BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig4760
         (708 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:CEF10C2_1362192 Caenorhabditis elegans cosmid F10C2, complete...    33   5.0     
pir|T20704|T20704 hypothetical protein R07B7.2 - Caenorhabditis ...    33   5.0     Caenorhabditis elegans [roundworm]
gb:AK129191_2069422 Mus musculus mRNA for mKIAA0687 protein.           32   8.5     
gb:AY834276_1965013 Homo sapiens mitogen-activated protein kinas...    32   8.5     
gb:AY212247_1939418 Homo sapiens Ste20 group protein kinase HGK ...    32   8.5     
gb:AF096300_1882786 Homo sapiens HPK/GCK-like kinase HGK mRNA, c...    32   8.5     
gb:AB014587_1864616 Homo sapiens mRNA for KIAA0687 protein, part...    32   8.5     
gb:CQ782869_1452188 Sequence 3009 from Patent EP1396543.               32   8.5     
gb:HSM802392_1186694 Homo sapiens mRNA; cDNA DKFZp434A025 (from ...    32   8.5     
pir|T46481|T46481 hypothetical protein DKFZp434A025.1 - human (f...    32   8.5     Homo sapiens [man]
sp|P97820|M4K4_MOUSE|M4K4_MOUSE Mitogen-activated protein kinase kinase kin...    32   8.5     Mus musculus [mouse]
sp|O95819|M4K4_HUMAN|M4K4_HUMAN Mitogen-activated protein kinase kinase kin...    32   8.5     Homo sapiens [man]


>gb:CEF10C2_1362192 Caenorhabditis elegans cosmid F10C2, complete
           sequence.>gb:CER07B7_1366580 Caenorhabditis elegans
           cosmid R07B7, complete sequence.
          Length = 651

 Score = 33.1 bits (74), Expect = 5.0
 Identities = 27/93 (29%), Positives = 37/93 (39%), Gaps = 9/93 (9%)
 Frame = -1

Query: 666 SPQSL*STPSKSMNIKNSMKYRYIEP*IINSGVCEKNLRHIREFKTAKRQRRTPNQQIRR 487
           SP +  S    S+ I   MK   +EP     G   KN R+    +T K+  +TP+  I +
Sbjct: 552 SPHTSRSRYGSSVAISTGMKRARLEPSQSPPGSSRKNSRN----ETTKKNSKTPSSTIDK 607

Query: 486 ERLCSKRRR---------WEGRKEHRFREPVRW 415
           E   SKR R         W   +    R   RW
Sbjct: 608 EPTSSKRTRKAPARYEAEWNAEQGGDTRRAKRW 640



>pir|T20704|T20704 hypothetical protein R07B7.2 - Caenorhabditis
           elegans
          Length = 710

 Score = 33.1 bits (74), Expect = 5.0
 Identities = 27/93 (29%), Positives = 37/93 (39%), Gaps = 9/93 (9%)
 Frame = -1

Query: 666 SPQSL*STPSKSMNIKNSMKYRYIEP*IINSGVCEKNLRHIREFKTAKRQRRTPNQQIRR 487
           SP +  S    S+ I   MK   +EP     G   KN R+    +T K+  +TP+  I +
Sbjct: 611 SPHTSRSRYGSSVAISTGMKRARLEPSQSPPGSSRKNSRN----ETTKKNSKTPSSTIDK 666

Query: 486 ERLCSKRRR---------WEGRKEHRFREPVRW 415
           E   SKR R         W   +    R   RW
Sbjct: 667 EPTSSKRTRKAPARYEAEWNAEQGGDTRRAKRW 699



>gb:AK129191_2069422 Mus musculus mRNA for mKIAA0687 protein.
          Length = 1255

 Score = 32.3 bits (72), Expect = 8.5
 Identities = 29/97 (29%), Positives = 43/97 (44%), Gaps = 3/97 (3%)
 Frame = -1

Query: 564 EKNLRHIREFKT---AKRQRRTPNQQIRRERLCSKRRRWEGRKEHRFREPVRWMXXXXXX 394
           E+ LR   E+K    A+RQ+R   Q+ +R RL  ++RR    +  + RE  R        
Sbjct: 304 EQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREARRQQEREQRR-------- 355

Query: 393 XXXXXXXXXXXEPVEKRVVTQKERRQMESEPERTLEK 283
                      E  EKR + + ERR+ E E  R  E+
Sbjct: 356 ----------REQEEKRRLEELERRRKEEEERRRAEE 382



>gb:AY834276_1965013 Homo sapiens mitogen-activated protein kinase
           kinase kinase kinase 4 isoform (MAP4K4) mRNA, complete
           cds, alternatively spliced.
          Length = 1042

 Score = 32.3 bits (72), Expect = 8.5
 Identities = 29/97 (29%), Positives = 43/97 (44%), Gaps = 3/97 (3%)
 Frame = -1

Query: 564 EKNLRHIREFKT---AKRQRRTPNQQIRRERLCSKRRRWEGRKEHRFREPVRWMXXXXXX 394
           E+ LR   E+K    A+RQ+R   Q+ +R RL  ++RR    +  + RE  R        
Sbjct: 231 EQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREARRQQEREQRR-------- 282

Query: 393 XXXXXXXXXXXEPVEKRVVTQKERRQMESEPERTLEK 283
                      E  EKR + + ERR+ E E  R  E+
Sbjct: 283 ----------REQEEKRRLEELERRRKEEEERRRAEE 309



>gb:AY212247_1939418 Homo sapiens Ste20 group protein kinase HGK
           mRNA, complete cds, alternatively spliced.
          Length = 1239

 Score = 32.3 bits (72), Expect = 8.5
 Identities = 29/97 (29%), Positives = 43/97 (44%), Gaps = 3/97 (3%)
 Frame = -1

Query: 564 EKNLRHIREFKT---AKRQRRTPNQQIRRERLCSKRRRWEGRKEHRFREPVRWMXXXXXX 394
           E+ LR   E+K    A+RQ+R   Q+ +R RL  ++RR    +  + RE  R        
Sbjct: 378 EQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREARRQQEREQRR-------- 429

Query: 393 XXXXXXXXXXXEPVEKRVVTQKERRQMESEPERTLEK 283
                      E  EKR + + ERR+ E E  R  E+
Sbjct: 430 ----------REQEEKRRLEELERRRKEEEERRRAEE 456



>gb:AF096300_1882786 Homo sapiens HPK/GCK-like kinase HGK mRNA,
           complete cds.
          Length = 1165

 Score = 32.3 bits (72), Expect = 8.5
 Identities = 29/97 (29%), Positives = 43/97 (44%), Gaps = 3/97 (3%)
 Frame = -1

Query: 564 EKNLRHIREFKT---AKRQRRTPNQQIRRERLCSKRRRWEGRKEHRFREPVRWMXXXXXX 394
           E+ LR   E+K    A+RQ+R   Q+ +R RL  ++RR    +  + RE  R        
Sbjct: 378 EQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREARRQQEREQRR-------- 429

Query: 393 XXXXXXXXXXXEPVEKRVVTQKERRQMESEPERTLEK 283
                      E  EKR + + ERR+ E E  R  E+
Sbjct: 430 ----------REQEEKRRLEELERRRKEEEERRRAEE 456



>gb:AB014587_1864616 Homo sapiens mRNA for KIAA0687 protein, partial
           cds.
          Length = 1175

 Score = 32.3 bits (72), Expect = 8.5
 Identities = 29/97 (29%), Positives = 43/97 (44%), Gaps = 3/97 (3%)
 Frame = -1

Query: 564 EKNLRHIREFKT---AKRQRRTPNQQIRRERLCSKRRRWEGRKEHRFREPVRWMXXXXXX 394
           E+ LR   E+K    A+RQ+R   Q+ +R RL  ++RR    +  + RE  R        
Sbjct: 341 EQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREARRQQEREQRR-------- 392

Query: 393 XXXXXXXXXXXEPVEKRVVTQKERRQMESEPERTLEK 283
                      E  EKR + + ERR+ E E  R  E+
Sbjct: 393 ----------REQEEKRRLEELERRRKEEEERRRAEE 419



>gb:CQ782869_1452188 Sequence 3009 from Patent EP1396543.
          Length = 367

 Score = 32.3 bits (72), Expect = 8.5
 Identities = 29/97 (29%), Positives = 43/97 (44%), Gaps = 3/97 (3%)
 Frame = -1

Query: 564 EKNLRHIREFKT---AKRQRRTPNQQIRRERLCSKRRRWEGRKEHRFREPVRWMXXXXXX 394
           E+ LR   E+K    A+RQ+R   Q+ +R RL  ++RR    +  + RE  R        
Sbjct: 184 EQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREARRQQEREQRR-------- 235

Query: 393 XXXXXXXXXXXEPVEKRVVTQKERRQMESEPERTLEK 283
                      E  EKR + + ERR+ E E  R  E+
Sbjct: 236 ----------REQEEKRRLEELERRRKEEEERRRAEE 262



>gb:HSM802392_1186694 Homo sapiens mRNA; cDNA DKFZp434A025 (from
           clone DKFZp434A025).
          Length = 1059

 Score = 32.3 bits (72), Expect = 8.5
 Identities = 29/97 (29%), Positives = 43/97 (44%), Gaps = 3/97 (3%)
 Frame = -1

Query: 564 EKNLRHIREFKT---AKRQRRTPNQQIRRERLCSKRRRWEGRKEHRFREPVRWMXXXXXX 394
           E+ LR   E+K    A+RQ+R   Q+ +R RL  ++RR    +  + RE  R        
Sbjct: 117 EQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREARRQQEREQRR-------- 168

Query: 393 XXXXXXXXXXXEPVEKRVVTQKERRQMESEPERTLEK 283
                      E  EKR + + ERR+ E E  R  E+
Sbjct: 169 ----------REQEEKRRLEELERRRKEEEERRRAEE 195



>pir|T46481|T46481 hypothetical protein DKFZp434A025.1 - human
           (fragment)
          Length = 1027

 Score = 32.3 bits (72), Expect = 8.5
 Identities = 29/97 (29%), Positives = 43/97 (44%), Gaps = 3/97 (3%)
 Frame = -1

Query: 564 EKNLRHIREFKT---AKRQRRTPNQQIRRERLCSKRRRWEGRKEHRFREPVRWMXXXXXX 394
           E+ LR   E+K    A+RQ+R   Q+ +R RL  ++RR    +  + RE  R        
Sbjct: 117 EQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREARRQQEREQRR-------- 168

Query: 393 XXXXXXXXXXXEPVEKRVVTQKERRQMESEPERTLEK 283
                      E  EKR + + ERR+ E E  R  E+
Sbjct: 169 ----------REQEEKRRLEELERRRKEEEERRRAEE 195



>sp|P97820|M4K4_MOUSE Mitogen-activated protein kinase kinase kinase
           kinase 4 (EC 2.7.1.37) (MAPK/ERK kinase kinase kinase 4)
           (MEK kinase kinase 4) (MEKKK 4) (HPK/GCK-like kinase
           HGK) (Nck interacting kinase).>pir|T30989|T30989
           serine/threonine protein kinase NIK -
           mouse>gb:MMU88984_2123856 Mus musculus NIK mRNA,
           complete cds.
          Length = 1233

 Score = 32.3 bits (72), Expect = 8.5
 Identities = 29/97 (29%), Positives = 43/97 (44%), Gaps = 3/97 (3%)
 Frame = -1

Query: 564 EKNLRHIREFKT---AKRQRRTPNQQIRRERLCSKRRRWEGRKEHRFREPVRWMXXXXXX 394
           E+ LR   E+K    A+RQ+R   Q+ +R RL  ++RR    +  + RE  R        
Sbjct: 377 EQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREARRQQEREQRR-------- 428

Query: 393 XXXXXXXXXXXEPVEKRVVTQKERRQMESEPERTLEK 283
                      E  EKR + + ERR+ E E  R  E+
Sbjct: 429 ----------REQEEKRRLEELERRRKEEEERRRAEE 455



>sp|O95819|M4K4_HUMAN Mitogen-activated protein kinase kinase kinase
           kinase 4 (EC 2.7.1.37) (MAPK/ERK kinase kinase kinase 4)
           (MEK kinase kinase 4) (MEKKK 4) (HPK/GCK-like kinase
           HGK) (Nck interacting kinase).
          Length = 1239

 Score = 32.3 bits (72), Expect = 8.5
 Identities = 29/97 (29%), Positives = 43/97 (44%), Gaps = 3/97 (3%)
 Frame = -1

Query: 564 EKNLRHIREFKT---AKRQRRTPNQQIRRERLCSKRRRWEGRKEHRFREPVRWMXXXXXX 394
           E+ LR   E+K    A+RQ+R   Q+ +R RL  ++RR    +  + RE  R        
Sbjct: 378 EQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREARRQQEREQRR-------- 429

Query: 393 XXXXXXXXXXXEPVEKRVVTQKERRQMESEPERTLEK 283
                      E  EKR + + ERR+ E E  R  E+
Sbjct: 430 ----------REQEEKRRLEELERRRKEEEERRRAEE 456


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 386,384,881
Number of Sequences: 1806583
Number of extensions: 5432478
Number of successful extensions: 17547
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 16867
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17479
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 41418643248
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)