BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig4775
         (555 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AK085114_1174419 Mus musculus 13 days embryo lung cDNA, RIKEN...    36   0.35    
sp|P52592|EDG5_MOUSE|EDG5_MOUSE Sphingosine 1-phosphate receptor Edg-5 (S1P...    36   0.35    Mus musculus [mouse]
gb:AF441397_1800111 Candida albicans putative transcription fact...    35   0.78    
gb:AP003247_1826203 Oryza sativa (japonica cultivar-group) genom...    35   1.0     
sp|P47752|EDG5_RAT|EDG5_RAT Sphingosine 1-phosphate receptor Edg-5 (S1P r...    33   2.3     Rattus norvegicus [brown rat]
gb:AY261359_2319383 Bovine herpesvirus 5 strain SV507/99, comple...    32   5.1     
gb:AE017175_397371 Porphyromonas gingivalis W83 section 4 of 8 o...    32   5.1     
gb:AP004117_1837803 Oryza sativa (japonica cultivar-group) genom...    32   6.6     
pir|T48707|T48707 related to regulatory protein wetA [imported] ...    32   6.6     Neurospora crassa
gb:AE016820_1749662 Ashbya gossypii (= Eremothecium gossypii) AT...    32   8.6     
gb:AE016873_354158 Pseudomonas syringae pv. tomato str. DC3000 s...    32   8.6     


>gb:AK085114_1174419 Mus musculus 13 days embryo lung cDNA, RIKEN
           full-length enriched library, clone:D430039A03
           product:endothelial differentiation, sphingolipid
           G-protein-coupled receptor, 5, full insert sequence.
          Length = 352

 Score = 36.2 bits (82), Expect = 0.35
 Identities = 17/34 (50%), Positives = 21/34 (61%)
 Frame = +3

Query: 207 RDVMTPTAECWRRWWTTTGLRGGNPPHKFWKSRS 308
           R+V+ P  +CWRR    TG RGGNP H+    RS
Sbjct: 297 REVLRPL-QCWRRGKGVTGRRGGNPGHRLLPLRS 329



>sp|P52592|EDG5_MOUSE Sphingosine 1-phosphate receptor Edg-5 (S1P
           receptor Edg-5) (Lysophospholipid receptor B2)
           (Endothelial differentiation G-protein coupled receptor
           5).>gb:AF108020_2054738 Mus musculus lysophospholipid
           receptor B2 (lpb2) gene, complete cds.
          Length = 352

 Score = 36.2 bits (82), Expect = 0.35
 Identities = 17/34 (50%), Positives = 21/34 (61%)
 Frame = +3

Query: 207 RDVMTPTAECWRRWWTTTGLRGGNPPHKFWKSRS 308
           R+V+ P  +CWRR    TG RGGNP H+    RS
Sbjct: 297 REVLRPL-QCWRRGKGVTGRRGGNPGHRLLPLRS 329



>gb:AF441397_1800111 Candida albicans putative transcription factor
            protein (TF) gene, complete cds.
          Length = 1078

 Score = 35.0 bits (79), Expect = 0.78
 Identities = 26/81 (32%), Positives = 42/81 (51%), Gaps = 7/81 (8%)
 Frame = +2

Query: 332  SWPQKDNPLSLNQALPLMNLIHVKPSSSPPPRTAPFTLA-GTDLS--PESNL----IHQG 490
            S PQ +  +++ Q LP+ +   V P   PPP  AP  +A  T+LS  P+SNL     +  
Sbjct: 976  SQPQTETDIAVPQ-LPIQHSSSVSPPQPPPPPPAPVIMADATNLSNDPKSNLPLPQYYNP 1034

Query: 491  FQVVSPLITMEEAHQGLSLSL 553
            +Q + P+   E+  +G +  L
Sbjct: 1035 YQPMPPIFGNEDKDRGAAHDL 1055



>gb:AP003247_1826203 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0425G02.>gb:AP003260_1826576 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0468B07.
          Length = 401

 Score = 34.7 bits (78), Expect = 1.0
 Identities = 16/47 (34%), Positives = 29/47 (61%)
 Frame = +2

Query: 245 MVDNYRSAWRKSAAQVLEEQIQASSYGGRSWPQKDNPLSLNQALPLM 385
           M ++  SAW + + Q+   QI ++   G +WP+++N  +L Q LPL+
Sbjct: 1   MAESSESAWPQQSQQL---QISSTMPAGSAWPEEENLENLEQPLPLL 44



>sp|P47752|EDG5_RAT Sphingosine 1-phosphate receptor Edg-5 (S1P
           receptor Edg-5) (G protein-coupled receptor H218)
           (AGR16) (Endothelial differentiation G- protein coupled
           receptor 5).>pir|JC1465|JC1465 probable G
           protein-coupled receptor - rat>gb:AX085544_1460993
           Sequence 7 from Patent WO0112838.>gb:AB016931_2043935
           Rattus norvegicus mRNA for AGR16, complete
           cds.>gb:AF022138_2051155 Rattus norvegicus
           lysosphingolipid receptor (h218) mRNA, partial
           cds.>gb:RNU10699_2136844 Rattus norvegicus G-protein
           coupled receptor pH218 mRNA, complete cds.
          Length = 352

 Score = 33.5 bits (75), Expect = 2.3
 Identities = 16/34 (47%), Positives = 20/34 (58%)
 Frame = +3

Query: 207 RDVMTPTAECWRRWWTTTGLRGGNPPHKFWKSRS 308
           R+V+ P   CWR+    TG RGGNP H+    RS
Sbjct: 297 REVLRPLL-CWRQGKGATGRRGGNPGHRLLPLRS 329



>gb:AY261359_2319383 Bovine herpesvirus 5 strain SV507/99, complete
            genome.
          Length = 3204

 Score = 32.3 bits (72), Expect = 5.1
 Identities = 18/48 (37%), Positives = 22/48 (45%)
 Frame = +2

Query: 329  RSWPQKDNPLSLNQALPLMNLIHVKPSSSPPPRTAPFTLAGTDLSPES 472
            R+ P+K  P +L    PL       P + PPP   P T AG   SP S
Sbjct: 2634 RTGPRKSMPAALPWRRPLPAAPPAAPRTHPPPAALPPTAAGAAASPAS 2681



>gb:AE017175_397371 Porphyromonas gingivalis W83 section 4 of 8 of
           the complete genome.>gb:AE015924_1032982 Porphyromonas
           gingivalis W83 complete genome.
          Length = 447

 Score = 32.3 bits (72), Expect = 5.1
 Identities = 25/102 (24%), Positives = 44/102 (43%), Gaps = 3/102 (2%)
 Frame = +2

Query: 245 MVDNYRSAWRKSAAQVLEEQIQASSYGGRSWPQKDNPLSLNQA---LPLMNLIHVKPSSS 415
           ++D  R  W+  + +  +++I+A   G  + P K NP+    A   L + N I    S  
Sbjct: 267 LIDLCRDFWQYISMEYFKQKIKAGEVGSSAMPHKVNPIDYENAEGNLGIANAIFEHLS-- 324

Query: 416 PPPRTAPFTLAGTDLSPESNLIHQGFQVVSPLITMEEAHQGL 541
              R  P +    DL+  + L + G  +   LI +    +GL
Sbjct: 325 ---RKLPISRLQRDLTDSTVLRNVGTPLAHSLIAVTSIAKGL 363



>gb:AP004117_1837803 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1134_F06.
          Length = 792

 Score = 32.0 bits (71), Expect = 6.6
 Identities = 25/75 (33%), Positives = 38/75 (50%), Gaps = 8/75 (10%)
 Frame = +2

Query: 251 DNYRSAWRKSAAQVL----EEQIQASSYGGRSWPQKDNPLSL---NQALPLMNLIHVKPS 409
           D +  +  ++A Q L    EEQ+ AS+  G + P    P+ L    Q LPL+N+   +PS
Sbjct: 510 DGHSGSIGRTATQALSMGGEEQVDASNVPGPA-PLPRPPMPLLRPPQPLPLVNVPRFQPS 568

Query: 410 SSP-PPRTAPFTLAG 451
           + P PP   P  + G
Sbjct: 569 AMPYPPHQQPHLMQG 583



>pir|T48707|T48707 related to regulatory protein wetA [imported] -
           Neurospora crassa>gb:NC1A9_1688444 Neurospora crassa DNA
           linkage group V Cosmid contig 1A9.
          Length = 963

 Score = 32.0 bits (71), Expect = 6.6
 Identities = 15/42 (35%), Positives = 22/42 (52%)
 Frame = -3

Query: 280 GFPPRRPVVVHHLRQHSAVGVITSRWRVSFKPSMNSHHHLSE 155
           G+PP  P+  HHL+ H   G  +    +S  P  + HHH S+
Sbjct: 766 GYPPMPPLPAHHLQAHHGPGASS----LSPPPPPHHHHHPSK 803



>gb:AE016820_1749662 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome VII, complete sequence.
          Length = 984

 Score = 31.6 bits (70), Expect = 8.6
 Identities = 17/64 (26%), Positives = 28/64 (43%)
 Frame = +3

Query: 177  FMEGLKETRHRDVMTPTAECWRRWWTTTGLRGGNPPHKFWKSRSKLPAMAADHGLRKIIH 356
            F + ++ET  RD M   A+    +W      GG       KS + +P  A +  ++  +H
Sbjct: 877  FAQAMEETSKRDEMLNQADSAEVYWDQHHRNGGEETLNVSKSMTSIPLQAQNSLIKSAVH 936

Query: 357  SH*T 368
            S  T
Sbjct: 937  SQAT 940



>gb:AE016873_354158 Pseudomonas syringae pv. tomato str. DC3000
           section 18 of 21 of the complete
           genome.>gb:AE016853_1039333 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 445

 Score = 31.6 bits (70), Expect = 8.6
 Identities = 15/67 (22%), Positives = 35/67 (52%), Gaps = 7/67 (10%)
 Frame = +2

Query: 245 MVDNYRSAWRKS-------AAQVLEEQIQASSYGGRSWPQKDNPLSLNQALPLMNLIHVK 403
           ++DN+R+  + +       A  +L ++ + + Y   +WP+ D PLS ++ + L +L+  +
Sbjct: 338 VLDNFRAILKYNNSTSYALAISLLSDRFKGAGYVVGAWPRADTPLSRSERIELQSLLSAR 397

Query: 404 PSSSPPP 424
              +  P
Sbjct: 398 QYDAGAP 404


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 670,153,854
Number of Sequences: 1806583
Number of extensions: 15331369
Number of successful extensions: 42167
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 40402
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 42147
length of database: 581,917,975
effective HSP length: 117
effective length of database: 370,547,764
effective search space used: 24826700188
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)