTSSP 760
           EQYLLSLYRKAFDQQ S+ SP
Sbjct: 132 EQYLLSLYRKAFDQQTSSVSP 152



>gb:AC004482_1531763 Arabidopsis thaliana chromosome 2 clone F27L4
           map CIC06C07, complete sequence.
          Length = 707

 Score =  130 bits (326), Expect = 4e-29
 Identities = 81/141 (57%), Positives = 94/141 (66%), Gaps = 4/141 (2%)
 Frame = +2

Query: 350 HKRSKS--FPDSVKT-GHDSFRCSPEASPELKLDMEH-SDDCFESKKKQSSTAEVQSSLT 517
           HKRSKS   P+  K    +S   S +AS  LKLD+    D  FE KK  S   + +SSL 
Sbjct: 13  HKRSKSCTVPEKKKLEDENSIDSSLDASQRLKLDLPRCGDKSFEMKKDLSPDVKFKSSLK 72

Query: 518 QEIMQLEKRLQTQVAVRCALEKALGYRSTCQKTADEISIPKPATELIREIAVLEFEVGHL 697
           QEI +LEKRLQ Q  VR ALEKALGY++  +    + S PKP TELI+EIAVLE EV HL
Sbjct: 73  QEIQELEKRLQNQFDVRGALEKALGYKTPSRDIKGD-STPKPPTELIKEIAVLELEVSHL 131

Query: 698 EQYLLSLYRKAFDQQISTSSP 760
           EQYLLSLYRKAFDQQ S+ SP
Sbjct: 132 EQYLLSLYRKAFDQQTSSVSP 152



>pir|T02421|T02421 hypothetical protein At2g23700 [imported] -
           Arabidopsis thaliana
          Length = 722

 Score =  117 bits (294), Expect = 2e-25
 Identities = 78/155 (50%), Positives = 93/155 (60%), Gaps = 18/155 (11%)
 Frame = +2

Query: 350 HKRSKS--FPDSVKT-GHDSFRCSPEASPELKLDMEH-SDDCFESKKKQSSTAEVQSSLT 517
           HKRSKS   P+  K    +S   S +AS  LKLD+    D  FE KK  S   + +SSL 
Sbjct: 13  HKRSKSCTVPEKKKLEDENSIDSSLDASQRLKLDLPRCGDKSFEMKKDLSPDVKFKSSLK 72

Query: 518 QE--------------IMQLEKRLQTQVAVRCALEKALGYRSTCQKTADEISIPKPATEL 655
           QE              I +LEKRLQ Q  VR ALEKALGY++  +    + +  +P TEL
Sbjct: 73  QESKIICLIHIVGYIQIQELEKRLQNQFDVRGALEKALGYKTPSRDIKGDSTPKQPPTEL 132

Query: 656 IREIAVLEFEVGHLEQYLLSLYRKAFDQQISTSSP 760
           I+EIAVLE EV HLEQYLLSLYRKAFDQQ S+ SP
Sbjct: 133 IKEIAVLELEVSHLEQYLLSLYRKAFDQQTSSVSP 167



>gb:AC103891_1737303 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1175C11, complete sequence.
          Length = 590

 Score =  104 bits (259), Expect = 2e-21
 Identities = 60/118 (50%), Positives = 76/118 (64%)
 Frame = +2

Query: 410 SPEASPELKLDMEHSDDCFESKKKQSSTAEVQSSLTQEIMQLEKRLQTQVAVRCALEKAL 589
           SP  + +   + E   D   + K+   T E+  SL QE+  LEKRL  Q A+R ALEKAL
Sbjct: 8   SPRCNVQHLQNAEELKDQNSTNKRLPRTTELPCSLIQEVQHLEKRLNDQFAMRRALEKAL 67

Query: 590 GYRSTCQKTADEISIPKPATELIREIAVLEFEVGHLEQYLLSLYRKAFDQQISTSSPS 763
           GY+     +++E  IPKP  ELI+EIAVLE EV  LEQ+LL+LYRKAFDQQI + S S
Sbjct: 68  GYKPCAIHSSNESCIPKPTEELIKEIAVLELEVICLEQHLLALYRKAFDQQICSVSSS 125



>gb:AC107207_1738368 Oryza sativa chromosome 3 BAC OSJNBb0106M04
           genomic sequence, complete sequence.
          Length = 644

 Score = 95.9 bits (237), Expect = 8e-19
 Identities = 66/146 (45%), Positives = 86/146 (58%), Gaps = 9/146 (6%)
 Frame = +2

Query: 350 HKRSKSFPDSVKTGHDSFRCSPEAS-PELKLDMEHSDDCFESKKKQSSTAEVQ------S 508
           HKRSKS  + +        C+ +A     K  ++   D  + K K    AEVQ      S
Sbjct: 22  HKRSKSDLEDM--------CAKDALYASDKTCVQPKPDAVKVKVKSDINAEVQPGRGAQS 73

Query: 509 SLTQEIMQLEKRLQTQVAVRCALEKALGYRSTCQ--KTADEISIPKPATELIREIAVLEF 682
            L +EI+QLEK L+ Q  +R ALEKALG  +T      ++E  +PK A ELIREIA LE 
Sbjct: 74  FLRKEILQLEKHLKDQQVMRGALEKALGPNATAAPVNVSNENPMPKDAKELIREIATLEL 133

Query: 683 EVGHLEQYLLSLYRKAFDQQISTSSP 760
           EV ++EQYLL+LYRKAF+QQ+ T SP
Sbjct: 134 EVKNMEQYLLTLYRKAFEQQVPTFSP 159



>gb:AY206499_1589526 Antirrhinum majus putative ternary complex
           factor MIP1 mRNA, complete cds.
          Length = 555

 Score = 92.8 bits (229), Expect = 7e-18
 Identities = 55/114 (48%), Positives = 75/114 (65%)
 Frame = +2

Query: 467 ESKKKQSSTAEVQSSLTQEIMQLEKRLQTQVAVRCALEKALGYRSTCQKTADEISIPKPA 646
           E KK+Q S  E QS L +EI+QL+K L+ Q  VR ALEKAL  +  C     E S+ +PA
Sbjct: 8   EHKKRQLSPNEAQSLLKEEILQLQKELEGQTVVRSALEKALNCQPLCYNPTYE-SLSQPA 66

Query: 647 TELIREIAVLEFEVGHLEQYLLSLYRKAFDQQISTSSPSRIDDKLKSLVGTPRR 808
             LI+EIA+LE EV +LE+YLLSLYR++F +++ST     +D + K  V T +R
Sbjct: 67  ENLIKEIALLELEVEYLEKYLLSLYRRSFTKRLSTL--QAVDKRPKPNVETHKR 118



>pir|E86343|E86343 T22I11.12 protein - Arabidopsis
           thaliana>gb:AE005172_891064 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:T22I11_1723802 Arabidopsis thaliana
           chromosome 1 BAC T22I11 sequence, complete sequence.
          Length = 504

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 45/120 (37%), Positives = 58/120 (48%), Gaps = 2/120 (1%)
 Frame = +2

Query: 407 CSPEASPELKLDMEHSDDCFESKKKQSSTAEVQSSLTQEIMQLEKRLQTQVAVRCALEKA 586
           CSP  S         S DC  S  + S   +        I+    R  T      ++EK 
Sbjct: 4   CSPSPS---------SHDCSSSSPRNSEKKQ------NVIVASPSRFSTYTKPSLSIEKR 48

Query: 587 L-GYR-STCQKTADEISIPKPATELIREIAVLEFEVGHLEQYLLSLYRKAFDQQISTSSP 760
           L  Y+ S C  T      PK + +L +EIA LEFE+   EQYLLSLYR AFD+Q+S+ SP
Sbjct: 49  LLTYQDSNCNVT------PKSSEDLRKEIASLEFEILRTEQYLLSLYRTAFDEQVSSFSP 102



>gb:AB018117_1513867 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MQL5.
          Length = 598

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 36/103 (34%), Positives = 60/103 (58%)
 Frame = +2

Query: 479 KQSSTAEVQSSLTQEIMQLEKRLQTQVAVRCALEKALGYRSTCQKTADEISIPKPATELI 658
           K + ++  ++SL +++ QL  RLQ + ++R  LE+A+G R++   +         A ELI
Sbjct: 81  KNNVSSNDRASLERDVEQLHLRLQQEKSMRMVLERAMG-RASSSLSPGHRHFAGQANELI 139

Query: 659 REIAVLEFEVGHLEQYLLSLYRKAFDQQISTSSPSRIDDKLKS 787
            EI +LE EV + E ++LSLYR  F+Q +S  +PS     + S
Sbjct: 140 TEIELLEAEVTNREHHVLSLYRSIFEQTVS-RAPSEQSSSISS 181



>gb:AP002039_1821570 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MCB22.
          Length = 524

 Score = 53.5 bits (127), Expect = 5e-06
 Identities = 36/108 (33%), Positives = 61/108 (56%), Gaps = 1/108 (0%)
 Frame = +2

Query: 473 KKKQSSTAEVQSSLTQEIMQLEKRLQTQVAVRCALEKALGYRSTCQKTADE-ISIPKPAT 649
           K K+SS A     +   ++Q     + +V VR  ++  LG +   + + +E  SIPK A 
Sbjct: 47  KNKKSSEALYNIHMIDLLLQ-----EDEVLVRREMKTVLGRKLFLEDSKNEDSSIPKEAK 101

Query: 650 ELIREIAVLEFEVGHLEQYLLSLYRKAFDQQISTSSPSRIDDKLKSLV 793
           +L+ EIA LE +V +LE YLL LYR+ F+ +I++   S   ++ + L+
Sbjct: 102 KLVEEIAGLELQVMYLETYLLLLYRRFFNNKITSKLESEEKERSEDLL 149



>gb:AY060575_1564881 Arabidopsis thaliana At1g76620/F14G6_22 mRNA,
           complete cds.>gb:AY149945_1584894 Arabidopsis thaliana
           At1g76620/F14G6_22 mRNA, complete cds.
          Length = 527

 Score = 52.8 bits (125), Expect = 8e-06
 Identities = 24/41 (58%), Positives = 33/41 (80%)
 Frame = +2

Query: 632 IPKPATELIREIAVLEFEVGHLEQYLLSLYRKAFDQQISTS 754
           IPK + EL +EIA +E E+ H+E+YLLSLYRK+F+QQ+  S
Sbjct: 76  IPKSSEELKKEIASIEIEILHMERYLLSLYRKSFEQQLPNS 116



>pir|D96794|D96794 unknown protein F14G6.22 [imported] - Arabidopsis
           thaliana>gb:AE005173_895193 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC015450_1538054 Arabidopsis thaliana
           chromosome 1 BAC F14G6 genomic sequence, complete
           sequence.
          Length = 509

 Score = 52.8 bits (125), Expect = 8e-06
 Identities = 24/41 (58%), Positives = 33/41 (80%)
 Frame = +2

Query: 632 IPKPATELIREIAVLEFEVGHLEQYLLSLYRKAFDQQISTS 754
           IPK + EL +EIA +E E+ H+E+YLLSLYRK+F+QQ+  S
Sbjct: 76  IPKSSEELKKEIASIEIEILHMERYLLSLYRKSFEQQLPNS 116



>gb:AE016959_1023816 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC079874_1732933
           Oryza sativa chromosome 10 BAC OSJNBa0042H09 genomic
           sequence, complete sequence.>gb:AE017119_1753635 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           73 of 77 of the complete sequence.
          Length = 531

 Score = 51.6 bits (122), Expect = 2e-05
 Identities = 28/76 (36%), Positives = 46/76 (60%)
 Frame = +2

Query: 530 QLEKRLQTQVAVRCALEKALGYRSTCQKTADEISIPKPATELIREIAVLEFEVGHLEQYL 709
           QL+  L  + ++R  L++A+G R++   +   +  P    ELI EI +LE E+ + EQ++
Sbjct: 55  QLQLNLHQERSIRIMLDRAIG-RASSTLSPGHMHFPAQTKELIAEIELLEEEIANREQHV 113

Query: 710 LSLYRKAFDQQISTSS 757
           L+LYR  FDQ  S +S
Sbjct: 114 LTLYRSIFDQSASGAS 129



>gb:AP004761_1844584 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC clone:P0686C03.
          Length = 538

 Score = 42.0 bits (97), Expect = 0.014
 Identities = 23/44 (52%), Positives = 28/44 (63%)
 Frame = +2

Query: 623 EISIPKPATELIREIAVLEFEVGHLEQYLLSLYRKAFDQQISTS 754
           E +I K   +L+ EIA LE EV   E +LLSLYR AFDQ +  S
Sbjct: 89  EKTISKSIADLVWEIAALEEEVVRKELHLLSLYRAAFDQHLGVS 132



>gb:AY600521_1617283 Arabidopsis thaliana hypothetical protein
           (At1g43020) mRNA, complete cds, alternatively spliced.
          Length = 288

 Score = 40.8 bits (94), Expect = 0.031
 Identities = 32/96 (33%), Positives = 50/96 (52%)
 Frame = +2

Query: 470 SKKKQSSTAEVQSSLTQEIMQLEKRLQTQVAVRCALEKALGYRSTCQKTADEISIPKPAT 649
           SKK + S++   SS +   +   + LQ   +   A+ K+  +     K +   S+ K   
Sbjct: 3   SKKYRYSSSSSFSSSSSSQLSTPRALQNGYSQ--AIAKSPLWDVEEVKCSFSSSVSKWNE 60

Query: 650 ELIREIAVLEFEVGHLEQYLLSLYRKAFDQQISTSS 757
           ELI EIA L+ E+  LE+YLLSLYR +F   +  +S
Sbjct: 61  ELIGEIAELDTEILQLERYLLSLYRSSFGDHLPDNS 96



>gb:AY600520_1617282 Arabidopsis thaliana hypothetical protein
           (At1g43020) mRNA, complete cds, alternatively spliced.
          Length = 315

 Score = 40.8 bits (94), Expect = 0.031
 Identities = 32/96 (33%), Positives = 50/96 (52%)
 Frame = +2

Query: 470 SKKKQSSTAEVQSSLTQEIMQLEKRLQTQVAVRCALEKALGYRSTCQKTADEISIPKPAT 649
           SKK + S++   SS +   +   + LQ   +   A+ K+  +     K +   S+ K   
Sbjct: 3   SKKYRYSSSSSFSSSSSSQLSTPRALQNGYSQ--AIAKSPLWDVEEVKCSFSSSVSKWNE 60

Query: 650 ELIREIAVLEFEVGHLEQYLLSLYRKAFDQQISTSS 757
           ELI EIA L+ E+  LE+YLLSLYR +F   +  +S
Sbjct: 61  ELIGEIAELDTEILQLERYLLSLYRSSFGDHLPDNS 96



>gb:AY600519_1617281 Arabidopsis thaliana hypothetical protein
           (At1g43020) mRNA, complete cds, alternatively spliced.
          Length = 445

 Score = 40.8 bits (94), Expect = 0.031
 Identities = 32/96 (33%), Positives = 50/96 (52%)
 Frame = +2

Query: 470 SKKKQSSTAEVQSSLTQEIMQLEKRLQTQVAVRCALEKALGYRSTCQKTADEISIPKPAT 649
           SKK + S++   SS +   +   + LQ   +   A+ K+  +     K +   S+ K   
Sbjct: 3   SKKYRYSSSSSFSSSSSSQLSTPRALQNGYSQ--AIAKSPLWDVEEVKCSFSSSVSKWNE 60

Query: 650 ELIREIAVLEFEVGHLEQYLLSLYRKAFDQQISTSS 757
           ELI EIA L+ E+  LE+YLLSLYR +F   +  +S
Sbjct: 61  ELIGEIAELDTEILQLERYLLSLYRSSFGDHLPDNS 96



>gb:AC068324_1540374 Arabidopsis thaliana chromosome 1 BAC F13A11
           genomic sequence, complete sequence.
          Length = 426

 Score = 40.8 bits (94), Expect = 0.031
 Identities = 32/96 (33%), Positives = 50/96 (52%)
 Frame = +2

Query: 470 SKKKQSSTAEVQSSLTQEIMQLEKRLQTQVAVRCALEKALGYRSTCQKTADEISIPKPAT 649
           SKK + S++   SS +   +   + LQ   +   A+ K+  +     K +   S+ K   
Sbjct: 3   SKKYRYSSSSSFSSSSSSQLSTPRALQNGYSQ--AIAKSPLWDVEEVKCSFSSSVSKWNE 60

Query: 650 ELIREIAVLEFEVGHLEQYLLSLYRKAFDQQISTSS 757
           ELI EIA L+ E+  LE+YLLSLYR +F   +  +S
Sbjct: 61  ELIGEIAELDTEILQLERYLLSLYRSSFGDHLPDNS 96



>pir|A86303|A86303 hypothetical protein F17F16.4 - Arabidopsis
           thaliana>gb:AE005172_890653 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC026237_1539615 Arabidopsis thaliana
           chromosome I BAC F17F16 genomic sequence, complete
           sequence.
          Length = 471

 Score = 40.4 bits (93), Expect = 0.040
 Identities = 27/79 (34%), Positives = 46/79 (58%)
 Frame = +2

Query: 485 SSTAEVQSSLTQEIMQLEKRLQTQVAVRCALEKALGYRSTCQKTADEISIPKPATELIRE 664
           S+ + + S LTQ + +L+ +LQ + A+R  L KA   +S   + +   S+P+   EL+  
Sbjct: 25  STISRLSSGLTQ-VKRLKNQLQKETAMRALLLKASD-QSHKIELSHASSLPRSVQELLTN 82

Query: 665 IAVLEFEVGHLEQYLLSLY 721
           IA +E  V  LEQ ++SL+
Sbjct: 83  IAAMEATVSKLEQEIMSLH 101



>gb:AY126989_1580446 Arabidopsis thaliana At1g16750/F19K19_26 mRNA,
           complete cds.>gb:BT001073_1635328 Arabidopsis thaliana
           At1g16750/F19K19_26 mRNA, complete cds.
          Length = 529

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 25/81 (30%), Positives = 43/81 (53%)
 Frame = +2

Query: 479 KQSSTAEVQSSLTQEIMQLEKRLQTQVAVRCALEKALGYRSTCQKTADEISIPKPATELI 658
           K S     +  L  ++ +L+ +LQ + A+R  L KA   +S   + +   S+P+   EL+
Sbjct: 36  KNSKFHHYRFELEHDVKRLKNQLQKETAMRALLLKASD-QSHKIELSHASSLPRSVQELL 94

Query: 659 REIAVLEFEVGHLEQYLLSLY 721
             IA +E  V  LEQ ++SL+
Sbjct: 95  TNIAAMEATVSKLEQEIMSLH 115



>gb:AY075621_1567765 Arabidopsis thaliana AT4g37080/C7A10_280 mRNA,
           complete cds.>gb:BT000819_1635074 Arabidopsis thaliana
           unknown protein (At4g37080/C7A10_280) mRNA, complete
           cds.
          Length = 597

 Score = 38.5 bits (88), Expect = 0.15
 Identities = 25/98 (25%), Positives = 52/98 (53%)
 Frame = +2

Query: 479 KQSSTAEVQSSLTQEIMQLEKRLQTQVAVRCALEKALGYRSTCQKTADEISIPKPATELI 658
           ++ +  E +  L Q++ +L+++L+ +  V  ALE+A   R           +P+   EL+
Sbjct: 35  RRRANKEKKMDLLQDVDKLKRKLRQEENVHRALERAFT-RPLGALPRLPSYLPRHTLELL 93

Query: 659 REIAVLEFEVGHLEQYLLSLYRKAFDQQISTSSPSRID 772
            E+AVLE EV  LE+ +++  +  + + +  SS   ++
Sbjct: 94  AEVAVLEEEVVRLEEQVVNFRQGLYQEAVYISSKRNLE 131



>pir|A85438|A85438 hypothetical protein AT4g37080 [imported] -
           Arabidopsis thaliana>gb:ATAP21_1543989 Arabidopsis
           thaliana DNA chromosome 4, ESSA I AP2 contig fragment
           No. 1.>gb:ATCHRIV86_1547663 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 86.
          Length = 596

 Score = 38.5 bits (88), Expect = 0.15
 Identities = 25/98 (25%), Positives = 52/98 (53%)
 Frame = +2

Query: 479 KQSSTAEVQSSLTQEIMQLEKRLQTQVAVRCALEKALGYRSTCQKTADEISIPKPATELI 658
           ++ +  E +  L Q++ +L+++L+ +  V  ALE+A   R           +P+   EL+
Sbjct: 34  RRRANKEKKMDLLQDVDKLKRKLRQEENVHRALERAFT-RPLGALPRLPSYLPRHTLELL 92

Query: 659 REIAVLEFEVGHLEQYLLSLYRKAFDQQISTSSPSRID 772
            E+AVLE EV  LE+ +++  +  + + +  SS   ++
Sbjct: 93  AEVAVLEEEVVRLEEQVVNFRQGLYQEAVYISSKRNLE 130



>gb:AP004154_1838283 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC
           clone:OJ1111_E05.>gb:AP004399_1841215 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0451G12.
          Length = 346

 Score = 38.1 bits (87), Expect = 0.20
 Identities = 26/92 (28%), Positives = 49/92 (53%)
 Frame = +2

Query: 479 KQSSTAEVQSSLTQEIMQLEKRLQTQVAVRCALEKALGYRSTCQKTADEISIPKPATELI 658
           +  S  + + +L Q++ +L K+L+ +  V  ALE+A   R           +P    EL+
Sbjct: 43  RSQSRRDRKIALQQDVDKLRKKLRHEENVHRALERAFT-RPLGALPRLPPYLPSQTLELL 101

Query: 659 REIAVLEFEVGHLEQYLLSLYRKAFDQQISTS 754
            E+AVLE EV  LE+ ++S  +  +++ ++ S
Sbjct: 102 AEVAVLEEEVVRLEEQVVSFRQGLYEEAVTIS 133



>gb:AB026645_1517173 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MGH6.>gb:AY093158_1575112 Arabidopsis thaliana
           unknown protein (At3g13000) mRNA, complete
           cds.>gb:BT008905_1640101 Arabidopsis thaliana At3g13000
           mRNA, complete cds.
          Length = 553

 Score = 38.1 bits (87), Expect = 0.20
 Identities = 27/91 (29%), Positives = 45/91 (49%)
 Frame = +2

Query: 446 EHSDDCFESKKKQSSTAEVQSSLTQEIMQLEKRLQTQVAVRCALEKALGYRSTCQKTADE 625
           E  + C ES   +S     Q  L +++ +L+ +LQ ++ +   LE  +       + +  
Sbjct: 3   EGRETCEESTSGESFPYRFQ--LEEDVKRLQLQLQQEIDLHTFLESVM--EKDPWELSYS 58

Query: 626 ISIPKPATELIREIAVLEFEVGHLEQYLLSL 718
            S+P PA EL+  I  LE  V  LEQ ++SL
Sbjct: 59  SSVPHPAQELLSNIVTLETAVTKLEQEMMSL 89



>pir|G96497|G96497 hypothetical protein F2H10.4 [imported] -
           Arabidopsis thaliana>gb:AE005173_892539 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC026757_1539655 Arabidopsis thaliana
           chromosome 1 BAC F2H10 genomic sequence, complete
           sequence.
          Length = 406

 Score = 37.7 bits (86), Expect = 0.26
 Identities = 19/36 (52%), Positives = 25/36 (69%)
 Frame = +2

Query: 650 ELIREIAVLEFEVGHLEQYLLSLYRKAFDQQISTSS 757
           ELI EIA L+ E+  LE+YLLSLYR +F   +  +S
Sbjct: 41  ELIGEIAELDTEILQLERYLLSLYRSSFGDHLPDNS 76



>gb:AB007647_1510178 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MJB21.
          Length = 512

 Score = 37.4 bits (85), Expect = 0.34
 Identities = 21/83 (25%), Positives = 45/83 (54%)
 Frame = +2

Query: 509 SLTQEIMQLEKRLQTQVAVRCALEKALGYRSTCQKTADEISIPKPATELIREIAVLEFEV 688
           +L +++ +L K+L+ +  +  A+E+A               +P    EL+ E+AVLE E+
Sbjct: 27  TLQEDVEKLRKKLRLEENIHRAMERAFSRPLGALPRLPPF-LPPSVLELLAEVAVLEEEL 85

Query: 689 GHLEQYLLSLYRKAFDQQISTSS 757
             LE++++   ++ + + + TSS
Sbjct: 86  VRLEEHIVHCRQELYQEAVFTSS 108



>gb:CR382121_1654598 Kluyveromyces lactis strain NRRL Y-1140
           chromosome A of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 720

 Score = 35.8 bits (81), Expect = 0.99
 Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 2/69 (2%)
 Frame = +2

Query: 440 DMEHSDDCFESKKKQSSTAEVQSSLTQEIMQLEKRLQTQVAVRCALEKALGYR--STCQK 613
           D +H       K K+++   +Q+  T+ ++ + +RL T+    C L     YR  ST   
Sbjct: 218 DQDHDGSTMNKKMKRATIDPIQTFPTELVISIMRRLDTKDITSCMLVSKFWYRKLSTTPM 277

Query: 614 TADEISIPK 640
             D +S+PK
Sbjct: 278 IIDYLSVPK 286



>gb:AY454095_1327715 Plasmodium vivax isolate SalI merozoite surface
           protein 3b gene, partial cds.
          Length = 927

 Score = 35.4 bits (80), Expect = 1.3
 Identities = 30/107 (28%), Positives = 50/107 (46%), Gaps = 5/107 (4%)
 Frame = +2

Query: 467 ESKKKQSSTAEV-----QSSLTQEIMQLEKRLQTQVAVRCALEKALGYRSTCQKTADEIS 631
           E  KK+ + AEV      + + +E  Q  K    QVA +  LEKA+       + A+E S
Sbjct: 494 EEAKKEKAKAEVAVEVAHAEVAKEKAQEAKEAAKQVADKSKLEKAIQAADKASEKANEAS 553

Query: 632 IPKPATELIREIAVLEFEVGHLEQYLLSLYRKAFDQQISTSSPSRID 772
             K A E +  +  LE E G + + +      A +Q++ T+  + I+
Sbjct: 554 --KLAEEALSNLESLEKETGEIVEKV-----NAIEQKVQTAKNAAIE 593



>gb:AY454082_1327702 Plasmodium vivax isolate Br69 merozoite surface
           protein 3b gene, partial cds.
          Length = 900

 Score = 35.4 bits (80), Expect = 1.3
 Identities = 30/107 (28%), Positives = 50/107 (46%), Gaps = 5/107 (4%)
 Frame = +2

Query: 467 ESKKKQSSTAEV-----QSSLTQEIMQLEKRLQTQVAVRCALEKALGYRSTCQKTADEIS 631
           E  KK+ + AEV      + + +E  Q  K    QVA +  LEKA+       + A+E S
Sbjct: 418 EEAKKEKAKAEVAVEVAHAEVAKEKAQEAKEAAKQVADKSKLEKAIQAADKASEKANEAS 477

Query: 632 IPKPATELIREIAVLEFEVGHLEQYLLSLYRKAFDQQISTSSPSRID 772
             K A E +  +  LE E G + + +      A +Q++ T+  + I+
Sbjct: 478 --KLAEEALSNLESLEKETGEIVEKV-----NAIEQKVQTAKNAAIE 517



>gb:BC066506_2554393 Danio rerio zgc:55951, mRNA (cDNA clone
           MGC:77009 IMAGE:6805687), complete cds.
          Length = 284

 Score = 34.7 bits (78), Expect = 2.2
 Identities = 35/118 (29%), Positives = 58/118 (49%), Gaps = 6/118 (5%)
 Frame = +2

Query: 431 LKLDMEHSDDCFESKKKQSSTAEVQSS-LTQEIMQLEKRLQTQVAVRCALEKAL-GYRST 604
           LKLD E++ D  E  +     AE +S  L  E++QLEKRL+     R   +K L  Y+S 
Sbjct: 11  LKLDKENALDRAEQAEGDKKAAEDRSKQLEDELIQLEKRLRVTEDER---DKVLEEYQSV 67

Query: 605 CQK--TADEISIPK--PATELIREIAVLEFEVGHLEQYLLSLYRKAFDQQISTSSPSR 766
            +K  TA+E++         L R I ++E E+   ++ L +  +K  + + +     R
Sbjct: 68  EEKLLTAEEVATKAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESER 125



>gb:AP005678_1855845 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC
           clone:OJ1116_F08.>gb:AP005704_1856383 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 9, PAC
           clone:P0448B03.
          Length = 239

 Score = 34.7 bits (78), Expect = 2.2
 Identities = 22/75 (29%), Positives = 38/75 (50%)
 Frame = +2

Query: 560 AVRCALEKALGYRSTCQKTADEISIPKPATELIREIAVLEFEVGHLEQYLLSLYRKAFDQ 739
           A + ALE+  GYR   +KT +++   +   +  R++A  E ++  LE  L+S    A   
Sbjct: 71  AEKSALERPDGYRLRLRKTEEDLCHKEDERQRDRQLAAAEEKIKSLEARLISAEAAAVTL 130

Query: 740 QISTSSPSRIDDKLK 784
             +T SP ++   LK
Sbjct: 131 APATESPKQVCYTLK 145



>gb:GGU43502_2573658 Gallus gallus insulin receptor substrate 1
           (IRS-1) gene, complete cds.
          Length = 1240

 Score = 34.3 bits (77), Expect = 2.9
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 4/80 (5%)
 Frame = -2

Query: 390 PVFTLSGKLLERLCVQVLIAAPGDSSKLNPS----NPITQHYKPISKEISYQDWIFPTDP 223
           PV +  GKLL      + +   GDS+  +PS     P    +KP+   +SY         
Sbjct: 715 PVESSGGKLLPCTGDYMDMYPVGDSNTSDPSLSYYGPEDPQHKPV---LSYYS------- 764

Query: 222 EVPDAQKHPTGPRKPQLGIK 163
            +PDA KHP+GP +P+ G +
Sbjct: 765 -LPDAFKHPSGPGEPEEGAR 783



>gb:AP005755_1857276 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, BAC clone:OSJNBb0019B14.
          Length = 580

 Score = 34.3 bits (77), Expect = 2.9
 Identities = 26/87 (29%), Positives = 46/87 (52%)
 Frame = +2

Query: 497 EVQSSLTQEIMQLEKRLQTQVAVRCALEKALGYRSTCQKTADEISIPKPATELIREIAVL 676
           E + +L Q++ +L+K+L+ +  V  ALE+A   R           +P     L+ E+AVL
Sbjct: 35  ERKLALQQDVDKLKKKLRHEENVHRALERAFT-RPLGALPRLPPYLPSQTLALLAEVAVL 93

Query: 677 EFEVGHLEQYLLSLYRKAFDQQISTSS 757
           E EV  LE+ +++  +  + + I  SS
Sbjct: 94  EEEVVRLEEQVVNFRQGLYQEAIIFSS 120



>gb:AF209743_1251167 Drosophila melanogaster XPC-like protein
           (mus210) gene, complete cds, alternatively spliced.
          Length = 1293

 Score = 34.3 bits (77), Expect = 2.9
 Identities = 34/131 (25%), Positives = 60/131 (45%)
 Frame = +2

Query: 422 SPELKLDMEHSDDCFESKKKQSSTAEVQSSLTQEIMQLEKRLQTQVAVRCALEKALGYRS 601
           S  ++ + E  D+  +  KK    AE +SS +    + EK+   + A    L K+    S
Sbjct: 528 SQTVESERESEDEKPKKDKKAGKPAEKESSKSTISKEAEKKNNAKKAEAKPLSKSTTKGS 587

Query: 602 TCQKTADEISIPKPATELIREIAVLEFEVGHLEQYLLSLYRKAFDQQISTSSPSRIDDKL 781
              K+    ++PK   EL     ++E +  H + Y  S    +FD++ STSS S+   + 
Sbjct: 588 ETTKSG---TVPKVKKELSLSSKLVE-KSKHQKAYTSSKSDTSFDEKPSTSSSSKCLKEE 643

Query: 782 KSLVGTPRRRL 814
            S +G  ++ L
Sbjct: 644 YSELGLSKKLL 654



>gb:AE013599_1131985 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003811_1225719 Drosophila melanogaster
           chromosome 2R, section 39 of 74 of the complete
           sequence.>gb:AY070566_1294711 Drosophila melanogaster
           LD47533 full length cDNA.
          Length = 1293

 Score = 34.3 bits (77), Expect = 2.9
 Identities = 34/131 (25%), Positives = 60/131 (45%)
 Frame = +2

Query: 422 SPELKLDMEHSDDCFESKKKQSSTAEVQSSLTQEIMQLEKRLQTQVAVRCALEKALGYRS 601
           S  ++ + E  D+  +  KK    AE +SS +    + EK+   + A    L K+    S
Sbjct: 528 SQTVESERESEDEKPKKDKKAGKPAEKESSKSTISKEAEKKNNAKKAEAKPLSKSTTKGS 587

Query: 602 TCQKTADEISIPKPATELIREIAVLEFEVGHLEQYLLSLYRKAFDQQISTSSPSRIDDKL 781
              K+    ++PK   EL     ++E +  H + Y  S    +FD++ STSS S+   + 
Sbjct: 588 ETTKSG---TVPKVKKELSLSSKLVE-KSKHQKAYTSSKSDTSFDEKPSTSSSSKCLKEE 643

Query: 782 KSLVGTPRRRL 814
            S +G  ++ L
Sbjct: 644 YSELGLSKKLL 654



>gb:AE013599_1131984 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003811_1225718 Drosophila melanogaster
           chromosome 2R, section 39 of 74 of the complete
           sequence.
          Length = 1294

 Score = 34.3 bits (77), Expect = 2.9
 Identities = 34/131 (25%), Positives = 60/131 (45%)
 Frame = +2

Query: 422 SPELKLDMEHSDDCFESKKKQSSTAEVQSSLTQEIMQLEKRLQTQVAVRCALEKALGYRS 601
           S  ++ + E  D+  +  KK    AE +SS +    + EK+   + A    L K+    S
Sbjct: 529 SQTVESERESEDEKPKKDKKAGKPAEKESSKSTISKEAEKKNNAKKAEAKPLSKSTTKGS 588

Query: 602 TCQKTADEISIPKPATELIREIAVLEFEVGHLEQYLLSLYRKAFDQQISTSSPSRIDDKL 781
              K+    ++PK   EL     ++E +  H + Y  S    +FD++ STSS S+   + 
Sbjct: 589 ETTKSG---TVPKVKKELSLSSKLVE-KSKHQKAYTSSKSDTSFDEKPSTSSSSKCLKEE 644

Query: 782 KSLVGTPRRRL 814
            S +G  ++ L
Sbjct: 645 YSELGLSKKLL 655



>pir|JC5209|JC5209 insulin receptor substrate 1 - chicken
          Length = 1240

 Score = 34.3 bits (77), Expect = 2.9
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 4/80 (5%)
 Frame = -2

Query: 390 PVFTLSGKLLERLCVQVLIAAPGDSSKLNPS----NPITQHYKPISKEISYQDWIFPTDP 223
           PV +  GKLL      + +   GDS+  +PS     P    +KP+   +SY         
Sbjct: 715 PVESSGGKLLPCTGDYMDMYPVGDSNTSDPSLSYYGPEDPQHKPV---LSYYS------- 764

Query: 222 EVPDAQKHPTGPRKPQLGIK 163
            +PDA KHP+GP +P+ G +
Sbjct: 765 -LPDAFKHPSGPGEPEEGAR 783



>gb:AY231828_1177121 Drosophila yakuba clone yak-em_GM130 mRNA
           sequence.
          Length = 174

 Score = 33.9 bits (76), Expect = 3.8
 Identities = 21/108 (19%), Positives = 55/108 (50%)
 Frame = +2

Query: 467 ESKKKQSSTAEVQSSLTQEIMQLEKRLQTQVAVRCALEKALGYRSTCQKTADEISIPKPA 646
           E  ++ +S  E +  L + +  LE+ +Q  ++++   ++A   + + ++T+D+ ++    
Sbjct: 43  ELAEELNSLRERERQLVEHVGTLERDIQKNISLQAQFKEASQVQPSKEETSDQKALKDEL 102

Query: 647 TELIREIAVLEFEVGHLEQYLLSLYRKAFDQQISTSSPSRIDDKLKSL 790
            EL   +A  EFE     ++ L +  +    Q+  S+ + ++ +L+ L
Sbjct: 103 AELKERLADFEFE---RHEFQLKIKSQDDQLQVKDSALNELEKQLERL 147



>gb:AY454096_1327716 Plasmodium vivax isolate SL merozoite surface
           protein 3b gene, partial cds.>gb:AY454097_1327717
           Plasmodium vivax isolate SL57 merozoite surface protein
           3b gene, partial cds.
          Length = 699

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 5/92 (5%)
 Frame = +2

Query: 467 ESKKKQSSTAEV-----QSSLTQEIMQLEKRLQTQVAVRCALEKALGYRSTCQKTADEIS 631
           E  KK+ + AEV      + + +E  Q  K    QVA +  LEKA+       + A+E S
Sbjct: 377 EEAKKEKAKAEVAVEVAHAEVAKEKAQEAKEAAKQVADKSKLEKAIQAADKASEKANEAS 436

Query: 632 IPKPATELIREIAVLEFEVGHLEQYLLSLYRK 727
             K A E +  +  LE E G + + + ++ +K
Sbjct: 437 --KLAEEALSNLESLEKETGEIVEKVNAIKQK 466



>gb:AP006618_557889 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 116

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 27/87 (31%), Positives = 41/87 (47%), Gaps = 1/87 (1%)
 Frame = +2

Query: 335 MRTCTHKRSKSFPDSVKTGHDSFRCSPEASPELKLDMEHSDDCFESKKKQSSTAEVQSSL 514
           MRT T  RS   PD      D F C    +P ++L  EH  + F      ++ +EV +++
Sbjct: 4   MRTPT-PRSTPMPDQTSPVGDDFPCCTTPTPHVELSREHL-EVFAVDPHAAAESEV-AAM 60

Query: 515 TQEIMQLEKRLQTQVAVR-CALEKALG 592
            QE++    R+    + R  A E ALG
Sbjct: 61  AQELLAARARIAEMESERAAATEAALG 87



>sp|Q8HZ58|HCR_PONPY Alpha helical coiled-coil rod
            protein.>gb:AY135796S1_1936881 Pongo pygmaeus HCR (HCR)
            gene, exon 18 and complete cds.
          Length = 782

 Score = 33.5 bits (75), Expect = 4.9
 Identities = 38/150 (25%), Positives = 67/150 (44%), Gaps = 18/150 (12%)
 Frame = +2

Query: 410  SPEASPELKLDMEHSDDCFESKKKQSSTAEVQSSLTQEIMQLEKRLQ------------- 550
            S E +  L+ ++    + +  +  Q   AEV++ L +++   E+RL              
Sbjct: 579  STEEAASLRQELTQQQELY-GQALQEKVAEVETQLREQLSDTERRLNEARREHAKAVVSL 637

Query: 551  TQVAVRCALEKALGYRSTCQKTADEISIPKPATELIREIAVLEFEVGHL-----EQYLLS 715
             Q+  R A EK    RS   +   E +  +    L R +  LE +   +     ++ LLS
Sbjct: 638  RQIQRRAAQEKE---RSQELRRLQEEARKEEGQRLARRLQELERDKNLMLATLQQEGLLS 694

Query: 716  LYRKAFDQQISTSSPSRIDDKLKSLVGTPR 805
             Y++   Q++ T  PS +D K KS+V +PR
Sbjct: 695  RYKQ---QRLLTVLPSLLDKK-KSVVSSPR 720



>gb:CTR399534_2397847 Citrus tristeza virus (CTV) partial mRNA for
           putative helicase domain of polyprotein (HEL gene),
           clone 14-10.
          Length = 371

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 1/68 (1%)
 Frame = -2

Query: 624 SSAVFWHVDRYPNAFSRAHRTATWVCNRFSSCIISCVNELWTSA-VDDCFFLLSKQSSEC 448
           SS++ W++++YPN +           ++ SS  +SC+NE    A V      L   S E 
Sbjct: 299 SSSLEWYLEKYPNEYKG---------SKASSAPLSCINEFLNEAVVGSSVVQLGDTSEEL 349

Query: 447 SISNFNSG 424
           S   F SG
Sbjct: 350 SSQPFESG 357



>gb:BC088245_2110440 Rattus norvegicus cDNA clone IMAGE:7368069,
           partial cds.
          Length = 433

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 22/74 (29%), Positives = 36/74 (48%)
 Frame = +2

Query: 362 KSFPDSVKTGHDSFRCSPEASPELKLDMEHSDDCFESKKKQSSTAEVQSSLTQEIMQLEK 541
           KS PD ++   D    SP  +  + L++ HS+     KK   +  +V SS+ +   Q  +
Sbjct: 4   KSHPDLLQLSRDLE--SPSQAAGIHLEIIHSEASANLKKLLEAERKVSSSIPEVQKQYAE 61

Query: 542 RLQTQVAVRCALEK 583
           RLQ  +    AL+K
Sbjct: 62  RLQASIEASRALDK 75



>gb:CR457227_1993434 Homo sapiens full open reading frame cDNA clone
            RZPDo834B046D for gene C6orf18, chromosome 6 open reading
            frame 18; complete cds, incl. stopcodon.
          Length = 782

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 38/150 (25%), Positives = 67/150 (44%), Gaps = 18/150 (12%)
 Frame = +2

Query: 410  SPEASPELKLDMEHSDDCFESKKKQSSTAEVQSSLTQEIMQLEKRLQ------------- 550
            S E +  L+ ++    + +  +  Q   AEV++ L +++   E+RL              
Sbjct: 579  STEEAASLRQELTQQQELY-GQALQEKVAEVETRLREQLSDTERRLNEARREHAKAVVSL 637

Query: 551  TQVAVRCALEKALGYRSTCQKTADEISIPKPATELIREIAVLEFEVGHL-----EQYLLS 715
             Q+  R A EK    RS   +   E +  +    L R +  LE +   +     ++ LLS
Sbjct: 638  RQIQRRAAQEKE---RSQELRRLQEEARKEEGQRLARRLQELERDKNLMLATLQQEGLLS 694

Query: 716  LYRKAFDQQISTSSPSRIDDKLKSLVGTPR 805
             Y++   Q++ T  PS +D K KS+V +PR
Sbjct: 695  RYKQ---QRLLTVLPSLLDKK-KSVVSSPR 720



>gb:AL662844_1931714 Human DNA sequence from clone XXbac-299F13 on
            chromosome 6 contains the gene for STG protein, the CDSN
            gene for corneodesmosin, the gene for SEEK1 protein, the
            gene for SPR1 protein, the gene for HCR, the TCF19 gene
            for transcription factor 19, the POU5F1 gene for POU
            domain, class 5, transcription factor 1, a putative novel
            transcript and four CpG islands, complete sequence.
          Length = 808

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 38/150 (25%), Positives = 67/150 (44%), Gaps = 18/150 (12%)
 Frame = +2

Query: 410  SPEASPELKLDMEHSDDCFESKKKQSSTAEVQSSLTQEIMQLEKRLQ------------- 550
            S E +  L+ ++    + +  +  Q   AEV++ L +++   E+RL              
Sbjct: 605  STEEAASLRQELTQQQELY-GQALQEKVAEVETRLREQLSDTERRLNEARREHAKAVVSL 663

Query: 551  TQVAVRCALEKALGYRSTCQKTADEISIPKPATELIREIAVLEFEVGHL-----EQYLLS 715
             Q+  R A EK    RS   +   E +  +    L R +  LE +   +     ++ LLS
Sbjct: 664  RQIQRRAAQEKE---RSQELRRLQEEARKEEGQRLARRLQELERDKNLMLATLQQEGLLS 720

Query: 716  LYRKAFDQQISTSSPSRIDDKLKSLVGTPR 805
             Y++   Q++ T  PS +D K KS+V +PR
Sbjct: 721  RYKQ---QRLLTVLPSLLDKK-KSVVSSPR 746



>gb:AL662833_1931665 Human DNA sequence from clone XXbac-101P6 on
            chromosome 6 contains the gene for HCR, the TCF19 gene
            for transcription factor 19, the POU5F1 gene for POU
            domain, class 5, transcription factor 1, a putative novel
            transcript, the HLA-C gene for major histocompatibility
            complex, class I, C, a ubiquitin specific protease 8
            (USP8) pseudogene, a ribosomal protein L3 (RPL3)
            pseudogene, a WAS protein family, member 3 (WASF3)
            pseudogene and three CpG islands, complete sequence.
          Length = 808

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 38/150 (25%), Positives = 67/150 (44%), Gaps = 18/150 (12%)
 Frame = +2

Query: 410  SPEASPELKLDMEHSDDCFESKKKQSSTAEVQSSLTQEIMQLEKRLQ------------- 550
            S E +  L+ ++    + +  +  Q   AEV++ L +++   E+RL              
Sbjct: 605  STEEAASLRQELTQQQELY-GQALQEKVAEVETRLREQLSDTERRLNEARREHAKAVVSL 663

Query: 551  TQVAVRCALEKALGYRSTCQKTADEISIPKPATELIREIAVLEFEVGHL-----EQYLLS 715
             Q+  R A EK    RS   +   E +  +    L R +  LE +   +     ++ LLS
Sbjct: 664  RQIQRRAAQEKE---RSQELRRLQEEARKEEGQRLARRLQELERDKNLMLATLQQEGLLS 720

Query: 716  LYRKAFDQQISTSSPSRIDDKLKSLVGTPR 805
             Y++   Q++ T  PS +D K KS+V +PR
Sbjct: 721  RYKQ---QRLLTVLPSLLDKK-KSVVSSPR 746



>gb:AL662833_1931664 Human DNA sequence from clone XXbac-101P6 on
            chromosome 6 contains the gene for HCR, the TCF19 gene
            for transcription factor 19, the POU5F1 gene for POU
            domain, class 5, transcription factor 1, a putative novel
            transcript, the HLA-C gene for major histocompatibility
            complex, class I, C, a ubiquitin specific protease 8
            (USP8) pseudogene, a ribosomal protein L3 (RPL3)
            pseudogene, a WAS protein family, member 3 (WASF3)
            pseudogene and three CpG islands, complete
            sequence.>gb:AY029160_1934454 Homo sapiens alpha helical
            coiled-coil rod protein (HCR) mRNA, psoriasis-associated
            allele, complete cds.
          Length = 782

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 38/150 (25%), Positives = 67/150 (44%), Gaps = 18/150 (12%)
 Frame = +2

Query: 410  SPEASPELKLDMEHSDDCFESKKKQSSTAEVQSSLTQEIMQLEKRLQ------------- 550
            S E +  L+ ++    + +  +  Q   AEV++ L +++   E+RL              
Sbjct: 579  STEEAASLRQELTQQQELY-GQALQEKVAEVETRLREQLSDTERRLNEARREHAKAVVSL 637

Query: 551  TQVAVRCALEKALGYRSTCQKTADEISIPKPATELIREIAVLEFEVGHL-----EQYLLS 715
             Q+  R A EK    RS   +   E +  +    L R +  LE +   +     ++ LLS
Sbjct: 638  RQIQRRAAQEKE---RSQELRRLQEEARKEEGQRLARRLQELERDKNLMLATLQQEGLLS 694

Query: 716  LYRKAFDQQISTSSPSRIDDKLKSLVGTPR 805
             Y++   Q++ T  PS +D K KS+V +PR
Sbjct: 695  RYKQ---QRLLTVLPSLLDKK-KSVVSSPR 720



>gb:AK000533_1907983 Homo sapiens cDNA FLJ20526 fis, clone KAT10627.
          Length = 506

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 38/150 (25%), Positives = 67/150 (44%), Gaps = 18/150 (12%)
 Frame = +2

Query: 410 SPEASPELKLDMEHSDDCFESKKKQSSTAEVQSSLTQEIMQLEKRLQ------------- 550
           S E +  L+ ++    + +  +  Q   AEV++ L +++   E+RL              
Sbjct: 303 STEEAASLRQELTQQQELY-GQALQEKVAEVETRLREQLSDTERRLNEARREHAKAVVSL 361

Query: 551 TQVAVRCALEKALGYRSTCQKTADEISIPKPATELIREIAVLEFEVGHL-----EQYLLS 715
            Q+  R A EK    RS   +   E +  +    L R +  LE +   +     ++ LLS
Sbjct: 362 RQIQRRAAQEKE---RSQELRRLQEEARKEEGLRLARRLQELERDKNLMLATLQQEGLLS 418

Query: 716 LYRKAFDQQISTSSPSRIDDKLKSLVGTPR 805
            Y++   Q++ T  PS +D K KS+V +PR
Sbjct: 419 RYKQ---QRLLTVLPSLLDKK-KSVVSSPR 444



>gb:AK000217_1907763 Homo sapiens cDNA FLJ20210 fis, clone COLF1787.
          Length = 782

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 38/150 (25%), Positives = 67/150 (44%), Gaps = 18/150 (12%)
 Frame = +2

Query: 410  SPEASPELKLDMEHSDDCFESKKKQSSTAEVQSSLTQEIMQLEKRLQ------------- 550
            S E +  L+ ++    + +  +  Q   AEV++ L +++   E+RL              
Sbjct: 579  STEEAASLRQELTQQQELY-GQALQEKVAEVETRLREQLSDTERRLNEARREHAKAVVSL 637

Query: 551  TQVAVRCALEKALGYRSTCQKTADEISIPKPATELIREIAVLEFEVGHL-----EQYLLS 715
             Q+  R A EK    RS   +   E +  +    L R +  LE +   +     ++ LLS
Sbjct: 638  RQIQRRAAQEKE---RSQELRRLQEEARKEEGQRLARRLQELERDKNLMLATLQQEGLLS 694

Query: 716  LYRKAFDQQISTSSPSRIDDKLKSLVGTPR 805
             Y++   Q++ T  PS +D K KS+V +PR
Sbjct: 695  RYKQ---QRLLTVLPSLLDKK-KSVVSSPR 720



>gb:AF216493_1890465 Homo sapiens a-helical protein (HCR) mRNA,
           complete cds.
          Length = 756

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 38/150 (25%), Positives = 67/150 (44%), Gaps = 18/150 (12%)
 Frame = +2

Query: 410 SPEASPELKLDMEHSDDCFESKKKQSSTAEVQSSLTQEIMQLEKRLQ------------- 550
           S E +  L+ ++    + +  +  Q   AEV++ L +++   E+RL              
Sbjct: 553 STEEAASLRQELTQQQELY-GQALQEKVAEVETRLREQLSDTERRLNEARREHAKAVVSL 611

Query: 551 TQVAVRCALEKALGYRSTCQKTADEISIPKPATELIREIAVLEFEVGHL-----EQYLLS 715
            Q+  R A EK    RS   +   E +  +    L R +  LE +   +     ++ LLS
Sbjct: 612 RQIQRRAAQEKE---RSQELRRLQEEARKEEGQRLARRLQELERDKNLMLATLQQEGLLS 668

Query: 716 LYRKAFDQQISTSSPSRIDDKLKSLVGTPR 805
            Y++   Q++ T  PS +D K KS+V +PR
Sbjct: 669 RYKQ---QRLLTVLPSLLDKK-KSVVSSPR 694



>gb:AB112474_1873701 Homo sapiens SBP mRNA for StAR protein binding
            protein, complete cds.>gb:AB112475_1873702 Homo sapiens
            SBP 1b mRNA for StAR protein binding protein 1b, complete
            cds.>gb:AK000204_1907754 Homo sapiens cDNA FLJ20197 fis,
            clone COLF0996.
          Length = 782

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 38/150 (25%), Positives = 67/150 (44%), Gaps = 18/150 (12%)
 Frame = +2

Query: 410  SPEASPELKLDMEHSDDCFESKKKQSSTAEVQSSLTQEIMQLEKRLQ------------- 550
            S E +  L+ ++    + +  +  Q   AEV++ L +++   E+RL              
Sbjct: 579  STEEAASLRQELTQQQELY-GQALQEKVAEVETRLREQLSDTERRLNEARREHAKAVVSL 637

Query: 551  TQVAVRCALEKALGYRSTCQKTADEISIPKPATELIREIAVLEFEVGHL-----EQYLLS 715
             Q+  R A EK    RS   +   E +  +    L R +  LE +   +     ++ LLS
Sbjct: 638  RQIQRRAAQEKE---RSQELRRLQEEARKEEGQRLARRLQELERDKNLMLATLQQEGLLS 694

Query: 716  LYRKAFDQQISTSSPSRIDDKLKSLVGTPR 805
             Y++   Q++ T  PS +D K KS+V +PR
Sbjct: 695  RYKQ---QRLLTVLPSLLDKK-KSVVSSPR 720



>gb:AB029343_1865911 Homo sapiens HCR (a-helix coiled-coil rod
           homologue) gene, complete cds.>gb:AB088104_1872116 Homo
           sapiens HCR gene for tricohyalin homologue, complete
           cds.>gb:BA000025_1966177 Homo sapiens genomic DNA,
           chromosome 6p21.3, HLA Class I region.
          Length = 756

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 38/150 (25%), Positives = 67/150 (44%), Gaps = 18/150 (12%)
 Frame = +2

Query: 410 SPEASPELKLDMEHSDDCFESKKKQSSTAEVQSSLTQEIMQLEKRLQ------------- 550
           S E +  L+ ++    + +  +  Q   AEV++ L +++   E+RL              
Sbjct: 553 STEEAASLRQELTQQQELY-GQALQEKVAEVETRLREQLSDTERRLNEARREHAKAVVSL 611

Query: 551 TQVAVRCALEKALGYRSTCQKTADEISIPKPATELIREIAVLEFEVGHL-----EQYLLS 715
            Q+  R A EK    RS   +   E +  +    L R +  LE +   +     ++ LLS
Sbjct: 612 RQIQRRAAQEKE---RSQELRRLQEEARKEEGQRLARRLQELERDKNLMLATLQQEGLLS 668

Query: 716 LYRKAFDQQISTSSPSRIDDKLKSLVGTPR 805
            Y++   Q++ T  PS +D K KS+V +PR
Sbjct: 669 RYKQ---QRLLTVLPSLLDKK-KSVVSSPR 694



>gb:AB029331_1865910 Homo sapiens HCR (a-helix coiled-coil rod
           homologue) mRNA, complete cds.
          Length = 756

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 38/150 (25%), Positives = 67/150 (44%), Gaps = 18/150 (12%)
 Frame = +2

Query: 410 SPEASPELKLDMEHSDDCFESKKKQSSTAEVQSSLTQEIMQLEKRLQ------------- 550
           S E +  L+ ++    + +  +  Q   AEV++ L +++   E+RL              
Sbjct: 553 STEEAASLRQELTQQQELY-GQALQEKVAEVETRLREQLSDTERRLNEARREHAKAVVSL 611

Query: 551 TQVAVRCALEKALGYRSTCQKTADEISIPKPATELIREIAVLEFEVGHL-----EQYLLS 715
            Q+  R A EK    RS   +   E +  +    L R +  LE +   +     ++ LLS
Sbjct: 612 RQIQRRAAQEKE---RSQELRRLQEEARKEEGQRLARRLQELERDKNLMLATLQQEGLLS 668

Query: 716 LYRKAFDQQISTSSPSRIDDKLKSLVGTPR 805
            Y++   Q++ T  PS +D K KS+V +PR
Sbjct: 669 RYKQ---QRLLTVLPSLLDKK-KSVVSSPR 694



>sp|Q8HZ60|HCR_PANTR Alpha helical coiled-coil rod
            protein.>gb:AY135760S1_1936879 Pan troglodytes HCR (HCR)
            gene, exon 18 and complete cds.
          Length = 782

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 38/150 (25%), Positives = 67/150 (44%), Gaps = 18/150 (12%)
 Frame = +2

Query: 410  SPEASPELKLDMEHSDDCFESKKKQSSTAEVQSSLTQEIMQLEKRLQ------------- 550
            S E +  L+ ++    + +  +  Q   AEV++ L +++   E+RL              
Sbjct: 579  STEEAASLRQELTQQQELY-GQALQEKVAEVETRLREQLSDTERRLNEARREHAKAVVSL 637

Query: 551  TQVAVRCALEKALGYRSTCQKTADEISIPKPATELIREIAVLEFEVGHL-----EQYLLS 715
             Q+  R A EK    RS   +   E +  +    L R +  LE +   +     ++ LLS
Sbjct: 638  RQIQRRAAQEKE---RSQELRRLQEEARKEEGQRLARRLQELERDKNLMLATLQQEGLLS 694

Query: 716  LYRKAFDQQISTSSPSRIDDKLKSLVGTPR 805
             Y++   Q++ T  PS +D K KS+V +PR
Sbjct: 695  RYKQ---QRLLTVLPSLLDKK-KSVVSSPR 720



>sp|Q8HZ57|HCR_PANPA Alpha helical coiled-coil rod
            protein.>gb:AY135814S1_1936882 Pan paniscus HCR (HCR)
            gene, exon 18 and complete cds.
          Length = 782

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 38/150 (25%), Positives = 67/150 (44%), Gaps = 18/150 (12%)
 Frame = +2

Query: 410  SPEASPELKLDMEHSDDCFESKKKQSSTAEVQSSLTQEIMQLEKRLQ------------- 550
            S E +  L+ ++    + +  +  Q   AEV++ L +++   E+RL              
Sbjct: 579  STEEAASLRQELTQQQELY-GQALQEKVAEVETRLREQLSDTERRLNEARREHAKAVVSL 637

Query: 551  TQVAVRCALEKALGYRSTCQKTADEISIPKPATELIREIAVLEFEVGHL-----EQYLLS 715
             Q+  R A EK    RS   +   E +  +    L R +  LE +   +     ++ LLS
Sbjct: 638  RQIQRRAAQEKE---RSQELRRLQEEARKEEGQRLARRLQELERDKNLMLATLQQEGLLS 694

Query: 716  LYRKAFDQQISTSSPSRIDDKLKSLVGTPR 805
             Y++   Q++ T  PS +D K KS+V +PR
Sbjct: 695  RYKQ---QRLLTVLPSLLDKK-KSVVSSPR 720



>sp|Q8TD31|HCR_HUMAN Alpha helical coiled-coil rod protein (Putative
            gene 8 protein) (Pg8).>gb:AL662844_1931713 Human DNA
            sequence from clone XXbac-299F13 on chromosome 6 contains
            the gene for STG protein, the CDSN gene for
            corneodesmosin, the gene for SEEK1 protein, the gene for
            SPR1 protein, the gene for HCR, the TCF19 gene for
            transcription factor 19, the POU5F1 gene for POU domain,
            class 5, transcription factor 1, a putative novel
            transcript and four CpG islands, complete
            sequence.>gb:AL773544_1932886 Human DNA sequence from
            clone DAQB-185I1 on chromosome 6, complete sequence.
          Length = 782

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 38/150 (25%), Positives = 67/150 (44%), Gaps = 18/150 (12%)
 Frame = +2

Query: 410  SPEASPELKLDMEHSDDCFESKKKQSSTAEVQSSLTQEIMQLEKRLQ------------- 550
            S E +  L+ ++    + +  +  Q   AEV++ L +++   E+RL              
Sbjct: 579  STEEAASLRQELTQQQELY-GQALQEKVAEVETRLREQLSDTERRLNEARREHAKAVVSL 637

Query: 551  TQVAVRCALEKALGYRSTCQKTADEISIPKPATELIREIAVLEFEVGHL-----EQYLLS 715
             Q+  R A EK    RS   +   E +  +    L R +  LE +   +     ++ LLS
Sbjct: 638  RQIQRRAAQEKE---RSQELRRLQEEARKEEGQRLARRLQELERDKNLMLATLQQEGLLS 694

Query: 716  LYRKAFDQQISTSSPSRIDDKLKSLVGTPR 805
             Y++   Q++ T  PS +D K KS+V +PR
Sbjct: 695  RYKQ---QRLLTVLPSLLDKK-KSVVSSPR 720



>sp|Q8HZ59|HCR_GORGO Alpha helical coiled-coil rod
            protein.>gb:AY135778S1_1936880 Gorilla gorilla HCR (HCR)
            gene, exon 18 and complete cds.
          Length = 782

 Score = 33.1 bits (74), Expect = 6.4
 Identities = 38/150 (25%), Positives = 67/150 (44%), Gaps = 18/150 (12%)
 Frame = +2

Query: 410  SPEASPELKLDMEHSDDCFESKKKQSSTAEVQSSLTQEIMQLEKRLQ------------- 550
            S E +  L+ ++    + +  +  Q   AEV++ L +++   E+RL              
Sbjct: 579  STEEAASLRQELTQQQELY-GQALQEKVAEVETRLREQLSDTERRLNEARREHAKAVVSL 637

Query: 551  TQVAVRCALEKALGYRSTCQKTADEISIPKPATELIREIAVLEFEVGHL-----EQYLLS 715
             Q+  R A EK    RS   +   E +  +    L R +  LE +   +     ++ LLS
Sbjct: 638  RQIQRRAAQEKE---RSQELRRLQEEARKEEGQRLARRLQELERDKNLMLATLQQEGLLS 694

Query: 716  LYRKAFDQQISTSSPSRIDDKLKSLVGTPR 805
             Y++   Q++ T  PS +D K KS+V +PR
Sbjct: 695  RYKQ---QRLLTVLPSLLDKK-KSVVSSPR 720



>gb:ARMIL2_2143484 Artificial mouse mIL2 gene for interleukin 2.
          Length = 150

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 31/112 (27%), Positives = 51/112 (45%), Gaps = 2/112 (1%)
 Frame = +2

Query: 470 SKKKQSSTAEVQSSLTQEIMQLEKRLQTQVAVRCALEKALGYRS--TCQKTADEISIPKP 643
           S    SSTAE Q    Q+  Q +   Q  + ++  L +   YR+    +    +  +PK 
Sbjct: 5   SSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKLPRMLTFKFYLPKQ 64

Query: 644 ATELIREIAVLEFEVGHLEQYLLSLYRKAFDQQISTSSPSRIDDKLKSLVGT 799
           ATEL +++  LE E+G L   L     K+F  + + +  S I   +  L G+
Sbjct: 65  ATEL-KDLQCLEDELGPLRHVLDLTQSKSFQLEDAENFISNIRVTVVKLKGS 115



>gb:AB128049_1873956 Macaca mulatta genes, MHC class I region,
           partial and complete cds.
          Length = 756

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 38/150 (25%), Positives = 66/150 (44%), Gaps = 18/150 (12%)
 Frame = +2

Query: 410 SPEASPELKLDMEHSDDCFESKKKQSSTAEVQSSLTQEIMQLEKRLQ------------- 550
           S E +  L+ ++    D +  +  Q   AEV++ L +++   E+RL              
Sbjct: 553 STEEAASLRQELTQQQDLYR-QALQEKVAEVETRLREQLSDTERRLNEARREHAKAVVSL 611

Query: 551 TQVAVRCALEKALGYRSTCQKTADEISIPKPATELIREIAVLEFEVGHL-----EQYLLS 715
            Q+  R A EK    RS   +   E +  +    L R +  LE +   +     ++ LLS
Sbjct: 612 RQIQRRAAQEKE---RSQELRRLQEEARKEEGQRLARRLQELERDKNLMLATLQQEGLLS 668

Query: 716 LYRKAFDQQISTSSPSRIDDKLKSLVGTPR 805
            Y++   Q++    PS +D K KS+V +PR
Sbjct: 669 RYKQ---QRLLAVLPSLLDKK-KSVVSSPR 694



>gb:LMFL7069_1388340 Leishmania major Friedlin chromosome 21 cosmid
            L7069.
          Length = 2026

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 31/141 (21%), Positives = 55/141 (39%)
 Frame = +2

Query: 341  TCTHKRSKSFPDSVKTGHDSFRCSPEASPELKLDMEHSDDCFESKKKQSSTAEVQSSLTQ 520
            +C   RS+  P +   G+D+   +     ++ +  E       + ++  + A   S+   
Sbjct: 1086 SCASSRSQR-PGAAHKGNDNDVSASAGGAKVTVAAEKQRHASHALEQAHAEASTTSNEVA 1144

Query: 521  EIMQLEKRLQTQVAVRCALEKALGYRSTCQKTADEISIPKPATELIREIAVLEFEVGHLE 700
                  K       +   L  A   R T    A   S P  A EL R +AV E +   LE
Sbjct: 1145 SASAFIKSSSNSATLPSRLSTAQQQRQTAP--AAPASPPSRAEELQRSLAVAEAKAARLE 1202

Query: 701  QYLLSLYRKAFDQQISTSSPS 763
            Q  + L ++ +  ++S  SP+
Sbjct: 1203 QLTVQLKKRLWMAELSRLSPT 1223



>pir|T05193|T05193 hypothetical protein F4I10.60 - Arabidopsis
           thaliana>gb:ATCHRIV79_1547233 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 79.>gb:ATF4I10_1550695
           Arabidopsis thaliana DNA chromosome 4, BAC clone F4I10
           (ESSA project).
          Length = 125

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 21/66 (31%), Positives = 37/66 (56%)
 Frame = +2

Query: 521 EIMQLEKRLQTQVAVRCALEKALGYRSTCQKTADEISIPKPATELIREIAVLEFEVGHLE 700
           +I +L+++LQ ++ +R AL  A+ + S+      +     P  EL+  +A+LE  V  LE
Sbjct: 3   QIKRLQQQLQEEINLRLALTSAVEHSSS---PFMDSPCELPDKELLDSLAILEITVSKLE 59

Query: 701 QYLLSL 718
           Q  +SL
Sbjct: 60  QESVSL 65



>sp|P04351|IL2_MOUSE Interleukin-2 precursor (IL-2) (T-cell growth
           factor) (TCGF).>pir|A93550|ICMS2 interleukin-2 precursor
           - mouse>gb:AF065914_2053147 Mus musculus strain C57BL/6J
           interleukin-2 precursor (Il2) mRNA, complete
           cds.>gb:AF195956_2058706 Mus musculus interleukin-2
           (Il2) gene, complete cds; and testis nuclear RNA-binding
           protein (Tenr) gene, partial cds.>gb:MMIL04_2116095
           Mouse mRNA for interleukin-2 (IL-2).>gb:MUSIL2T_2128499
           Mouse interleukin-2 mRNA, complete cds.
          Length = 169

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 31/112 (27%), Positives = 51/112 (45%), Gaps = 2/112 (1%)
 Frame = +2

Query: 470 SKKKQSSTAEVQSSLTQEIMQLEKRLQTQVAVRCALEKALGYRS--TCQKTADEISIPKP 643
           S    SSTAE Q    Q+  Q +   Q  + ++  L +   YR+    +    +  +PK 
Sbjct: 24  SSSTSSSTAEAQQQQQQQQQQQQHLEQLLMDLQELLSRMENYRNLKLPRMLTFKFYLPKQ 83

Query: 644 ATELIREIAVLEFEVGHLEQYLLSLYRKAFDQQISTSSPSRIDDKLKSLVGT 799
           ATEL +++  LE E+G L   L     K+F  + + +  S I   +  L G+
Sbjct: 84  ATEL-KDLQCLEDELGPLRHVLDLTQSKSFQLEDAENFISNIRVTVVKLKGS 134


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 913,264,243
Number of Sequences: 1806583
Number of extensions: 19464102
Number of successful extensions: 56580
Number of sequences better than 10.0: 63
Number of HSP's better than 10.0 without gapping: 53837
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 56445
length of database: 581,917,975
effective HSP length: 123
effective length of database: 359,708,266
effective search space used: 53596531634
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)