BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig4600
         (731 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:A83552_1450985 Sequence 1 from Patent WO9849330.                   258   1e-67   
sp|O24133|CHLD_TOBAC|CHLD_TOBAC Magnesium-chelatase subunit chlD, chloropla...   257   1e-67   Nicotiana tabacum [American tobacco]
sp|O22437|CHLD_PEA|CHLD_PEA Magnesium-chelatase subunit chlD, chloroplast...   248   8e-65   Pisum sativum [garden pea]
gb:BT002406_1636009 Arabidopsis thaliana Mg-chelatase, putative ...   246   3e-64   
gb:AX765812_1474595 Sequence 21 from Patent WO03008440.>gb:AY063...   246   3e-64   
pir|B86218|B86218 protein T27G7.20 [imported] - Arabidopsis thal...   246   3e-64   Arabidopsis thaliana [mouse-ear cress]
sp|Q9SJE1|CHLD_ARATH|CHLD_ARATH Magnesium-chelatase subunit chlD, chloropla...   246   3e-64   Arabidopsis thaliana [mouse-ear cress]
gb:AF083555_1766894 Arabidopsis thaliana magnesium-chelatase sub...   245   5e-64   
gb:AC137507_1743420 Oryza sativa chromosome 3 BAC OSJNBb0033J23 ...   239   3e-62   
gb:AC135595_1742648 Oryza sativa chromosome 3 BAC OSJNBa0028F23 ...   239   3e-62   
pir|AF1841|AF1841 Mg chelatase chain [imported] - Nostoc sp. (st...   182   5e-45   Nostoc sp. PCC 7120
pir|T46870|T46870 protoporphyrin IX magnesium chelatase (EC 4.99...   163   3e-39   Synechocystis sp. PCC 6803
sp|P72772|CHLD_SYNY3|CHLD_SYNY3 Magnesium-chelatase subunit chlD (EC 6.6.1....   163   3e-39   Synechocystis sp.
gb:BA000039_727197 Thermosynechococcus elongatus BP-1 DNA, compl...   160   2e-38   
gb:AP008231_581520 Synechococcus elongatus PCC 6301 DNA, complet...   147   2e-34   
sp|O07345|CHLD_SYNP7|CHLD_SYNP7 Magnesium-chelatase subunit chlD (EC 6.6.1....   147   2e-34   Synechococcus sp.
gb:BX569689_775115 Synechococcus sp. WH8102 complete genome; seg...   144   1e-33   
gb:AE017162_394777 Prochlorococcus marinus subsp. marinus str. C...   142   6e-33   
gb:BA000045_740945 Gloeobacter violaceus PCC 7421 DNA, complete ...   140   2e-32   
gb:BX572100_799229 Prochlorococcus marinus MIT9313 complete geno...   131   1e-29   
gb:BX572090_795914 Prochlorococcus marinus MED4 complete genome;...   120   2e-26   
sp|Q9ZGE6|BCHD_HELMO|BCHD_HELMO Magnesium-chelatase 67 kDa subunit (EC 6.6....   119   6e-26   Heliobacillus mobilis
gb:BX572098_798477 Prochlorococcus marinus MIT9313 complete geno...   114   2e-24   
sp|Q9TL08|CHLI_NEPOL|CHLI_NEPOL Magnesium-chelatase subunit chlI (EC 6.6.1....   114   2e-24   Nephroselmis olivacea
gb:BX569691_775618 Synechococcus sp. WH8102 complete genome; seg...   113   3e-24   
gb:AY673996_1621553 Gracilaria tenuistipitata var. liui chloropl...   112   5e-24   
gb:AL646079_548995 Ralstonia solanacearum GMI1000 megaplasmid, c...   112   5e-24   
sp|Q94FT3|CHLI_CHLRE|CHLI_CHLRE Magnesium-chelatase subunit chlI, chloropla...   112   5e-24   Chlamydomonas reinhardtii
gb:AB002583_1508738 Cyanidioschyzon merolae chloroplast DNA, com...   112   7e-24   
sp|P58571|CHLI_ANASP|CHLI_ANASP Magnesium-chelatase subunit chlI (EC 6.6.1....   112   9e-24   Anabaena sp.
gb:AE017164_395602 Prochlorococcus marinus subsp. marinus str. C...   111   2e-23   
gb:BA000039_727295 Thermosynechococcus elongatus BP-1 DNA, compl...   110   3e-23   
gb:BX572597_801120 Rhodopseudomonas palustris CGA009 complete ge...   110   3e-23   
sp|P31205|CHLI_EUGGR|CHLI_EUGGR Magnesium-chelatase subunit chlI (EC 6.6.1....   110   3e-23   Euglena gracilis
gb:AF494278_1805204 Chaetosphaeridium globosum chloroplast, comp...   108   8e-23   
gb:AC084767_1733793 Oryza sativa chromosome 3 BAC OSJNBb0057P11 ...   108   8e-23   
gb:AB016870_1512884 Arabidopsis thaliana genomic DNA, chromosome...   108   8e-23   
sp|P16127|CHLI_ARATH|CHLI_ARATH Magnesium-chelatase subunit chlI, chloropla...   108   8e-23   Arabidopsis thaliana [mouse-ear cress]
pir|T46868|T46868 protoporphyrin IX magnesium chelatase (EC 4.99...   108   1e-22   Synechocystis sp. PCC 6803
sp|P51634|CHLI_SYNY3|CHLI_SYNY3 Magnesium-chelatase subunit chlI (EC 6.6.1....   108   1e-22   Synechocystis sp.
sp|P51394|CHLI_PORPU|CHLI_PORPU Magnesium-chelatase subunit chlI (EC 6.6.1....   108   1e-22   Porphyra purpurea
gb:BT015783_1642401 Arabidopsis thaliana At5g45930 mRNA, complet...   107   2e-22   
gb:AY140022_1582462 Arabidopsis thaliana magnesium chelatase sub...   107   2e-22   
gb:AY616113_1178748 Prototheca wickerhamii plastid Mg chelatase ...   107   2e-22   
sp|Q93SW1|BCHI_CHLTE|BCHI_CHLTE Magnesium-chelatase 38 kDa subunit (EC 6.6....   107   2e-22   Chlorobaculum tepidum
gb:AP008231_580635 Synechococcus elongatus PCC 6301 DNA, complet...   107   3e-22   
gb:AY458639_619477 Uncultured bacterium 442 clone EBAC000-63A02 ...   106   4e-22   
sp|Q9MUT3|CHLI_MESVI|CHLI_MESVI Magnesium-chelatase subunit chlI (EC 6.6.1....   105   6e-22   Mesostigma viride
sp|O50312|BCHI_CHLVI|BCHI_CHLVI Magnesium-chelatase 38 kDa subunit (EC 6.6....   105   6e-22   Prosthecochloris vibrioformis
sp|P56304|CHLI_CHLVU|CHLI_CHLVU Magnesium-chelatase subunit chlI (EC 6.6.1....   105   1e-21   Chlorella vulgaris
sp|Q58321|Y911_METJA|Y911_METJA Magnesium-chelatase subunit chlI homolog.>p...   104   1e-21   Methanocaldococcus jannaschii
sp|P93162|CHLI_SOYBN|CHLI_SOYBN Magnesium-chelatase subunit chlI, chloropla...   104   1e-21   Glycine max [soybeans]
gb:NTU67064_1691888 Nicotiana tabacum sulfur gene (Su-s) mRNA, c...   104   2e-21   
gb:BA000011_665071 Thermoplasma volcanium GSS1 DNA, complete gen...   104   2e-21   
sp|O22436|CHLI_TOBAC|CHLI_TOBAC Magnesium-chelatase subunit chlI, chloropla...   104   2e-21   Nicotiana tabacum [American tobacco]
sp|P49469|CHLI_ODOSI|CHLI_ODOSI Magnesium-chelatase subunit chlI (EC 6.6.1....   104   2e-21   
gb:AE000838_28258 Methanobacterium thermoautotrophicum from base...   103   3e-21   
pir|E69173|E69173 protoporphyrin IX magnesium chelatase (EC 4.99...   103   3e-21   Methanothermobacter thermautotrophicus str. Delta H
gb:BX572092_796681 Prochlorococcus marinus MED4 complete genome;...   102   5e-21   
gb:AE016915_356531 Chromobacterium violaceum ATCC 12472 section ...   102   7e-21   
pir|S04401|S04401 spheroidene monooxygenase - Rhodobacter capsul...   102   7e-21   Rhodobacter capsulatus
sp|P48101|CHLI_CYAPA|CHLI_CYAPA Magnesium-chelatase subunit chlI (EC 6.6.1....   102   9e-21   Cyanophora paradoxa
sp|P26239|BCHI_RHOCA|BCHI_RHOCA Magnesium-chelatase 38 kDa subunit (EC 6.6....   102   9e-21   Rhodobacter capsulatus
gb:AE010752_266252 Methanosarcina acetivorans str. C2A, section ...   101   1e-20   
gb:BA000045_741789 Gloeobacter violaceus PCC 7421 DNA, complete ...   100   2e-20   
gb:TACID2_196346 Thermoplasma acidophilum complete genome; segme...   100   3e-20   
gb:AY458640_619530 Uncultured bacterium 443 clone EBAC000-65D02 ...   100   4e-20   
gb:AE013439_292333 Methanosarcina mazei strain Goe1, section 221...   100   4e-20   
sp|Q39516|CHLI_GUITH|CHLI_GUITH Magnesium-chelatase subunit chlI (EC 6.6.1....   100   5e-20   Guillardia theta
sp|Q9TLX7|CHLI_CYACA|CHLI_CYACA Magnesium-chelatase subunit chlI (EC 6.6.1....   100   5e-20   Cyanidium caldarium
gb:AE008921_246307 Uncultured proteobacterium clone EBAC000-60D0...    98   1e-19   
gb:SCO939110_175525 Streptomyces coelicolor A3(2) complete genom...    97   2e-19   
sp|O30819|BCHI_RHOSH|BCHI_RHOSH Magnesium-chelatase 38 kDa subunit (EC 6.6....    97   2e-19   Rhodobacter sphaeroides
sp|Q32742|CHLI_OLILU|CHLI_OLILU Magnesium-chelatase subunit chlI (EC 6.6.1....    97   3e-19   Olisthodiscus luteus
gb:AF288461_496036 Chloroflexus aurantiacus BchI (bchI) and BchD...    96   5e-19   
gb:RSP010302_168007 Rhodobacter sphaeroides photosynthetic gene ...    96   5e-19   
pir|T50743|T50743 probable protoporphyrin IX magnesium chelatase...    96   5e-19   Rhodobacter sphaeroides 2.4.1
gb:BA000030_704300 Streptomyces avermitilis MA-4680 genomic DNA,...    95   1e-18   
pir|A69159|A69159 protoporphyrin IX magnesium chelatase (EC 4.99...    94   3e-18   Methanothermobacter thermautotrophicus str. Delta H
sp|Q9WXA9|BCHI_ACIRU|BCHI_ACIRU Magnesium-chelatase 38 kDa subunit (EC 6.6....    92   7e-18   Acidiphilium rubrum
gb:AE012819_285909 Chlorobium tepidum TLS section 40 of 194 of t...    90   5e-17   
pir|T31460|T31460 probable magnesium chelatase (EC 4.99.1.-) cha...    89   6e-17   Heliobacillus mobilis
gb:HVU26545_1682606 Hordeum vulgare Mg-chelatase subunit (Xantha...    87   3e-16   
pir|S64722|S64722 protoporphyrin IX magnesium chelatase (EC 4.99...    87   3e-16   Hordeum vulgare [barley]
gb:AE017283_429892 Propionibacterium acnes KPA171202, complete g...    83   4e-15   
sp|Q44498|CHLI_ANAVA|CHLI_ANAVA Magnesium-chelatase subunit chlI (EC 6.6.1....    82   8e-15   
gb:AP006618_560481 Nocardia farcinica IFM 10152 DNA, complete ge...    79   6e-14   
gb:AE012819_285908 Chlorobium tepidum TLS section 40 of 194 of t...    77   3e-13   
gb:AE016867_352547 Pseudomonas syringae pv. tomato str. DC3000 s...    77   4e-13   
gb:AE016787_332921 Pseudomonas putida KT2440 section 14 of 21 of...    77   4e-13   
gb:AE017261_419195 Picrophilus torridus DSM 9790, complete genome.     76   7e-13   
pir|H84309|H84309 protoporphyrin IX magnesium chelatase [importe...    76   7e-13   Halobacterium salinarum
gb:BX248343_760232 Mycobacterium bovis subsp. bovis AF2122/97 co...    75   2e-12   
sp|O05809|YS50_MYCTU|YS50_MYCTU Hypothetical protein Rv2850c/MT2916.>pir|E7...    75   2e-12   Mycobacterium tuberculosis
gb:AE017237_413624 Mycobacterium avium subsp. paratuberculosis s...    74   4e-12   
gb:AE017283_429893 Propionibacterium acnes KPA171202, complete g...    73   6e-12   
gb:AY659213_2148223 Synthetic construct Peudomonas aeruginosa cl...    72   8e-12   
pir|E83278|E83278 probable magnesium chelatase PA2942 [imported]...    72   8e-12   Pseudomonas aeruginosa
gb:AX066025_1459926 Sequence 369 from Patent WO0100842.                72   1e-11   
gb:BA000036_719724 Corynebacterium glutamicum ATCC 13032 DNA, co...    72   1e-11   
gb:AF454055_512597 Corynebacterium glutamicum putative Mg-Chelat...    72   1e-11   
gb:BA000035_716674 Corynebacterium efficiens YS-314 DNA, complet...    70   4e-11   
gb:AY596297_634207 Haloarcula marismortui ATCC 43049 chromosome ...    70   5e-11   
gb:AJ616741_1812022 Nicotiana tabacum partial mRNA for magnesium...    67   3e-10   
gb:NBE571699_1688168 Nicotiana benthamiana partial mRNA for magn...    67   3e-10   
gb:BX571965_791554 Burkholderia pseudomallei strain K96243, chro...    65   2e-09   
sp|O50313|BCHD_CHLVI|BCHD_CHLVI Magnesium-chelatase 67 kDa subunit (EC 6.6....    64   4e-09   Prosthecochloris vibrioformis
sp|Q93SW0|BCHD_CHLTE|BCHD_CHLTE Magnesium-chelatase 67 kDa subunit (EC 6.6....    64   4e-09   Chlorobaculum tepidum
gb:AF288461_496037 Chloroflexus aurantiacus BchI (bchI) and BchD...    63   5e-09   
gb:AE017248_415800 Treponema denticola ATCC 35405, section 3 of ...    61   2e-08   
gb:AE000516_23011 Mycobacterium tuberculosis CDC1551, complete g...    57   3e-07   
gb:AE017248_415799 Treponema denticola ATCC 35405, section 3 of ...    52   8e-06   
gb:AE017283_430576 Propionibacterium acnes KPA171202, complete g...    51   2e-05   
gb:AE017283_430575 Propionibacterium acnes KPA171202, complete g...    47   3e-04   
gb:AP006840_569630 Symbiobacterium thermophilum DNA, complete ge...    45   0.002   
gb:AE010318_261824 Methanopyrus kandleri AV19 section 17 of 157 ...    44   0.004   
gb:SCO939123_178949 Streptomyces coelicolor A3(2) complete genom...    42   0.009   
gb:AE017340_455980 Idiomarina loihiensis L2TR, complete genome.        40   0.043   
pir|F82985|F82985 conserved hypothetical protein PA5290 [importe...    36   0.82    Pseudomonas aeruginosa
gb:CR555306_107178 Azoarcus sp. EbN1 complete genome.                  35   1.8     
sp|P43746|DP3X_HAEIN|DP3X_HAEIN DNA polymerase III subunit gamma/tau (EC 2....    35   1.8     Haemophilus influenzae
gb:AF313480_1261599 Drosophila melanogaster gamma dynein (kl-3) ...    34   3.1     
gb:POL505006_159106 Sorangium cellulosum spiG gene (partial), sp...    34   3.1     
pir|D69430|D69430 conserved hypothetical protein AF1445 - Archae...    34   3.1     Archaeoglobus fulgidus
gb:AY623658_637462 Aeromicrobium erythreum erythromycin biosynth...    33   5.3     
gb:AP006840_567202 Symbiobacterium thermophilum DNA, complete ge...    33   5.3     
gb:AY045575_1935093 Homo sapiens axonemal dynein heavy chain DNA...    33   6.9     
gb:AE016874_354338 Pseudomonas syringae pv. tomato str. DC3000 s...    33   6.9     
gb:STYPPHCM1_194600 Salmonella enterica subsp. enterica serovar ...    33   6.9     
gb:SCO939114_176691 Streptomyces coelicolor A3(2) complete genom...    33   6.9     
gb:POL505006_159105 Sorangium cellulosum spiG gene (partial), sp...    33   6.9     
gb:AB017350_3205 Acidiphilium rubrum bchP, bchI, bchD, crtI gene...    33   6.9     
gb:BA000016_674744 Clostridium perfringens str. 13 DNA, complete...    32   9.0     
gb:SCU24241_181682 Sorangium cellulosum acyl-CoA dehydrogenase (...    32   9.0     
gb:SCO939127_179942 Streptomyces coelicolor A3(2) complete genom...    32   9.0     
gb:RSU86454_168402 Rhodobacter sphaeroides hook length control p...    32   9.0     
pir|JC5009|JC5009 nucleotide-binding protein D - Methanosarcina ...    32   9.0     Methanosarcina mazei


>gb:A83552_1450985 Sequence 1 from Patent WO9849330.
          Length = 758

 Score =  258 bits (658), Expect = 1e-67
 Identities = 129/172 (75%), Positives = 145/172 (84%), Gaps = 7/172 (4%)
 Frame = +2

Query: 224 RPHRLRFRINASA-------NGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLL 382
           RP RL+FR+  SA       NG+V     +   +  ++GRQYFPLAAV+GQDAIKTALLL
Sbjct: 38  RPERLKFRLRISATATIDSPNGAVAVVEPEKQPEKISFGRQYFPLAAVIGQDAIKTALLL 97

Query: 383 GAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRV 562
           GAIDR IGGIAI GKRGTAKT+MARGLHA+LPPIE+V GS++NADP CP+EWEDGLADR 
Sbjct: 98  GAIDREIGGIAICGKRGTAKTLMARGLHAILPPIEVVVGSMANADPNCPDEWEDGLADRA 157

Query: 563 EYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
           EY S GNIKT+I+KSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA
Sbjct: 158 EYGSDGNIKTQIVKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 209



>sp|O24133|CHLD_TOBAC Magnesium-chelatase subunit chlD, chloroplast
           precursor (EC 6.6.1.1) (Mg-protoporphyrin IX chelatase)
           (Mg-chelatase subunit D).>pir|T02925|T02925
           protoporphyrin IX magnesium chelatase (EC 4.99.1.-)
           chain chlD - common tobacco>gb:NTCHLDMGC_1691510
           N.tabacum mRNA for CHLD magnesium chelatase subunit.
          Length = 758

 Score =  257 bits (657), Expect = 1e-67
 Identities = 129/172 (75%), Positives = 145/172 (84%), Gaps = 7/172 (4%)
 Frame = +2

Query: 224 RPHRLRFRINASA-------NGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLL 382
           RP RL+FR+  SA       NG+V     +   +  ++GRQYFPLAAV+GQDAIKTALLL
Sbjct: 38  RPKRLKFRLRISATATIDSPNGAVAVVEPEKQPEKISFGRQYFPLAAVIGQDAIKTALLL 97

Query: 383 GAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRV 562
           GAIDR IGGIAI GKRGTAKT+MARGLHA+LPPIE+V GS++NADP CP+EWEDGLADR 
Sbjct: 98  GAIDREIGGIAICGKRGTAKTLMARGLHAILPPIEVVVGSMANADPNCPDEWEDGLADRA 157

Query: 563 EYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
           EY S GNIKT+I+KSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA
Sbjct: 158 EYGSDGNIKTQIVKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 209



>sp|O22437|CHLD_PEA Magnesium-chelatase subunit chlD, chloroplast
           precursor (EC 6.6.1.1) (Mg-protoporphyrin IX chelatase)
           (Mg-chelatase subunit D).>pir|T06249|T06249
           protoporphyrin IX magnesium chelatase (EC 4.99.1.-) D
           chain - garden pea>gb:AF014399_1761348 Pisum sativum
           Mg-chelatase subunit D (ChlD) mRNA, complete cds.
          Length = 754

 Score =  248 bits (633), Expect = 8e-65
 Identities = 123/154 (79%), Positives = 139/154 (90%)
 Frame = +2

Query: 257 SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT 436
           S NG+V+ A ++   D + YGRQYFPLAAV+GQDAIKTALLLGA D  IGGIAISG+RGT
Sbjct: 54  SENGAVLQASEEKL-DASNYGRQYFPLAAVIGQDAIKTALLLGATDPRIGGIAISGRRGT 112

Query: 437 AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV 616
           AKT+MARG+HA+LPPIE+V+GSI+NADP+CPEEWEDGL  RVEYDS GN+KT IIKSPFV
Sbjct: 113 AKTIMARGMHAILPPIEVVQGSIANADPSCPEEWEDGLYKRVEYDSDGNVKTHIIKSPFV 172

Query: 617 QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
           QIPLGVTEDRLIGSVDVEESVK+GTTVFQPGLLA
Sbjct: 173 QIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLA 206



>gb:BT002406_1636009 Arabidopsis thaliana Mg-chelatase, putative
           (At1g08520) mRNA, partial cds.
          Length = 430

 Score =  246 bits (628), Expect = 3e-64
 Identities = 125/177 (70%), Positives = 143/177 (80%), Gaps = 8/177 (4%)
 Frame = +2

Query: 212 PSGRRPHRLRFRINASANGSVVAAPQKPAA--------DTTAYGRQYFPLAAVVGQDAIK 367
           P   R    RF + ASAN +V +    PA+        DTT+YGRQ+FPLAAVVGQ+ IK
Sbjct: 38  PKRNRIASCRFTVRASANATVESPNGVPASTSDTDTETDTTSYGRQFFPLAAVVGQEGIK 97

Query: 368 TALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDG 547
           TALLLGA+DR IGGIAISG+RGTAKTVMARGLH +LPPIE+V GSISNADP CP+EWED 
Sbjct: 98  TALLLGAVDREIGGIAISGRRGTAKTVMARGLHEILPPIEVVVGSISNADPACPDEWEDD 157

Query: 548 LADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
           L +R+EY++   IKTEI+KSPF+QIPLGVTEDRLIGSVDVEESVK GTTVFQPGLLA
Sbjct: 158 LDERIEYNADNTIKTEIVKSPFIQIPLGVTEDRLIGSVDVEESVKRGTTVFQPGLLA 214



>gb:AX765812_1474595 Sequence 21 from Patent
           WO03008440.>gb:AY063821_1565771 Arabidopsis thaliana
           putative Mg-chelatase (At1g08520) mRNA, complete
           cds.>gb:AY091402_1574605 Arabidopsis thaliana putative
           Mg-chelatase (At1g08520) mRNA, complete cds.
          Length = 760

 Score =  246 bits (628), Expect = 3e-64
 Identities = 125/177 (70%), Positives = 143/177 (80%), Gaps = 8/177 (4%)
 Frame = +2

Query: 212 PSGRRPHRLRFRINASANGSVVAAPQKPAA--------DTTAYGRQYFPLAAVVGQDAIK 367
           P   R    RF + ASAN +V +    PA+        DTT+YGRQ+FPLAAVVGQ+ IK
Sbjct: 36  PKRNRIASCRFTVRASANATVESPNGVPASTSDTDTETDTTSYGRQFFPLAAVVGQEGIK 95

Query: 368 TALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDG 547
           TALLLGA+DR IGGIAISG+RGTAKTVMARGLH +LPPIE+V GSISNADP CP+EWED 
Sbjct: 96  TALLLGAVDREIGGIAISGRRGTAKTVMARGLHEILPPIEVVVGSISNADPACPDEWEDD 155

Query: 548 LADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
           L +R+EY++   IKTEI+KSPF+QIPLGVTEDRLIGSVDVEESVK GTTVFQPGLLA
Sbjct: 156 LDERIEYNADNTIKTEIVKSPFIQIPLGVTEDRLIGSVDVEESVKRGTTVFQPGLLA 212



>pir|B86218|B86218 protein T27G7.20 [imported] - Arabidopsis
           thaliana>gb:AE005172_889857 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC006932_1534863 Genomic sequence for
           Arabidopsis thaliana BAC T27G7 from chromosome I,
           complete sequence.
          Length = 778

 Score =  246 bits (628), Expect = 3e-64
 Identities = 125/177 (70%), Positives = 143/177 (80%), Gaps = 8/177 (4%)
 Frame = +2

Query: 212 PSGRRPHRLRFRINASANGSVVAAPQKPAA--------DTTAYGRQYFPLAAVVGQDAIK 367
           P   R    RF + ASAN +V +    PA+        DTT+YGRQ+FPLAAVVGQ+ IK
Sbjct: 36  PKRNRIASCRFTVRASANATVESPNGVPASTSDTDTETDTTSYGRQFFPLAAVVGQEGIK 95

Query: 368 TALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDG 547
           TALLLGA+DR IGGIAISG+RGTAKTVMARGLH +LPPIE+V GSISNADP CP+EWED 
Sbjct: 96  TALLLGAVDREIGGIAISGRRGTAKTVMARGLHEILPPIEVVVGSISNADPACPDEWEDD 155

Query: 548 LADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
           L +R+EY++   IKTEI+KSPF+QIPLGVTEDRLIGSVDVEESVK GTTVFQPGLLA
Sbjct: 156 LDERIEYNADNTIKTEIVKSPFIQIPLGVTEDRLIGSVDVEESVKRGTTVFQPGLLA 212



>sp|Q9SJE1|CHLD_ARATH Magnesium-chelatase subunit chlD, chloroplast
           precursor (EC 6.6.1.1) (Mg-protoporphyrin IX chelatase)
           (Mg-chelatase subunit D).
          Length = 759

 Score =  246 bits (628), Expect = 3e-64
 Identities = 125/177 (70%), Positives = 143/177 (80%), Gaps = 8/177 (4%)
 Frame = +2

Query: 212 PSGRRPHRLRFRINASANGSVVAAPQKPAA--------DTTAYGRQYFPLAAVVGQDAIK 367
           P   R    RF + ASAN +V +    PA+        DTT+YGRQ+FPLAAVVGQ+ IK
Sbjct: 36  PKRNRIASCRFTVRASANATVESPNGVPASTSDTDTETDTTSYGRQFFPLAAVVGQEGIK 95

Query: 368 TALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDG 547
           TALLLGA+DR IGGIAISG+RGTAKTVMARGLH +LPPIE+V GSISNADP CP+EWED 
Sbjct: 96  TALLLGAVDREIGGIAISGRRGTAKTVMARGLHEILPPIEVVVGSISNADPACPDEWEDD 155

Query: 548 LADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
           L +R+EY++   IKTEI+KSPF+QIPLGVTEDRLIGSVDVEESVK GTTVFQPGLLA
Sbjct: 156 LDERIEYNADNTIKTEIVKSPFIQIPLGVTEDRLIGSVDVEESVKRGTTVFQPGLLA 212



>gb:AF083555_1766894 Arabidopsis thaliana magnesium-chelatase
           subunit CHLD precursor, mRNA, nuclear gene encoding
           chloroplast protein, partial cds.
          Length = 726

 Score =  245 bits (626), Expect = 5e-64
 Identities = 125/177 (70%), Positives = 142/177 (80%), Gaps = 8/177 (4%)
 Frame = +2

Query: 212 PSGRRPHRLRFRINASANGSVVAAPQKPAA--------DTTAYGRQYFPLAAVVGQDAIK 367
           P   R    RF + ASAN +V +    PA+        DTT+YGRQ+FPLAAVVGQ+ IK
Sbjct: 5   PKRNRIASCRFTVRASANATVESPNGVPASTSDTETETDTTSYGRQFFPLAAVVGQEGIK 64

Query: 368 TALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDG 547
           TALLLGA+DR IGGIAISG+RGTAKTVMARGLH +LPPIE+V GSISNADP CP EWED 
Sbjct: 65  TALLLGAVDREIGGIAISGRRGTAKTVMARGLHEILPPIEVVVGSISNADPACPNEWEDD 124

Query: 548 LADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
           L +R+EY++   IKTEI+KSPF+QIPLGVTEDRLIGSVDVEESVK GTTVFQPGLLA
Sbjct: 125 LDERIEYNADNTIKTEIVKSPFIQIPLGVTEDRLIGSVDVEESVKRGTTVFQPGLLA 181



>gb:AC137507_1743420 Oryza sativa chromosome 3 BAC OSJNBb0033J23
           genomic sequence, complete sequence.
          Length = 745

 Score =  239 bits (611), Expect = 3e-62
 Identities = 121/154 (78%), Positives = 135/154 (87%)
 Frame = +2

Query: 257 SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT 436
           S NG++   P         YGR+YFPLAAVVGQDAIKTALLLGAIDR IGGIAISGKRGT
Sbjct: 58  STNGAI---PSGKGGGGQQYGREYFPLAAVVGQDAIKTALLLGAIDREIGGIAISGKRGT 114

Query: 437 AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV 616
           AKTVMARGLHA+LPPIE+V GSI+NADP  PEEWE+GLA++V+YD+ GN+KTEIIK+PFV
Sbjct: 115 AKTVMARGLHAMLPPIEVVVGSIANADPNYPEEWEEGLANQVQYDADGNLKTEIIKTPFV 174

Query: 617 QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
           QIPLG+TEDRLIGSVDVE SVKSGTTVFQPGLLA
Sbjct: 175 QIPLGITEDRLIGSVDVEASVKSGTTVFQPGLLA 208



>gb:AC135595_1742648 Oryza sativa chromosome 3 BAC OSJNBa0028F23
           genomic sequence, complete sequence.
          Length = 754

 Score =  239 bits (611), Expect = 3e-62
 Identities = 121/154 (78%), Positives = 135/154 (87%)
 Frame = +2

Query: 257 SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGT 436
           S NG++   P         YGR+YFPLAAVVGQDAIKTALLLGAIDR IGGIAISGKRGT
Sbjct: 58  STNGAI---PSGKGGGGQQYGREYFPLAAVVGQDAIKTALLLGAIDREIGGIAISGKRGT 114

Query: 437 AKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFV 616
           AKTVMARGLHA+LPPIE+V GSI+NADP  PEEWE+GLA++V+YD+ GN+KTEIIK+PFV
Sbjct: 115 AKTVMARGLHAMLPPIEVVVGSIANADPNYPEEWEEGLANQVQYDADGNLKTEIIKTPFV 174

Query: 617 QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
           QIPLG+TEDRLIGSVDVE SVKSGTTVFQPGLLA
Sbjct: 175 QIPLGITEDRLIGSVDVEASVKSGTTVFQPGLLA 208



>pir|AF1841|AF1841 Mg chelatase chain [imported] - Nostoc sp.
           (strain PCC 7120)>gb:BA000019_681270 Nostoc sp. PCC 7120
           DNA, complete genome.
          Length = 678

 Score =  182 bits (462), Expect = 5e-45
 Identities = 89/130 (68%), Positives = 107/130 (82%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           FPL AVVGQ+AIK ALLL A+D  +GG+AI+G+RGTAK+VMAR +HA+LPPIE+VKGS+S
Sbjct: 13  FPLTAVVGQEAIKLALLLAAVDPGLGGVAIAGRRGTAKSVMARAIHALLPPIEVVKGSLS 72

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
           N DP  PEEW+D L       +  ++ TEII SPFVQIPLGVTEDRL+GSVDVE+SVK G
Sbjct: 73  NCDPNHPEEWDDYLLAEYADKNIQDVPTEIIPSPFVQIPLGVTEDRLLGSVDVEQSVKQG 132

Query: 689 TTVFQPGLLA 718
            T+FQPGLLA
Sbjct: 133 DTIFQPGLLA 142



>pir|T46870|T46870 protoporphyrin IX magnesium chelatase (EC
           4.99.1.-) chain chlD [validated] - Synechocystis
           sp.>gb:SSCHLD_190545 Synechocystis sp. chlD gene.
          Length = 676

 Score =  163 bits (413), Expect = 3e-39
 Identities = 78/130 (60%), Positives = 100/130 (76%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           FP+ A+VGQ+AIK ALLLGAID  +GGI I+G+RGTAK+VMAR +H +LPPIEI+KG+  
Sbjct: 12  FPITAIVGQEAIKLALLLGAIDPGLGGIVIAGRRGTAKSVMARAIHTLLPPIEIIKGNRY 71

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
             DP  P  W+D   ++        ++T++I +PF+QIPLGVTEDRL+GSVDVE+SVK G
Sbjct: 72  QCDPKNPGSWDDDTLEKFADVPLDQLETQVIPAPFIQIPLGVTEDRLLGSVDVEKSVKQG 131

Query: 689 TTVFQPGLLA 718
             VFQPGLLA
Sbjct: 132 EAVFQPGLLA 141



>sp|P72772|CHLD_SYNY3 Magnesium-chelatase subunit chlD (EC 6.6.1.1)
           (Mg-protoporphyrin IX chelatase) (Mg-chelatase subunit
           D).>pir|S74635|S74635 protoporphyrin IX magnesium
           chelatase (EC 4.99.1.-) chain I - Synechocystis sp.
           (strain PCC 6803)>gb:BA000022_687566 Synechocystis sp.
           PCC 6803 DNA, complete genome.
          Length = 676

 Score =  163 bits (413), Expect = 3e-39
 Identities = 78/130 (60%), Positives = 100/130 (76%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           FP+ A+VGQ+AIK ALLLGAID  +GGI I+G+RGTAK+VMAR +H +LPPIEI+KG+  
Sbjct: 12  FPITAIVGQEAIKLALLLGAIDPGLGGIVIAGRRGTAKSVMARAIHTLLPPIEIIKGNRY 71

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
             DP  P  W+D   ++        ++T++I +PF+QIPLGVTEDRL+GSVDVE+SVK G
Sbjct: 72  QCDPKNPGSWDDDTLEKFADVPLDQLETQVIPAPFIQIPLGVTEDRLLGSVDVEKSVKQG 131

Query: 689 TTVFQPGLLA 718
             VFQPGLLA
Sbjct: 132 EAVFQPGLLA 141



>gb:BA000039_727197 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 668

 Score =  160 bits (405), Expect = 2e-38
 Identities = 77/136 (56%), Positives = 103/136 (75%), Gaps = 6/136 (4%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGS-- 502
           FP+ A+VGQ+AIK ALLL A+D  +GG+ I+G+RGTAK+V+ARG+HA+LPPIE++     
Sbjct: 8   FPITAIVGQEAIKLALLLAAVDPGLGGVIIAGRRGTAKSVLARGIHALLPPIEVIDQGEI 67

Query: 503 ----ISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVE 670
               I+N DP CP+EW+  L    +    G +KT++I +PFVQIPLGVTEDRL+G+VDV 
Sbjct: 68  PVPIIANPDPECPQEWDSRLQAWRQSHPHGELKTKVIPAPFVQIPLGVTEDRLLGAVDVS 127

Query: 671 ESVKSGTTVFQPGLLA 718
           +SV+ G  VFQPGLLA
Sbjct: 128 QSVQRGEAVFQPGLLA 143



>gb:AP008231_581520 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 677

 Score =  147 bits (371), Expect = 2e-34
 Identities = 80/149 (53%), Positives = 104/149 (69%)
 Frame = +2

Query: 272 VVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVM 451
           ++AA   P A         FPL AVVGQ  IK AL+L A+D  +GG+AI+G+RGTAK+VM
Sbjct: 1   MIAAAPSPTA---------FPLPAVVGQGPIKLALILAAVDPGLGGVAIAGRRGTAKSVM 51

Query: 452 ARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLG 631
           AR LHA+LPPIEI++ S  NADP    +W D L  + + +    + T +I +PF Q+PLG
Sbjct: 52  ARALHALLPPIEILENSF-NADPNRAGDW-DALTQQRQANGE-ELPTRVIPAPFCQVPLG 108

Query: 632 VTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
           +TEDRL+GSVDV +S+K G TVFQPGLLA
Sbjct: 109 ITEDRLLGSVDVAQSIKRGETVFQPGLLA 137



>sp|O07345|CHLD_SYNP7 Magnesium-chelatase subunit chlD (EC 6.6.1.1)
           (Mg-protoporphyrin IX chelatase) (Mg-chelatase subunit
           D).>gb:AB003135_575 Synechococcus sp. DNA for
           magnesium-chelatase subunit and Asn-tRNA,complete cds.
          Length = 677

 Score =  147 bits (371), Expect = 2e-34
 Identities = 80/149 (53%), Positives = 104/149 (69%)
 Frame = +2

Query: 272 VVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVM 451
           ++AA   P A         FPL AVVGQ  IK AL+L A+D  +GG+AI+G+RGTAK+VM
Sbjct: 1   MIAAAPSPTA---------FPLPAVVGQGPIKLALILAAVDPGLGGVAIAGRRGTAKSVM 51

Query: 452 ARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLG 631
           AR LHA+LPPIEI++ S  NADP    +W D L  + + +    + T +I +PF Q+PLG
Sbjct: 52  ARALHALLPPIEILENSF-NADPNRAGDW-DALTQQRQANGE-ELPTRVIPAPFCQVPLG 108

Query: 632 VTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
           +TEDRL+GSVDV +S+K G TVFQPGLLA
Sbjct: 109 ITEDRLLGSVDVAQSIKRGETVFQPGLLA 137



>gb:BX569689_775115 Synechococcus sp. WH8102 complete genome;
           segment 1/7.
          Length = 702

 Score =  144 bits (364), Expect = 1e-33
 Identities = 72/133 (54%), Positives = 97/133 (72%), Gaps = 3/133 (2%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIV---KG 499
           FPLAA+ G   +K ALLL A+D  +GG+ I+G RGT K+V+ARGLHA+LPPI+I+    G
Sbjct: 17  FPLAAITGHGTLKLALLLAAVDPGLGGVVIAGGRGTGKSVLARGLHALLPPIDILDVDNG 76

Query: 500 SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV 679
              N DP  PEEW+D   +R+    +G   +++I +PFVQIPLG+TEDRL+G++DV  S+
Sbjct: 77  VGRNLDPQNPEEWDDTTRERI----SGEPPSKVIPAPFVQIPLGITEDRLVGALDVAASL 132

Query: 680 KSGTTVFQPGLLA 718
            SG+ VFQPGLLA
Sbjct: 133 ASGSAVFQPGLLA 145



>gb:AE017162_394777 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 2 of 6 of the complete
           genome.>gb:AE017126_1030446 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 707

 Score =  142 bits (358), Expect = 6e-33
 Identities = 71/148 (47%), Positives = 100/148 (67%), Gaps = 18/148 (12%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIV----K 496
           FPLAAV G   +K AL+L A+D  +GG+ I+G RGT K+V+ARGLHA+LPPIE++     
Sbjct: 26  FPLAAVTGHGTLKLALMLAAVDPGLGGVIIAGGRGTGKSVLARGLHALLPPIEVLDLRFA 85

Query: 497 GSIS-------NADPTCPEEWEDGLADRVEYDSAGN-------IKTEIIKSPFVQIPLGV 634
           G +        N DP  PEEW+D   + ++   + N       ++T ++++PFVQ+PLG+
Sbjct: 86  GDLQGPRPFGRNLDPNFPEEWDDATNELIKQRESNNSANGKQDLQTRVVQAPFVQVPLGI 145

Query: 635 TEDRLIGSVDVEESVKSGTTVFQPGLLA 718
           TEDRL+G+VDV  S+ SG+ VFQPGLLA
Sbjct: 146 TEDRLVGAVDVASSLDSGSAVFQPGLLA 173



>gb:BA000045_740945 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 669

 Score =  140 bits (354), Expect = 2e-32
 Identities = 71/130 (54%), Positives = 91/130 (70%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           FP+ AVV Q+AIK ALLL   D  +GG+AISG+RGTAK+VMARG+HA+LPPIE++ G  +
Sbjct: 9   FPITAVVAQEAIKLALLLAVTDPGLGGVAISGRRGTAKSVMARGIHALLPPIEVIAGCPA 68

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
           N DP  PE W D         +       +   PFVQ+PLG TEDR+IG+VD+E+S++ G
Sbjct: 69  NDDPDWPESWCDQCRRLYAQQTPQRAMRPV---PFVQVPLGATEDRVIGTVDLEKSMRLG 125

Query: 689 TTVFQPGLLA 718
             VFQPGLLA
Sbjct: 126 EPVFQPGLLA 135



>gb:BX572100_799229 Prochlorococcus marinus MIT9313 complete genome;
           segment 6/7.
          Length = 714

 Score =  131 bits (330), Expect = 1e-29
 Identities = 71/154 (46%), Positives = 99/154 (64%), Gaps = 24/154 (15%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVK-GSI 505
           FPLAA+ G   +K +LLL A+D  +GG+ I+G RGT K+V+ARGLHA+LPPI+++   ++
Sbjct: 27  FPLAAITGHGTLKLSLLLAAVDPELGGVVIAGGRGTGKSVLARGLHALLPPIDVLDLEAL 86

Query: 506 S--------------NADPTCPEEWED---------GLADRVEYDSAGNIKTEIIKSPFV 616
           S              N DP  PEEW++         G  D  E +S   + + +I +PFV
Sbjct: 87  SKDQQTSQIHRPIGLNLDPKLPEEWDEASQRLITKQGATD--EENSKEPLPSRVIPAPFV 144

Query: 617 QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
           Q+P+G+TEDRL+G+VDV  S+ SGT VFQPGLLA
Sbjct: 145 QVPIGITEDRLVGAVDVTASLTSGTPVFQPGLLA 178



>gb:BX572090_795914 Prochlorococcus marinus MED4 complete genome;
           segment 1/5.
          Length = 720

 Score =  120 bits (302), Expect = 2e-26
 Identities = 64/155 (41%), Positives = 96/155 (61%), Gaps = 25/155 (16%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIV----- 493
           FPLAA+ G   +K +LLL A+D ++GG+ I+G RGT K+++ARGLH +LPPIE++     
Sbjct: 26  FPLAAITGHSLLKLSLLLAAVDPSLGGVIIAGGRGTGKSILARGLHTLLPPIEVLDNESI 85

Query: 494 --KGSISNA-----------DPTCPEEWEDGLADRVE-------YDSAGNIKTEIIKSPF 613
             K ++SN+           DP   EEW+      +E        +    I  ++ ++PF
Sbjct: 86  LEKLTMSNSNTSLRPIGRNLDPDKAEEWDISTNKLLEEVIGSDYLNQIEEIPKKVREAPF 145

Query: 614 VQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
           +Q+P+G+TEDRL+GS+DV  S+ SG  VFQPG+LA
Sbjct: 146 IQVPIGITEDRLVGSIDVAASLSSGEQVFQPGVLA 180



>sp|Q9ZGE6|BCHD_HELMO Magnesium-chelatase 67 kDa subunit (EC
           6.6.1.1) (Mg-protoporphyrin IX chelatase) (Mg-chelatase
           subunit D).>pir|T31461|T31461 probable magnesium
           chelatase (EC 4.99.1.-) chain D bchD - Heliobacillus
           mobilis>gb:AF080002_477420 Heliobacillus mobilis
           exopolyphosphatase Ppx (ppx) gene, partial cds; cobyric
           acid synthase CobQ (cobQ), UDP-N-acetylmuramyl
           tripeptide synthetase MurC (murC), glutamyl tRNA
           reductase HemA (hemA), photosynthesis gene cluster,
           complete sequence, stage II sporulation protein E Sp2E
           (sp2E), cell cycle protein MesJ (mesJ), and
           ATP-dependent zinc metallopeptidase FtsH (ftsH) genes,
           complete cds; and nucleoside diphosphate kinase B NdkB
           (ndkB) gene, partial cds.
          Length = 666

 Score =  119 bits (298), Expect = 6e-26
 Identities = 58/131 (44%), Positives = 89/131 (67%), Gaps = 3/131 (2%)
 Frame = +2

Query: 332 PLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISN 511
           PLAA+ GQ+A+K AL L A+D  + G+AI+G+RGT KTV+ARGL  +LPPI+ ++G   +
Sbjct: 7   PLAAITGQEAVKLALTLAAVDPGLKGVAIAGRRGTGKTVLARGLRHLLPPIDQLEGCPCH 66

Query: 512 ADPTCPEEWEDGLADR-VEYDSAGNIKTEIIK--SPFVQIPLGVTEDRLIGSVDVEESVK 682
            +P  P  W +   +R  E     + +  +++  +PF ++PLG TEDRL+G++DVE+S+ 
Sbjct: 67  CNPAEPHSWCNRCRERFTEESGLSDSEVPVVQRNAPFSEVPLGATEDRLLGAIDVEQSLA 126

Query: 683 SGTTVFQPGLL 715
            G   +QPGLL
Sbjct: 127 GGVRAWQPGLL 137



>gb:BX572098_798477 Prochlorococcus marinus MIT9313 complete genome;
           segment 4/7.
          Length = 363

 Score =  114 bits (285), Expect = 2e-24
 Identities = 57/133 (42%), Positives = 83/133 (62%)
 Frame = +2

Query: 320 RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG 499
           R+ FP  +V+GQ+ +K ALLL  ID  IGG+ I G RGT K+   R L  +LP I++V G
Sbjct: 7   RRVFPFTSVIGQEEMKLALLLNVIDPRIGGVMIMGDRGTGKSTAIRALADLLPGIDVVAG 66

Query: 500 SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV 679
              N+ PT P+     +  R+E+    ++ TE  + P V +PLG TEDRL G++D+E+++
Sbjct: 67  DPYNSSPTDPDLQSSDVRQRIEHGE--SLATEERQVPMVDLPLGATEDRLCGTIDIEKAL 124

Query: 680 KSGTTVFQPGLLA 718
             G   F+PGLLA
Sbjct: 125 SEGVRAFEPGLLA 137



>sp|Q9TL08|CHLI_NEPOL Magnesium-chelatase subunit chlI (EC 6.6.1.1)
           (Mg-protoporphyrin IX chelatase).>gb:AF137379_1771254
           Nephroselmis olivacea chloroplast DNA, complete genome.
          Length = 355

 Score =  114 bits (285), Expect = 2e-24
 Identities = 59/138 (42%), Positives = 83/138 (60%)
 Frame = +2

Query: 305 TTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPI 484
           T+   R  FP  A+VGQ+ +K ALLL  ID  IGG+ I G RGT K+   R L  +LP I
Sbjct: 7   TSEQARPVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEI 66

Query: 485 EIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVD 664
           E+V+    N+ P  PE   D + ++V      +I+T   K P V +PLG TEDR+ G++D
Sbjct: 67  EVVENDPFNSHPYDPELMSDEVREKVH--RGESIRTTTTKIPMVDLPLGATEDRVCGTID 124

Query: 665 VEESVKSGTTVFQPGLLA 718
           +E+++  G   F+PGLLA
Sbjct: 125 IEKALTEGVKAFEPGLLA 142



>gb:BX569691_775618 Synechococcus sp. WH8102 complete genome;
           segment 3/7.
          Length = 362

 Score =  113 bits (283), Expect = 3e-24
 Identities = 59/133 (44%), Positives = 82/133 (61%)
 Frame = +2

Query: 320 RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG 499
           R+ FP  AV+GQ+ +K ALLL  ID  IGG+ I G RGT K+   R L  +LP IE+V G
Sbjct: 7   RRVFPFTAVIGQEEMKLALLLNVIDPRIGGVMIMGDRGTGKSTTIRALADLLPDIEVVAG 66

Query: 500 SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV 679
              N+  T P+     + +R+E     +I TE  + P V +PLG TEDRL G++D+E+++
Sbjct: 67  DPYNSSSTDPDLQSSEVRERME--RGDSISTEPRQVPMVDLPLGATEDRLCGTIDIEKAL 124

Query: 680 KSGTTVFQPGLLA 718
             G   F+PGLLA
Sbjct: 125 SEGVRAFEPGLLA 137



>gb:AY673996_1621553 Gracilaria tenuistipitata var. liui
           chloroplast, complete genome.
          Length = 356

 Score =  112 bits (281), Expect = 5e-24
 Identities = 55/133 (41%), Positives = 83/133 (62%)
 Frame = +2

Query: 320 RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG 499
           R  FP  A+VGQ+ +K ALLL  ID  IGG+ I G RGT K+   R +  +LP IE+V+ 
Sbjct: 17  RPVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRAIADLLPKIEVVQD 76

Query: 500 SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV 679
            + N+ P+  +   D +  ++E  S+ ++ T  I  P V +PLG TEDR+ G++D+E+++
Sbjct: 77  DLFNSHPSDYDLMSDSVKSQIE--SSNHLPTRFIDVPMVDLPLGATEDRVCGTIDIEKAL 134

Query: 680 KSGTTVFQPGLLA 718
             G   F+PGLLA
Sbjct: 135 SEGVKTFEPGLLA 147



>gb:AL646079_548995 Ralstonia solanacearum GMI1000 megaplasmid,
           complete sequence; segment 4/11.
          Length = 637

 Score =  112 bits (281), Expect = 5e-24
 Identities = 63/131 (48%), Positives = 81/131 (61%)
 Frame = +2

Query: 326 YFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSI 505
           ++P AA+VGQ+ +K ALLL AID  +GG+ I G +GTAK+  ARGL  VLPPI  V G  
Sbjct: 4   HYPFAAIVGQEPLKRALLLCAIDPTLGGVLIRGDKGTAKSTAARGLTDVLPPITRVAGCA 63

Query: 506 SNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKS 685
            N  P  P      LA+  E   AG+        PFV +PLG TEDR++G +D+E ++K 
Sbjct: 64  FNCAPDAP------LAE-CEACRAGDAAHASAPVPFVNLPLGATEDRVLGHLDIERALKD 116

Query: 686 GTTVFQPGLLA 718
           G   FQPGLLA
Sbjct: 117 GRKAFQPGLLA 127



>sp|Q94FT3|CHLI_CHLRE Magnesium-chelatase subunit chlI, chloroplast
           precursor (EC 6.6.1.1) (Mg-protoporphyrin IX
           chelatase).>gb:AF343974_1789745 Chlamydomonas
           reinhardtii magnesium-chelatase subunit I (chlI) mRNA,
           complete cds.
          Length = 417

 Score =  112 bits (281), Expect = 5e-24
 Identities = 62/162 (38%), Positives = 91/162 (56%)
 Frame = +2

Query: 233 RLRFRINASANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGI 412
           R    + A+A   V AA  +   +     R  FP  A+VGQD +K AL+L  ID  IGG+
Sbjct: 48  RAALLVRAAAATEVKAAEGRTGKEL-GQARPIFPFTAIVGQDEMKLALILNVIDPKIGGV 106

Query: 413 AISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKT 592
            I G RGT K+   R L  +LP +++V     N+DPT PE   + + +RV+  +   +  
Sbjct: 107 MIMGDRGTGKSTTIRALADLLPEMQVVANDPFNSDPTDPELMSEEVRNRVK--AGEQLPV 164

Query: 593 EIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
              K P V +PLG TEDR+ G++D+E+++  G   F+PGLLA
Sbjct: 165 SSKKIPMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLA 206



>gb:AB002583_1508738 Cyanidioschyzon merolae chloroplast DNA,
           complete genome, strain:10D.
          Length = 346

 Score =  112 bits (280), Expect = 7e-24
 Identities = 58/130 (44%), Positives = 79/130 (60%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           FP  A+VGQ+ +K ALLL  ID  IGG+ I G RGT KT   R L  +LP I +VKG + 
Sbjct: 7   FPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKTTTIRALIDILPSIPVVKGDLF 66

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
           N+ P+ PE     +  ++       +  E IK P V +PLG TEDRL G++D+E+++  G
Sbjct: 67  NSHPSDPELMSTDVQKKIANQEP--LVIEYIKVPMVDLPLGATEDRLCGTIDMEKALVEG 124

Query: 689 TTVFQPGLLA 718
              F+PGLLA
Sbjct: 125 VKSFEPGLLA 134



>sp|P58571|CHLI_ANASP Magnesium-chelatase subunit chlI (EC 6.6.1.1)
           (Mg-protoporphyrin IX chelatase).>pir|AH1825|AH1825
           protoporphyrin IX magnesium chelatase chain [imported] -
           Nostoc sp. (strain PCC 7120)>gb:BA000019_681144 Nostoc
           sp. PCC 7120 DNA, complete genome.
          Length = 374

 Score =  112 bits (279), Expect = 9e-24
 Identities = 61/143 (42%), Positives = 84/143 (58%), Gaps = 1/143 (0%)
 Frame = +2

Query: 293 PAADTTAYGRQY-FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHA 469
           P A TTA  R+  FP  A+VGQ+ +K ALLL  ID  IGG+ I G RGT K+   R L  
Sbjct: 3   PTAQTTASARRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRALAD 62

Query: 470 VLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRL 649
           +LP I +V     N+DP+ P+   D +  R +  +   I  E  K   V +PLG TEDR+
Sbjct: 63  LLPEIPVVANDPFNSDPSDPDLMSDEV--RQKSGTGAEIPIEFKKVQMVDLPLGATEDRV 120

Query: 650 IGSVDVEESVKSGTTVFQPGLLA 718
            G++D+E+++  G   F+PGLLA
Sbjct: 121 CGTIDIEKALSEGVKAFEPGLLA 143



>gb:AE017164_395602 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 4 of 6 of the complete
           genome.>gb:AE017126_1031271 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 362

 Score =  111 bits (277), Expect = 2e-23
 Identities = 57/133 (42%), Positives = 81/133 (60%)
 Frame = +2

Query: 320 RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG 499
           R+ FP AAV+GQ  +K ALLL  ID  IGG+ I G RGT K+   R L  +LP I++V+G
Sbjct: 7   RRVFPFAAVIGQSEMKLALLLNVIDPRIGGVMIMGDRGTGKSTTIRALADLLPAIKVVEG 66

Query: 500 SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV 679
              N+ P  P+     + +++  D      TE  + P V +PLG TEDRL G++D+E+++
Sbjct: 67  DPYNSSPDDPDLQSSDVREQI--DQGTTPSTENKQVPMVDLPLGATEDRLCGTIDIEKAL 124

Query: 680 KSGTTVFQPGLLA 718
             G   F+PGLLA
Sbjct: 125 SEGVRAFEPGLLA 137



>gb:BA000039_727295 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 367

 Score =  110 bits (275), Expect = 3e-23
 Identities = 61/142 (42%), Positives = 82/142 (57%)
 Frame = +2

Query: 293 PAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAV 472
           P   T    R  FP AA+VGQD +K +LLL  ID  IGG+ I G RGT K+   R L  +
Sbjct: 14  PVTATAVPRRPVFPFAAIVGQDEMKLSLLLNVIDPKIGGVMIMGDRGTGKSTTIRALADL 73

Query: 473 LPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLI 652
           LP IE+V     N+ P+ P+   D  A +V   +   I T   K P V +PLG TEDR+ 
Sbjct: 74  LPEIEVVADDPFNSHPSDPDLMSD--AVKVAVAAGEPIHTIKKKVPMVDLPLGATEDRVC 131

Query: 653 GSVDVEESVKSGTTVFQPGLLA 718
           G++D+E+++  G   F+PGLLA
Sbjct: 132 GTIDIEKALAEGVKAFEPGLLA 153



>gb:BX572597_801120 Rhodopseudomonas palustris CGA009 complete
           genome; segment 5/16.
          Length = 340

 Score =  110 bits (274), Expect = 3e-23
 Identities = 52/130 (40%), Positives = 83/130 (63%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           FP +A+VGQ+ +K ALL+ A+D+ +GG+   G RG  K+   R L A+LP ++ V G   
Sbjct: 5   FPFSAIVGQEEMKLALLIAAVDQKVGGVLAFGDRGAGKSTAVRALAALLPKMKTVVGCRY 64

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
           N DP  P+ + +   ++V++   G +KT  +  P V +PLG TEDR++G++D+E ++  G
Sbjct: 65  NCDPDQPDRYCEECKEKVKH---GKVKTAQVPVPVVDLPLGATEDRVVGALDLERALAKG 121

Query: 689 TTVFQPGLLA 718
              F+PGLLA
Sbjct: 122 EKAFEPGLLA 131



>sp|P31205|CHLI_EUGGR Magnesium-chelatase subunit chlI (EC 6.6.1.1)
           (Mg-protoporphyrin IX chelatase).>pir|S34494|S34494 ccsA
           protein - Euglena gracilis
           chloroplast>gb:CLEGCGA_1647762 Euglena gracilis
           chloroplast complete genome.>gb:EGCCSA_1676426
           E.gracilis chloroplast ccsA gene.
          Length = 348

 Score =  110 bits (274), Expect = 3e-23
 Identities = 52/133 (39%), Positives = 85/133 (63%)
 Frame = +2

Query: 320 RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG 499
           R  FP  ++VGQ+ +K +L+L  ID  IGG+ I G RGT K+ + R L  +LPPI++++ 
Sbjct: 8   RPVFPFTSIVGQEEMKLSLILNVIDPKIGGVMIMGDRGTGKSTIVRALVDLLPPIDVIEN 67

Query: 500 SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV 679
              N+DP   E   D + ++++ +   +I    +K+P V +PLG TEDR+ G++D+E+++
Sbjct: 68  DPYNSDPYDTELMSDDVLEKIKKNEKVSIIQ--VKTPMVDLPLGGTEDRVCGTIDIEKAI 125

Query: 680 KSGTTVFQPGLLA 718
             G   F+PGLLA
Sbjct: 126 SEGKKAFEPGLLA 138



>gb:AF494278_1805204 Chaetosphaeridium globosum chloroplast,
           complete genome.
          Length = 354

 Score =  108 bits (271), Expect = 8e-23
 Identities = 57/133 (42%), Positives = 81/133 (60%)
 Frame = +2

Query: 320 RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG 499
           R  FP  A+VGQ+ +K ALLL  ID  IGG+ I G RGT K+   R L  +LP IE+V+ 
Sbjct: 11  RPVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIEVVED 70

Query: 500 SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV 679
              N+DP  PE   + + ++V+ +    I T   K   V +PLG TEDR+ G++D+E+++
Sbjct: 71  DAFNSDPRDPELMSEYVRNKVKNNE--KISTIRTKINMVDLPLGATEDRVCGTIDIEKAL 128

Query: 680 KSGTTVFQPGLLA 718
             G   F+PGLLA
Sbjct: 129 TEGVKAFEPGLLA 141



>gb:AC084767_1733793 Oryza sativa chromosome 3 BAC OSJNBb0057P11
           genomic sequence, complete sequence.
          Length = 415

 Score =  108 bits (271), Expect = 8e-23
 Identities = 68/173 (39%), Positives = 89/173 (51%), Gaps = 5/173 (2%)
 Frame = +2

Query: 215 SGRRPHRLRFRINASANGSVVAAPQKPAADTTAYG-----RQYFPLAAVVGQDAIKTALL 379
           S R P R  FR         VAAP     +  A G     R  +P AA+VGQD +K  LL
Sbjct: 37  SARIPSRRGFR-RGRFTVCNVAAPSATQQEAKAAGAKESQRPVYPFAAIVGQDEMKLCLL 95

Query: 380 LGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADR 559
           L  ID  IGG+ I G RGT K+   R L  +LP I +V G   N+DP  PE     + +R
Sbjct: 96  LNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPDIRVVVGDPFNSDPDDPEVMGPEVRER 155

Query: 560 VEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
           V       +     K   V +PLG TEDR+ G++D+E+++  G   F+PGLLA
Sbjct: 156 VL--EGEKLPVVTAKITMVDLPLGATEDRVCGTIDIEKALTDGVKAFEPGLLA 206



>gb:AB016870_1512884 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K15I22.
          Length = 423

 Score =  108 bits (271), Expect = 8e-23
 Identities = 71/208 (34%), Positives = 106/208 (50%), Gaps = 7/208 (3%)
 Frame = +2

Query: 116 STLPANPSHTAPFSTTLRFKFXXXXXXXXXXRPSGR---RPHRLRFRINASANG---SVV 277
           S++   P  ++P ST+               + SGR    P + R R + S       + 
Sbjct: 10  SSILTCPRISSPSSTSSMSHLCFGPGSNFAEKLSGRIQFNPKKNRSRYHVSVMNVATEIN 69

Query: 278 AAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMAR 457
           +  Q    D+    R  +P AA+VGQD +K  LLL  ID  IGG+ I G RGT K+   R
Sbjct: 70  SVEQAKKIDSKESARPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVR 129

Query: 458 GLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEY-DSAGNIKTEIIKSPFVQIPLGV 634
            L  +LP I +V G   N+DP  PE     + ++V+  +    I+T+I     V +PLG 
Sbjct: 130 SLVDLLPEITVVSGDPYNSDPRDPECMGKEVREKVQKGEELSVIETKI---NMVDLPLGA 186

Query: 635 TEDRLIGSVDVEESVKSGTTVFQPGLLA 718
           TEDR+ G++D+E+++  G   F+PGLLA
Sbjct: 187 TEDRVCGTIDIEKALTEGVKAFEPGLLA 214



>sp|P16127|CHLI_ARATH Magnesium-chelatase subunit chlI, chloroplast
           precursor (EC 6.6.1.1) (Mg-protoporphyrin IX chelatase)
           (Protein CS/CH-42).>pir|S12785|S12785 protein ch-42
           precursor, chloroplast - Arabidopsis
           thaliana>gb:ATCH42WT_1544174 A.thaliana CH42 gene (wild
           type).>gb:ATCHRIV48_1545649 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           48.>gb:ATCSCH42_1548023 Arabidopsis thaliana cs/ch-42
           gene for a chloroplast protein (cs).>gb:ATF28J12_1550320
           Arabidopsis thaliana DNA chromosome 4, BAC clone F28J12
           (ESSAII project).>gb:AY093192_1575146 Arabidopsis
           thaliana protein ch-42 precursor, chloroplast
           (At4g18480) mRNA, complete cds.>gb:BT010129_1640195
           Arabidopsis thaliana At4g18480 gene, complete cds.
          Length = 424

 Score =  108 bits (271), Expect = 8e-23
 Identities = 71/212 (33%), Positives = 109/212 (51%), Gaps = 10/212 (4%)
 Frame = +2

Query: 113 SSTLPANPSHTAPFS----TTLRFK----FXXXXXXXXXXRPSGRRPHRLRFRINASANG 268
           SS + A+PS ++P S    + + F+    F          RP   + +R R+ ++     
Sbjct: 9   SSAIWASPSLSSPSSKPSSSPICFRPGKLFGSKLNAGIQIRP---KKNRSRYHVSVMNVA 65

Query: 269 SVVAAPQKPAA--DTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAK 442
           + + + ++     D+    R  +P AA+VGQD +K  LLL  ID  IGG+ I G RGT K
Sbjct: 66  TEINSTEQVVGKFDSKKSARPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGK 125

Query: 443 TVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQI 622
           +   R L  +LP I +V G   N+DP  PE     + +RVE      +     K   V +
Sbjct: 126 STTVRSLVDLLPEINVVAGDPYNSDPIDPEFMGVEVRERVE--KGEQVPVIATKINMVDL 183

Query: 623 PLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
           PLG TEDR+ G++D+E+++  G   F+PGLLA
Sbjct: 184 PLGATEDRVCGTIDIEKALTEGVKAFEPGLLA 215



>pir|T46868|T46868 protoporphyrin IX magnesium chelatase (EC
           4.99.1.-) chain chlI [validated] - Synechocystis
           sp.>gb:SSU35144_191461 Synechocystis sp.
           Mg-protoporhyrin IX (chlI) gene, complete cds.
          Length = 357

 Score =  108 bits (270), Expect = 1e-22
 Identities = 61/150 (40%), Positives = 84/150 (56%)
 Frame = +2

Query: 269 SVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTV 448
           + +AAP K         R  FP  A+VGQD +K ALLL  ID  IGG+ I G RGT K+ 
Sbjct: 3   ATLAAPSKTR-------RVVFPFTAIVGQDEMKLALLLNVIDPKIGGVMIMGDRGTGKST 55

Query: 449 MARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPL 628
             R L  +LP IE+V     N+ P+ PE   + +  R+  DS   +     K   V +PL
Sbjct: 56  TIRALADLLPEIEVVANDPFNSSPSDPEMMSEEV--RIRVDSQEPLSIVKKKVTMVDLPL 113

Query: 629 GVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
           G TEDR+ G++D+E+++  G   F+PGLLA
Sbjct: 114 GATEDRVCGTIDIEKALSEGVKAFEPGLLA 143



>sp|P51634|CHLI_SYNY3 Magnesium-chelatase subunit chlI (EC 6.6.1.1)
           (Mg-protoporphyrin IX chelatase).>pir|S75252|S75252
           protoporphyrin IX magnesium chelatase chain chlI-related
           protein - Synechocystis sp. (strain PCC
           6803)>gb:BA000022_687945 Synechocystis sp. PCC 6803 DNA,
           complete genome.
          Length = 357

 Score =  108 bits (270), Expect = 1e-22
 Identities = 61/150 (40%), Positives = 84/150 (56%)
 Frame = +2

Query: 269 SVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTV 448
           + +AAP K         R  FP  A+VGQD +K ALLL  ID  IGG+ I G RGT K+ 
Sbjct: 3   ATLAAPSKTR-------RVVFPFTAIVGQDEMKLALLLNVIDPKIGGVMIMGDRGTGKST 55

Query: 449 MARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPL 628
             R L  +LP IE+V     N+ P+ PE   + +  R+  DS   +     K   V +PL
Sbjct: 56  TIRALADLLPEIEVVANDPFNSSPSDPEMMSEEV--RIRVDSQEPLSIVKKKVTMVDLPL 113

Query: 629 GVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
           G TEDR+ G++D+E+++  G   F+PGLLA
Sbjct: 114 GATEDRVCGTIDIEKALSEGVKAFEPGLLA 143



>sp|P51394|CHLI_PORPU Magnesium-chelatase subunit chlI (EC 6.6.1.1)
           (Mg-protoporphyrin IX chelatase).>pir|S73315|S73315
           protoporphyrin IX magnesium chelatase (EC 4.99.1.-) chlI
           - red alga (Porphyra purpurea)
           chloroplast>gb:PPU38804_1701710 Porphyra purpurea
           chloroplast, complete genome.
          Length = 356

 Score =  108 bits (269), Expect = 1e-22
 Identities = 56/133 (42%), Positives = 80/133 (60%)
 Frame = +2

Query: 320 RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG 499
           R  FP  A+VGQ+ +K AL+L  ID  IGG+ I G RGT K+   R +  +LP IEIVK 
Sbjct: 13  RPVFPFTAIVGQEEMKLALMLNVIDPKIGGVMIMGDRGTGKSTTIRAIADLLPKIEIVKD 72

Query: 500 SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV 679
            + N+ P+  +   D   ++    +  NI    IK P V +PLG TEDR+ G++D+E+++
Sbjct: 73  DLFNSHPSDVDLMSD--ENKHALQNGINIDKAYIKVPMVDLPLGATEDRVCGTIDIEKAL 130

Query: 680 KSGTTVFQPGLLA 718
             G   F+PGLLA
Sbjct: 131 TEGVKTFEPGLLA 143



>gb:BT015783_1642401 Arabidopsis thaliana At5g45930 mRNA, complete
           cds.
          Length = 418

 Score =  107 bits (267), Expect = 2e-22
 Identities = 61/167 (36%), Positives = 94/167 (56%), Gaps = 2/167 (1%)
 Frame = +2

Query: 224 RPHRLRFRINA-SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRN 400
           + +R R+ ++  +    + +  Q    D+    R  +P AA+VGQD +K  LLL  ID  
Sbjct: 46  KKNRSRYHVSVMNVATEINSVEQAKKIDSKESARPVYPFAAIVGQDEMKLCLLLNVIDPK 105

Query: 401 IGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEY-DSA 577
           IGG+ I G RGT K+   R L  +LP I +V G   N+DP  PE     + ++V+  +  
Sbjct: 106 IGGVMIMGDRGTGKSTTVRSLVDLLPEITVVSGDPYNSDPRDPECMGKEVREKVQKGEEL 165

Query: 578 GNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
             I+T+I     V +PLG TEDR+ G++D+E+++  G   F+PGLLA
Sbjct: 166 SVIETKI---NMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLA 209



>gb:AY140022_1582462 Arabidopsis thaliana magnesium chelatase
           subunit of protochlorophyllide reductase (At5g45930)
           mRNA, complete cds.
          Length = 418

 Score =  107 bits (267), Expect = 2e-22
 Identities = 61/167 (36%), Positives = 94/167 (56%), Gaps = 2/167 (1%)
 Frame = +2

Query: 224 RPHRLRFRINA-SANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRN 400
           + +R R+ ++  +    + +  Q    D+    R  +P AA+VGQD +K  LLL  ID  
Sbjct: 46  KKNRSRYHVSVMNVATEINSVEQAKKIDSKESARPVYPFAAIVGQDEMKLCLLLNVIDPK 105

Query: 401 IGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEY-DSA 577
           IGG+ I G RGT K+   R L  +LP I +V G   N+DP  PE     + ++V+  +  
Sbjct: 106 IGGVMIMGDRGTGKSTTVRSLVDLLPEITVVSGDPYNSDPRDPECMGKEVREKVQKGEEL 165

Query: 578 GNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
             I+T+I     V +PLG TEDR+ G++D+E+++  G   F+PGLLA
Sbjct: 166 SVIETKI---NMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLA 209



>gb:AY616113_1178748 Prototheca wickerhamii plastid Mg chelatase
           subunit I mRNA, partial cds; nuclear gene for plastid
           product.
          Length = 200

 Score =  107 bits (267), Expect = 2e-22
 Identities = 61/169 (36%), Positives = 92/169 (54%)
 Frame = +2

Query: 212 PSGRRPHRLRFRINASANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAI 391
           P  R+  R++     + NG+ V A +  A       R  FP  AV+GQ+ +K AL+L  I
Sbjct: 41  PLSRKHLRVQAVAAVAENGAAVQAAEGQA-------RPIFPFTAVIGQEEMKLALILNVI 93

Query: 392 DRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYD 571
           D  IGG+ I G RGT KT   R L  +LP + +V     N+DP   E   + +  R++  
Sbjct: 94  DPKIGGVMIMGDRGTGKTTTIRALADLLPQVPVVAKDPFNSDPFDAELMSEEVRQRLK-- 151

Query: 572 SAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
           +   +    +K P V +PLG TEDR+ G++D+E+++  G   F+PGLLA
Sbjct: 152 AGEELPVGSMKIPMVDLPLGATEDRVCGTIDIEKALTEGVKAFEPGLLA 200



>sp|Q93SW1|BCHI_CHLTE Magnesium-chelatase 38 kDa subunit (EC
           6.6.1.1) (Mg-protoporphyrin IX
           chelatase).>gb:AE012889_286769 Chlorobium tepidum TLS
           section 110 of 194 of the complete
           genome.>gb:AY005135_584399 Chlorobium tepidum Ybc5
           (ybc5) gene, partial cds; Dld2 (dld2), BchI (chlI), BchD
           (bchD), and BchH3 (bchH3) genes, complete cds; and
           unknown gene.>gb:AE006470_933937 Chlorobium tepidum TLS
           complete genome.
          Length = 392

 Score =  107 bits (267), Expect = 2e-22
 Identities = 62/167 (37%), Positives = 92/167 (55%), Gaps = 9/167 (5%)
 Frame = +2

Query: 245 RINASANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISG 424
           ++  +A    V   +KPAA   +     FP  A+VGQ+ +K +L+L  ID  IGG+ + G
Sbjct: 23  KVKVTAEEKAVTEVKKPAAKKKS--ALAFPFTAIVGQEEMKLSLILNIIDPRIGGVLVMG 80

Query: 425 KRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAG-------- 580
            RGT K+   R L  VLP I  VKG I N            +   +E ++AG        
Sbjct: 81  HRGTGKSTTVRALAEVLPLIPRVKGDIYNRT----------VEQYIEMEAAGKGAPAIKP 130

Query: 581 -NIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
            +++TE+I  P V +PLG TEDR+ G++D+E+++ SG   F+PGLLA
Sbjct: 131 EDVETELIPVPVVDLPLGATEDRVCGTIDIEKALTSGVKAFEPGLLA 177



>gb:AP008231_580635 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 364

 Score =  107 bits (266), Expect = 3e-22
 Identities = 58/140 (41%), Positives = 83/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query: 308 TAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIE 487
           TA  R  FP  A+VGQ+ +K ALLL  ID  +GG+ I G RGT K+   R L  +LP IE
Sbjct: 7   TAPRRTVFPFTAIVGQEEMKLALLLNVIDPKLGGVMIMGDRGTGKSTTIRALADLLPEIE 66

Query: 488 IVKGSISNADPTCPEEWEDGLADRV---EYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGS 658
           +V     N+ P+ PE   + + DR+   E  + G  K ++     V +PLG TEDR+ G+
Sbjct: 67  VVAEDPYNSHPSDPELMSNEVRDRIARGETPTIGRAKVQM-----VDLPLGATEDRVCGT 121

Query: 659 VDVEESVKSGTTVFQPGLLA 718
           +D+E+++  G   F+PGLLA
Sbjct: 122 IDIEKALSEGVKAFEPGLLA 141



>gb:AY458639_619477 Uncultured bacterium 442 clone EBAC000-63A02
           genomic sequence.
          Length = 341

 Score =  106 bits (265), Expect = 4e-22
 Identities = 52/130 (40%), Positives = 77/130 (59%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           +P  A+V Q  +K ALL+ A+D+ +GG+ I G RGT K+   R L A+LP I ++     
Sbjct: 5   YPFTAIVAQQDMKLALLIAAVDQGVGGVLIMGDRGTGKSTAIRALAALLPKIPVIANCAY 64

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
           N D   PE    G  D  + +    +KT  +  P V +PLG TEDR+IG++D+E ++ +G
Sbjct: 65  NCD---PERTPAGQCDNCQQNKNQVVKTTTVSIPVVDLPLGATEDRVIGALDIERALHAG 121

Query: 689 TTVFQPGLLA 718
              F+PGLLA
Sbjct: 122 EKAFEPGLLA 131



>sp|Q9MUT3|CHLI_MESVI Magnesium-chelatase subunit chlI (EC 6.6.1.1)
           (Mg-protoporphyrin IX chelatase).>gb:AF166114_1773935
           Mesostigma viride chloroplast DNA, complete genome.
          Length = 360

 Score =  105 bits (263), Expect = 6e-22
 Identities = 53/133 (39%), Positives = 80/133 (60%)
 Frame = +2

Query: 320 RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG 499
           R  +P  A+VGQ+ +K AL+L  ID +IGG+ I G RGT K+   R L  +LP IE+V  
Sbjct: 16  RPVYPFTAIVGQEEMKLALILNVIDPDIGGVMIMGDRGTGKSTTIRALVDLLPEIEVVTN 75

Query: 500 SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV 679
              N+DP  P+   D + +++  ++   + T   K   V +PLG TEDR+ G++D+E ++
Sbjct: 76  DPFNSDPRDPDLMSDEVREKI--NNKQEVPTIKTKIKIVDLPLGATEDRVCGTIDIERAL 133

Query: 680 KSGTTVFQPGLLA 718
             G   F+PGLLA
Sbjct: 134 NEGVKAFEPGLLA 146



>sp|O50312|BCHI_CHLVI Magnesium-chelatase 38 kDa subunit (EC
           6.6.1.1) (Mg-protoporphyrin IX
           chelatase).>pir|T17192|T17192 probable protoporphyrin IX
           magnesium chelatase (EC 4.99.1.-), 38 K chain -
           Chlorobium vibrioforme>gb:CVZ83933_119836 Chlorobium
           vibrioforme 15 kb genomic DNA fragment.
          Length = 346

 Score =  105 bits (263), Expect = 6e-22
 Identities = 56/130 (43%), Positives = 78/130 (60%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           FP  ++VGQ+ +K +L+L  ID  IGG+ + G RGT K+   R L  VLP I+ VKG I 
Sbjct: 3   FPFTSIVGQEEMKLSLILNIIDPRIGGVLVMGHRGTGKSTTVRALAEVLPLIDRVKGDIY 62

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
           N       E E G+        A ++KTE I  P V +PLG TEDR+ G++D+E+++ SG
Sbjct: 63  NRTVEQYIEMESGVKG-APVLKASDVKTEKIPVPVVDLPLGATEDRVCGTIDIEKALTSG 121

Query: 689 TTVFQPGLLA 718
              F+PGL A
Sbjct: 122 VKAFEPGLFA 131



>sp|P56304|CHLI_CHLVU Magnesium-chelatase subunit chlI (EC 6.6.1.1)
           (Mg-protoporphyrin IX chelatase).>pir|T07342|T07342
           probable protoporphyrin IX magnesium chelatase (EC
           4.99.1.-) - Chlorella vulgaris
           chloroplast>gb:AB001684_1508646 Chlorella vulgaris C-27
           chloroplast DNA, complete sequence.
          Length = 354

 Score =  105 bits (261), Expect = 1e-21
 Identities = 55/133 (41%), Positives = 78/133 (58%)
 Frame = +2

Query: 320 RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG 499
           R  FP  A+VGQ+ +K AL+L  ID  IGG+ I G RGT K+   R L  +LP I++V  
Sbjct: 13  RPVFPFTAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTVRALVDLLPEIQVVAD 72

Query: 500 SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV 679
              N+DP  PE     +  R++      I T+  K   V +PLG TEDR+ G++D+E+++
Sbjct: 73  DPFNSDPKDPELMSQEVRGRLQRKETVPITTK--KISMVDLPLGATEDRVCGTIDIEKAL 130

Query: 680 KSGTTVFQPGLLA 718
             G   F+PGLLA
Sbjct: 131 TEGVKAFEPGLLA 143



>sp|Q58321|Y911_METJA Magnesium-chelatase subunit chlI
           homolog.>pir|G64413|G64413 protoporphyrin IX magnesium
           chelatase (EC 4.99.1.-) homolog - Methanococcus
           jannaschii>gb:U67534_207020 Methanocaldococcus
           jannaschii DSM 2661 section 76 of 150 of the complete
           genome.>gb:L77117_1099778 Methanocaldococcus jannaschii
           DSM 2661, complete genome.
          Length = 365

 Score =  104 bits (260), Expect = 1e-21
 Identities = 56/131 (42%), Positives = 80/131 (61%), Gaps = 1/131 (0%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           +P  A+VGQ+ +K AL+L AI+  IGG+ I G++GTAK+   R L  +LP IEIV+G   
Sbjct: 8   YPFTAIVGQEKMKKALILNAINPKIGGVLIRGEKGTAKSTAVRALADLLPEIEIVEGCPF 67

Query: 509 NADPTCPEEWEDGLADRV-EYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKS 685
           N DP         L D   E    G +KT   K   V +P+G TEDR+IG++D+E+++K 
Sbjct: 68  NCDP------NGNLCDICKEKKKRGELKTTKKKMKVVNLPIGATEDRVIGTLDIEKAIKE 121

Query: 686 GTTVFQPGLLA 718
           G    +PG+LA
Sbjct: 122 GIKALEPGILA 132



>sp|P93162|CHLI_SOYBN Magnesium-chelatase subunit chlI, chloroplast
           precursor (EC 6.6.1.1) (Mg-protoporphyrin IX
           chelatase).>pir|JC4312|JC4312 chlorophyll magnesium
           chelatase (EC 4.99.1.-) - soybean
           chloroplast>gb:SOYCHLI_1715979 Soybean mRNA for Mg
           chelatase subunit (46 kD), complete cds.
          Length = 421

 Score =  104 bits (260), Expect = 1e-21
 Identities = 55/133 (41%), Positives = 77/133 (57%)
 Frame = +2

Query: 320 RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG 499
           R  +P +A+VGQD +K  LLL  ID  IGG+ I G RGT K+   R L  +LP I++V G
Sbjct: 82  RPVYPFSAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVVAG 141

Query: 500 SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV 679
              N+DP  PE    G+  R        +   + K   V +PLG TEDR+ G++D+E+++
Sbjct: 142 DPYNSDPQDPEFM--GVEVRERVLQGEELSVVLTKINMVDLPLGATEDRVCGTIDIEKAL 199

Query: 680 KSGTTVFQPGLLA 718
             G   F+PGLLA
Sbjct: 200 TEGVKAFEPGLLA 212



>gb:NTU67064_1691888 Nicotiana tabacum sulfur gene (Su-s) mRNA,
           complete cds.
          Length = 424

 Score =  104 bits (259), Expect = 2e-21
 Identities = 54/133 (40%), Positives = 77/133 (57%)
 Frame = +2

Query: 320 RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG 499
           R  +P AA+VGQD +K  LLL  ID  IGG+ I G RGT K+   R L  +LP I+++ G
Sbjct: 85  RPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVISG 144

Query: 500 SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV 679
              N+DP   E     + D++   S   +     K   V +PLG TEDR+ G++D+E+++
Sbjct: 145 DPFNSDPDDQEVMSAEVRDKLR--SGQQLPISRTKINMVDLPLGATEDRVCGTIDIEKAL 202

Query: 680 KSGTTVFQPGLLA 718
             G   F+PGLLA
Sbjct: 203 TEGVKAFEPGLLA 215



>gb:BA000011_665071 Thermoplasma volcanium GSS1 DNA, complete
           genome.
          Length = 614

 Score =  104 bits (259), Expect = 2e-21
 Identities = 57/133 (42%), Positives = 81/133 (60%)
 Frame = +2

Query: 320 RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG 499
           R  FP +AVVG+D +K ALL+ A++  IGG+ I G +G AK+ +AR L  +LP I++VK 
Sbjct: 3   RLLFPFSAVVGEDDLKEALLINAVNPRIGGVLIRGPKGVAKSTIARSLIDILPEIDVVKD 62

Query: 500 SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV 679
                DP   E   D    R++Y+  G I  +  K PFV +P+  T DR+IGS+D+ ++V
Sbjct: 63  CPFKCDPDDYESMCDEC--RIKYEK-GQIVRDRRKMPFVDLPVSATIDRVIGSIDISKAV 119

Query: 680 KSGTTVFQPGLLA 718
             G    QPGLLA
Sbjct: 120 NEGIKALQPGLLA 132



>sp|O22436|CHLI_TOBAC Magnesium-chelatase subunit chlI, chloroplast
           precursor (EC 6.6.1.1) (Mg-protoporphyrin IX
           chelatase).>pir|T01790|T01790 protoporphyrin IX
           magnesium chelatase (EC 4.99.1.-) chlI - common
           tobacco>gb:AF014053_1761325 Nicotiana tabacum Mg
           protoporphyrin chelatase subunit (Chl I) mRNA, complete
           cds.
          Length = 426

 Score =  104 bits (259), Expect = 2e-21
 Identities = 54/133 (40%), Positives = 77/133 (57%)
 Frame = +2

Query: 320 RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG 499
           R  +P AA+VGQD +K  LLL  ID  IGG+ I G RGT K+   R L  +LP I+++ G
Sbjct: 87  RPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVISG 146

Query: 500 SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV 679
              N+DP   E     + D++   S   +     K   V +PLG TEDR+ G++D+E+++
Sbjct: 147 DPFNSDPDDQEVMSAEVRDKLR--SGQQLPISRTKINMVDLPLGATEDRVCGTIDIEKAL 204

Query: 680 KSGTTVFQPGLLA 718
             G   F+PGLLA
Sbjct: 205 TEGVKAFEPGLLA 217



>sp|P49469|CHLI_ODOSI Magnesium-chelatase subunit chlI (EC 6.6.1.1)
           (Mg-protoporphyrin IX chelatase).>pir|S78304|S78304
           protoporphyrin IX magnesium chelatase (EC 4.99.1.-) chlI
           - Odontella sinensis chloroplast>gb:OSCHLPLXX_1692889
           Odontella sinensis complete chloroplast genome.
          Length = 353

 Score =  104 bits (259), Expect = 2e-21
 Identities = 54/139 (38%), Positives = 82/139 (58%)
 Frame = +2

Query: 302 DTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPP 481
           D   +    FP  A+VGQ+ +K AL L  ID  IGG+ I G RGT K+   R +  +LP 
Sbjct: 5   DLKKFSTPVFPFTAIVGQEEMKLALQLNVIDPKIGGVMIMGDRGTGKSTTIRAIADLLPE 64

Query: 482 IEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSV 661
           IE+VK    N+  +  +    G   ++   +  +++TE+IK P V +PLG TEDR+ G++
Sbjct: 65  IEVVKDDPFNSHKSDLDLM--GNEIKLAIQNGESLETELIKIPMVDLPLGATEDRVCGTI 122

Query: 662 DVEESVKSGTTVFQPGLLA 718
           D+E+++  G   F+PGLLA
Sbjct: 123 DIEKALTEGVKAFEPGLLA 141



>gb:AE000838_28258 Methanobacterium thermoautotrophicum from bases
           494834 to 505698 (section 44 of 148) of the complete
           genome.>gb:AE000666_925340 Methanobacterium
           thermoautotrophicum str. Delta H complete genome.
          Length = 395

 Score =  103 bits (257), Expect = 3e-21
 Identities = 54/130 (41%), Positives = 76/130 (58%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           FP  A+VGQ+ +K AL+L AI+  IGG+ I G +GT KT   R L  +LP +  VKG   
Sbjct: 6   FPFTAIVGQEKVKKALILNAINPGIGGVLIKGDKGTGKTTAVRALADLLPSLRTVKGCPF 65

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
           N DP  PE    G  D       G++  E  K   V++PLG TEDR++GS+D+ +++  G
Sbjct: 66  NCDPDEPE----GACDMCR---GGDVDVEYRKMRVVELPLGATEDRVVGSLDISKALTEG 118

Query: 689 TTVFQPGLLA 718
               +PG+LA
Sbjct: 119 IKALEPGILA 128



>pir|E69173|E69173 protoporphyrin IX magnesium chelatase (EC
           4.99.1.-) ChlI - Methanobacterium thermoautotrophicum
           (strain Delta H)
          Length = 397

 Score =  103 bits (257), Expect = 3e-21
 Identities = 54/130 (41%), Positives = 76/130 (58%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           FP  A+VGQ+ +K AL+L AI+  IGG+ I G +GT KT   R L  +LP +  VKG   
Sbjct: 6   FPFTAIVGQEKVKKALILNAINPGIGGVLIKGDKGTGKTTAVRALADLLPSLRTVKGCPF 65

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
           N DP  PE    G  D       G++  E  K   V++PLG TEDR++GS+D+ +++  G
Sbjct: 66  NCDPDEPE----GACDMCR---GGDVDVEYRKMRVVELPLGATEDRVVGSLDISKALTEG 118

Query: 689 TTVFQPGLLA 718
               +PG+LA
Sbjct: 119 IKALEPGILA 128



>gb:BX572092_796681 Prochlorococcus marinus MED4 complete genome;
           segment 3/5.
          Length = 362

 Score =  102 bits (255), Expect = 5e-21
 Identities = 56/134 (41%), Positives = 82/134 (61%), Gaps = 1/134 (0%)
 Frame = +2

Query: 320 RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG 499
           R+ FP  AV+GQ+ +K ALLL  ID  IGG+ I G RGT K+   R L  +LP I++VK 
Sbjct: 7   RRVFPFTAVIGQEEMKLALLLNVIDPRIGGVMIMGDRGTGKSTTIRALADLLPAIDVVKD 66

Query: 500 SISNADPTCPE-EWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEES 676
              N+    P+ + ++ L   V+ +S    K ++   P V +PLG TEDRL G++D+E++
Sbjct: 67  DPYNSSLIDPDLQSKEVLEKIVQGESLEKDKKQV---PMVDLPLGATEDRLCGTIDIEKA 123

Query: 677 VKSGTTVFQPGLLA 718
           +  G   F+PGLLA
Sbjct: 124 LSEGIKAFEPGLLA 137



>gb:AE016915_356531 Chromobacterium violaceum ATCC 12472 section 6
           of 16 of the complete genome.>gb:AE016825_1041685
           Chromobacterium violaceum ATCC 12472 complete genome.
          Length = 635

 Score =  102 bits (254), Expect = 7e-21
 Identities = 54/130 (41%), Positives = 78/130 (60%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           +P AA+VGQ+ +K ALL+ A+D  +GG+ + G +G+AK+  ARGL AVLPPI    G   
Sbjct: 5   YPFAAIVGQEQLKQALLICAVDPTVGGVLVRGDKGSAKSTAARGLAAVLPPIRRAAGCGY 64

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
           N +P  P              S G  +      PF+ +PLG TEDR++GS+D E++++ G
Sbjct: 65  NCEPDHP-------LPLCPVCSGGARELHDGPVPFINLPLGATEDRVLGSLDFEKALQGG 117

Query: 689 TTVFQPGLLA 718
              F+PGLLA
Sbjct: 118 KQAFKPGLLA 127



>pir|S04401|S04401 spheroidene monooxygenase - Rhodobacter
           capsulatus>gb:RCCRTAK_162609 Rhodobacter capsulatus
           clustered genes crtA-F, I and K involved in carotenoid
           biosynthesis.
          Length = 591

 Score =  102 bits (254), Expect = 7e-21
 Identities = 66/171 (38%), Positives = 96/171 (56%), Gaps = 4/171 (2%)
 Frame = +2

Query: 218 GRRPHRLRFRINASANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDR 397
           G+ P R +     +   + VA  Q  A+   A  R  FP +A+VGQ+ +K ALLL A+D 
Sbjct: 227 GQGPARQQSLGKGNCMTTAVARLQPSASG--AKTRPVFPFSAIVGQEDMKLALLLTAVDP 284

Query: 398 NIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEY--D 571
            IGG+ + G RGT K+   R L A+LP IE V+G        CP       +  VE   D
Sbjct: 285 GIGGVLVFGDRGTGKSTAVRALAALLPEIEAVEG--------CPVS-----SPNVEMIPD 331

Query: 572 SAGNIKTEIIK--SPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
            A  + T +I+  +P V +PLGV+EDR++G++D+E ++  G   F+PGLLA
Sbjct: 332 WATVLSTNVIRKPTPVVDLPLGVSEDRVVGALDIERAISKGEKAFEPGLLA 382



>sp|P48101|CHLI_CYAPA Magnesium-chelatase subunit chlI (EC 6.6.1.1)
           (Mg-protoporphyrin IX chelatase).>pir|T06902|T06902
           probable protoporphyrin IX magnesium chelatase (EC
           4.99.1.-) - Cyanophora paradoxa
           cyanelle>gb:CPU30821_1648813 Cyanophora paradoxa
           cyanelle, complete genome.
          Length = 347

 Score =  102 bits (253), Expect = 9e-21
 Identities = 55/133 (41%), Positives = 77/133 (57%)
 Frame = +2

Query: 320 RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG 499
           R  FP  A+VGQ+ +K ALLL  +D  IGG+ I G RGT K+   R L  +LP I+IV  
Sbjct: 6   RPIFPFTAIVGQEEMKLALLLNIVDPKIGGVMIMGDRGTGKSTTIRALADLLPEIDIVAN 65

Query: 500 SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV 679
              N+ PT  E   D +  R   ++   I     K P + +PLG TEDR+ G++D+E+++
Sbjct: 66  DPFNSHPTDIELMSDNV--RQLKENGEEISLIQKKVPMIDLPLGATEDRVCGTIDIEKAL 123

Query: 680 KSGTTVFQPGLLA 718
             G   F+PGLLA
Sbjct: 124 TEGVKAFEPGLLA 136



>sp|P26239|BCHI_RHOCA Magnesium-chelatase 38 kDa subunit (EC
           6.6.1.1) (Mg-protoporphyrin IX
           chelatase).>gb:RCPHSYNG_162737 R.capsulatus complete
           photosynthesis gene cluster.
          Length = 350

 Score =  102 bits (253), Expect = 9e-21
 Identities = 62/154 (40%), Positives = 91/154 (59%), Gaps = 4/154 (2%)
 Frame = +2

Query: 269 SVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTV 448
           +   A  +P+A + A  R  FP +A+VGQ+ +K ALLL A+D  IGG+ + G RGT K+ 
Sbjct: 2   TTAVARLQPSA-SGAKTRPVFPFSAIVGQEDMKLALLLTAVDPGIGGVLVFGDRGTGKST 60

Query: 449 MARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEY--DSAGNIKTEIIK--SPFV 616
             R L A+LP IE V+G        CP       +  VE   D A  + T +I+  +P V
Sbjct: 61  AVRALAALLPEIEAVEG--------CPVS-----SPNVEMIPDWATVLSTNVIRKPTPVV 107

Query: 617 QIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
            +PLGV+EDR++G++D+E ++  G   F+PGLLA
Sbjct: 108 DLPLGVSEDRVVGALDIERAISKGEKAFEPGLLA 141



>gb:AE010752_266252 Methanosarcina acetivorans str. C2A, section 97
           of 534 of the complete genome.>gb:AE010299_906811
           Methanosarcina acetivorans str. C2A, complete genome.
          Length = 704

 Score =  101 bits (252), Expect = 1e-20
 Identities = 48/130 (36%), Positives = 83/130 (63%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           +P  A+VGQ+ +K AL+L  I+  +GG+ I G++GTAK+   R L ++LP IE+V+G   
Sbjct: 9   YPFTAIVGQEKMKKALVLNLINPKVGGVLIRGEKGTAKSTAVRALASLLPEIEVVEGCKF 68

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
             DP    E+ +    ++   +AG ++   +K   V +P+  TEDR++G++D+E ++K+G
Sbjct: 69  KCDPNHTNEFCEECLGKL---NAGTLRVSQVKMKVVDLPVSATEDRVVGTLDIEYAIKTG 125

Query: 689 TTVFQPGLLA 718
              F+PG+LA
Sbjct: 126 EKRFEPGVLA 135



>gb:BA000045_741789 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 358

 Score =  100 bits (250), Expect = 2e-20
 Identities = 54/137 (39%), Positives = 79/137 (57%)
 Frame = +2

Query: 308 TAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIE 487
           T+  R  FP  A+VGQ+ +K AL+L  ID  +GG+ I G RGT K+   R L  +LP IE
Sbjct: 5   TSGRRPVFPFTAIVGQEEMKLALILNVIDPKLGGVMIMGDRGTGKSTTVRALAELLPEIE 64

Query: 488 IVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDV 667
           +V G   ++DP   +   D +  R     A  +  E  +   V +PLG TEDR+ G++D+
Sbjct: 65  VVTGDPYHSDPYNQDLMSDEVRGRKLAGEA--LPVERRQVQMVDLPLGATEDRVCGTIDI 122

Query: 668 EESVKSGTTVFQPGLLA 718
           E+++  G   F+PGLLA
Sbjct: 123 EKALSEGVKAFEPGLLA 139



>gb:TACID2_196346 Thermoplasma acidophilum complete genome; segment
           2/5.
          Length = 617

 Score =  100 bits (249), Expect = 3e-20
 Identities = 54/130 (41%), Positives = 79/130 (60%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           FP +AVV +D +K AL+L AID+ IGG+ I G +G AK+ +AR L  +LP I++VK    
Sbjct: 9   FPFSAVVDEDDLKMALILNAIDQRIGGVLIMGPKGVAKSTIARSLTDLLPDIDVVKDCPF 68

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
             DP  P    D   + ++    G I +E  K PFV +P+  T DR++GS+D++ ++  G
Sbjct: 69  KCDPHDPSSMCD---ECIKKYRDGTIVSEKRKIPFVNMPVTATLDRVVGSLDIKRAIDEG 125

Query: 689 TTVFQPGLLA 718
               QPGLLA
Sbjct: 126 LRALQPGLLA 135



>gb:AY458640_619530 Uncultured bacterium 443 clone EBAC000-65D02
           genomic sequence.
          Length = 338

 Score =  100 bits (248), Expect = 4e-20
 Identities = 51/130 (39%), Positives = 77/130 (59%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           +P  A+VGQD +K AL + A+D +IGG+ + G+RGT K+   R L  +LP I  VK    
Sbjct: 5   YPFTAIVGQDDMKLALSIAAVDPSIGGVLVFGERGTGKSTTIRALAQLLPKIAAVKDCPY 64

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
             DP  P +     +   +      +K+  I  P V +PLG TEDR++G++D+E+++ +G
Sbjct: 65  QCDPQAPSK-----SLCAQCQKTTPLKSHKIAIPVVDLPLGATEDRVLGALDIEKAIHNG 119

Query: 689 TTVFQPGLLA 718
              FQPGLLA
Sbjct: 120 EKAFQPGLLA 129



>gb:AE013439_292333 Methanosarcina mazei strain Goe1, section 221 of
           379 of the complete genome.>gb:AE008384_966442
           Methanosarcina mazei strain Goe1, complete genome.
          Length = 692

 Score =  100 bits (248), Expect = 4e-20
 Identities = 48/130 (36%), Positives = 82/130 (63%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           +P  A+VGQ+ +K AL+L  I+  +GG+ + G++GTAK+   R L  +LP IE+V+G   
Sbjct: 9   YPFTAIVGQEKMKKALVLNLINPKLGGVLVRGEKGTAKSTAVRALANLLPEIEVVEGCKF 68

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
             +P   +E  +    ++   +AGN++   IK   V +P+  TEDR++G++D+E ++K G
Sbjct: 69  KCNPQYQKELCEECLGKL---NAGNLRVSRIKMKVVDLPVSATEDRVVGTLDIEHAIKKG 125

Query: 689 TTVFQPGLLA 718
              F+PG+LA
Sbjct: 126 EKRFEPGVLA 135



>sp|Q39516|CHLI_GUITH Magnesium-chelatase subunit chlI (EC 6.6.1.1)
           (Mg-protoporphyrin IX chelatase).>pir|S37138|S37138
           protoporphyrin IX magnesium chelatase (EC 4.99.1.-) -
           Cryptomonas sp.>gb:AF041468_1763505 Guillardia theta
           complete plastid genome.
          Length = 353

 Score = 99.8 bits (247), Expect = 5e-20
 Identities = 52/133 (39%), Positives = 77/133 (57%)
 Frame = +2

Query: 320 RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG 499
           R  FP  A+VGQ+ +K AL L  ID  IGG+ I G RGT K+   R +  +LP I IV+ 
Sbjct: 11  RPVFPFTAIVGQEEMKLALTLNVIDPKIGGVIIMGDRGTGKSTTIRAITDILPEIPIVEN 70

Query: 500 SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV 679
              N+ P   +   D +  R+E     +I + + K   + +PLG TEDR+ G++D+E+++
Sbjct: 71  DPFNSHPQDFDLMSDEVRSRIE--KGESIPSVMKKVSMIDLPLGATEDRVCGTIDIEKAL 128

Query: 680 KSGTTVFQPGLLA 718
             G   F+PGLLA
Sbjct: 129 TEGVKAFEPGLLA 141



>sp|Q9TLX7|CHLI_CYACA Magnesium-chelatase subunit chlI (EC 6.6.1.1)
           (Mg-protoporphyrin IX chelatase).>gb:AF022186_1761905
           Cyanidium caldarium strain RK1 chloroplast, complete
           genome.
          Length = 353

 Score = 99.8 bits (247), Expect = 5e-20
 Identities = 55/130 (42%), Positives = 76/130 (58%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           FP  A+VGQ+ +K +LLL  +D  IGG+ I G RGT KT   R L  +LP I +VK    
Sbjct: 18  FPFTAIVGQEEMKISLLLNVVDPKIGGVMIMGDRGTGKTTTIRALVDILPDILVVKDDPY 77

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
           N+ P   +     +   V   +  NI+T   K P V +PLG TEDR+ GS+D+E+++  G
Sbjct: 78  NSHPHDVDLMSSEVQALVL--NRMNIETCYTKVPLVDLPLGATEDRVCGSIDIEKALSEG 135

Query: 689 TTVFQPGLLA 718
              F+PGLLA
Sbjct: 136 KKSFEPGLLA 145



>gb:AE008921_246307 Uncultured proteobacterium clone EBAC000-60D04
           complete sequence.
          Length = 335

 Score = 98.2 bits (243), Expect = 1e-19
 Identities = 52/133 (39%), Positives = 79/133 (59%)
 Frame = +2

Query: 320 RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG 499
           +Q FP +A+VGQD +K A++L AID +I G+ + G+RGT K+   R L  +LPPI  VK 
Sbjct: 2   KQPFPFSAIVGQDDMKLAMVLTAIDPSIAGVLVFGERGTGKSTAVRALAGLLPPILAVK- 60

Query: 500 SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV 679
                   CP    D + D   +    + + + I +P V +PLG +EDR+ G++D+E+++
Sbjct: 61  -------ACPVNSAD-IKDCPAWCEISDARVQSIATPVVDLPLGASEDRVTGALDIEKAL 112

Query: 680 KSGTTVFQPGLLA 718
             G   FQPGL A
Sbjct: 113 TKGEKAFQPGLFA 125



>gb:SCO939110_175525 Streptomyces coelicolor A3(2) complete genome;
           segment 7/29.
          Length = 672

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 49/131 (37%), Positives = 79/131 (60%), Gaps = 1/131 (0%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           FP  AVVGQD ++ ALLL A+   +GG+ + G++GTAK+   R L A++P +++V G   
Sbjct: 5   FPFTAVVGQDDLRLALLLNAVSPAVGGVLVRGEKGTAKSTAVRALSALMPEVDVVSGCRF 64

Query: 509 NADPTCPE-EWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKS 685
           + DP  P+    DG  +   + S          +  V++P+G +EDRL+G++D+E ++  
Sbjct: 65  SCDPDSPDPACPDGPHEPGAFASR--------PARMVELPVGASEDRLVGALDIERALAE 116

Query: 686 GTTVFQPGLLA 718
           G   F+PGLLA
Sbjct: 117 GVKAFEPGLLA 127



>sp|O30819|BCHI_RHOSH Magnesium-chelatase 38 kDa subunit (EC
           6.6.1.1) (Mg-protoporphyrin IX
           chelatase).>gb:AF017642_469483 Rhodobacter sphaeroides
           magnesium chelatase subunits BchI (bchI) and BchD (bchD)
           genes, complete cds; and BchO (bchO) gene, partial cds.
          Length = 334

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 55/133 (41%), Positives = 82/133 (61%), Gaps = 3/133 (2%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG-SI 505
           FP +A+VGQ+ +K A++L AID  IGG+ + G RGT K+   R L A+LP I+ V+G  +
Sbjct: 5   FPFSAIVGQEQMKQAMVLTAIDPGIGGVLVFGDRGTGKSTAVRALAALLPLIKAVEGCPV 64

Query: 506 SNADPTCPEEWEDGLADRVEYDSAGNIKTEIIK--SPFVQIPLGVTEDRLIGSVDVEESV 679
           ++A P    EW            A    T +I+  +P V +PLGVTEDR++G++D+E ++
Sbjct: 65  NSARPEDCPEW------------AHVSSTTMIERPTPVVDLPLGVTEDRVVGALDIERAL 112

Query: 680 KSGTTVFQPGLLA 718
             G   F+PGLLA
Sbjct: 113 TRGEKAFEPGLLA 125



>sp|Q32742|CHLI_OLILU Magnesium-chelatase subunit chlI (EC 6.6.1.1)
           (Mg-protoporphyrin IX chelatase).>pir|S32166|S32166 ccsA
           protein - golden alga (Olisthodiscus luteus)
           chloroplast>gb:CHOLCCSA_1647097 O.luteus chloroplast ORF
           97 and bchI, and tRNA-Glu genes.
          Length = 334

 Score = 97.1 bits (240), Expect = 3e-19
 Identities = 53/130 (40%), Positives = 76/130 (58%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           FP  A+VGQ+ +K AL L  ID  IGG+ I G RGT K+   R +  +LP IE+VK +  
Sbjct: 12  FPFTAIVGQEEMKLALQLNVIDPKIGGVMIMGDRGTGKSTTIRAIADLLPEIEVVKDNQF 71

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
           N  P+     ED   + V+           IK+P + +PLG TEDR+ G++D+E+++  G
Sbjct: 72  NTAPS-----EDLNEEIVK-----------IKTPMIDLPLGATEDRVCGTIDIEKALTDG 115

Query: 689 TTVFQPGLLA 718
              F+PGLLA
Sbjct: 116 VKAFEPGLLA 125



>gb:AF288461_496036 Chloroflexus aurantiacus BchI (bchI) and BchD
           (bchD) genes, complete cds; and unknown genes.
          Length = 370

 Score = 96.3 bits (238), Expect = 5e-19
 Identities = 55/135 (40%), Positives = 77/135 (57%), Gaps = 5/135 (3%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           +P  A+VGQ  +K ALLL  ++  IGG+ + G RGTAK+   R L A+LPPI+ V G   
Sbjct: 30  YPFVAIVGQAELKLALLLCVVNPTIGGVMVMGHRGTAKSTAVRALAAMLPPIKAVAG--- 86

Query: 509 NADPTCPEEWEDGLADR---VEYDSAGNIKTEIIK--SPFVQIPLGVTEDRLIGSVDVEE 673
               +C  +   GL D+   +E  S    K  +I    P V +PLG TEDR+ G++D+E 
Sbjct: 87  -CPYSCAPDRTAGLCDQCRALEQQSGKTKKPAVINIPVPVVDLPLGATEDRVCGTLDIER 145

Query: 674 SVKSGTTVFQPGLLA 718
           ++  G   F PGLLA
Sbjct: 146 ALTQGVQAFAPGLLA 160



>gb:RSP010302_168007 Rhodobacter sphaeroides photosynthetic gene
           cluster.
          Length = 334

 Score = 96.3 bits (238), Expect = 5e-19
 Identities = 54/133 (40%), Positives = 82/133 (61%), Gaps = 3/133 (2%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG-SI 505
           FP +A+VGQ+ +K A++L AID  IGG+ + G RGT K+   R L A+LP I+ V+G  +
Sbjct: 5   FPFSAIVGQEQMKQAMVLTAIDPGIGGVLVFGARGTGKSTAVRALAALLPLIKAVEGCPV 64

Query: 506 SNADPTCPEEWEDGLADRVEYDSAGNIKTEIIK--SPFVQIPLGVTEDRLIGSVDVEESV 679
           ++A P    EW            A    T +I+  +P V +PLGVTEDR++G++D++ ++
Sbjct: 65  NSARPEDCPEW------------AHVSSTTMIERPTPVVDLPLGVTEDRVVGALDIQRAL 112

Query: 680 KSGTTVFQPGLLA 718
             G   F+PGLLA
Sbjct: 113 TRGEKAFEPGLLA 125



>pir|T50743|T50743 probable protoporphyrin IX magnesium chelatase
           (EC 4.99.1.-) bchI [similarity] - Rhodobacter
           sphaeroides>gb:AF195122_487191 Rhodobacter sphaeroides
           photosynthetic gene cluster, partial sequence.
          Length = 334

 Score = 96.3 bits (238), Expect = 5e-19
 Identities = 54/133 (40%), Positives = 82/133 (61%), Gaps = 3/133 (2%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG-SI 505
           FP +A+VGQ+ +K A++L AID  IGG+ + G RGT K+   R L A+LP I+ V+G  +
Sbjct: 5   FPFSAIVGQEQMKQAMVLTAIDPGIGGVLVFGDRGTGKSTAVRALAALLPLIKAVEGCPV 64

Query: 506 SNADPTCPEEWEDGLADRVEYDSAGNIKTEIIK--SPFVQIPLGVTEDRLIGSVDVEESV 679
           ++A P    EW            A    T +I+  +P V +PLGVTEDR++G++D++ ++
Sbjct: 65  NSARPEDCPEW------------AHVSSTTMIERPTPVVDLPLGVTEDRVVGALDIQRAL 112

Query: 680 KSGTTVFQPGLLA 718
             G   F+PGLLA
Sbjct: 113 TRGEKAFEPGLLA 125



>gb:BA000030_704300 Streptomyces avermitilis MA-4680 genomic DNA,
           complete genome.
          Length = 689

 Score = 94.7 bits (234), Expect = 1e-18
 Identities = 49/135 (36%), Positives = 81/135 (60%), Gaps = 5/135 (3%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG--- 499
           FP  AVVGQD ++ ALLL A+   +GG+ + G++GTAK+   R L A++P +++V G   
Sbjct: 5   FPFTAVVGQDDLRLALLLNAVSPAVGGVLVRGEKGTAKSTAVRALSALMPEVDVVAGCRF 64

Query: 500 --SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEE 673
             +  + DP CP    DG      ++    ++     +  V++P+G +EDRL+G++D+E 
Sbjct: 65  SCAPGSPDPACP----DG-----PHEVGPGVRR---PARMVELPVGASEDRLVGALDIER 112

Query: 674 SVKSGTTVFQPGLLA 718
           ++  G   F+PGLLA
Sbjct: 113 ALAEGVKAFEPGLLA 127



>pir|A69159|A69159 protoporphyrin IX magnesium chelatase (EC
           4.99.1.-) ChlI - Methanobacterium thermoautotrophicum
           (strain Delta H)>gb:AE000829_28153 Methanobacterium
           thermoautotrophicum from bases 383485 to 394302 (section
           35 of 148) of the complete genome.>gb:AE000666_925235
           Methanobacterium thermoautotrophicum str. Delta H
           complete genome.
          Length = 591

 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 46/131 (35%), Positives = 79/131 (60%)
 Frame = +2

Query: 326 YFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSI 505
           YFP  A+VGQ+ +K AL+L AI+ +IGG+ I G +GT K+   R L  VLP  ++V+G  
Sbjct: 5   YFPFTAIVGQELLKKALILNAINPSIGGVLIRGDKGTGKSTAVRSLRDVLPDRKMVEGCR 64

Query: 506 SNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKS 685
              D   P+  E  +  R + +  G++ +  ++   V +P+  TED ++GS+D++ +++ 
Sbjct: 65  FGCD---PDGAEICMECRRKLEEQGSLPSRQVRMEVVDLPVSATEDMVVGSLDIKRALRD 121

Query: 686 GTTVFQPGLLA 718
           G    +PG+LA
Sbjct: 122 GIKALEPGILA 132



>sp|Q9WXA9|BCHI_ACIRU Magnesium-chelatase 38 kDa subunit (EC
           6.6.1.1) (Mg-protoporphyrin IX
           chelatase).>gb:AB017350_3204 Acidiphilium rubrum bchP,
           bchI, bchD, crtI genes and 2 ORFs, partial and complete
           cds.
          Length = 345

 Score = 92.4 bits (228), Expect = 7e-18
 Identities = 49/135 (36%), Positives = 77/135 (57%), Gaps = 5/135 (3%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           +P  A+VGQ  +  A+L+  ++  +GG+   G RGT K+   R L A+LP +  V G   
Sbjct: 4   YPFTAIVGQTEMIRAMLIATVEPTLGGVLAFGDRGTGKSTAVRALAALLPTMRAVAGCRY 63

Query: 509 NADPT-----CPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEE 673
           + DP      CPE       +R    +AG + +E ++ P V +PLG TEDR++G++D+E 
Sbjct: 64  HCDPAARSALCPE-----CRNR---RAAGRLASERVRIPVVDLPLGATEDRVVGALDLER 115

Query: 674 SVKSGTTVFQPGLLA 718
           ++  G   F+PGLLA
Sbjct: 116 ALADGVKAFEPGLLA 130



>gb:AE012819_285909 Chlorobium tepidum TLS section 40 of 194 of the
           complete genome.>gb:AE006470_933077 Chlorobium tepidum
           TLS complete genome.
          Length = 347

 Score = 89.7 bits (221), Expect = 5e-17
 Identities = 50/137 (36%), Positives = 79/137 (57%), Gaps = 7/137 (5%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           +P  A+VGQ+ +K AL+L  I+  I G+ I G++GTAK+   R L  +LP IE++ G   
Sbjct: 7   YPFTAIVGQEEMKLALILNIINPAISGVLIRGEKGTAKSTAVRALADILPEIEVIAGIPF 66

Query: 509 NADPTCPEEWEDGLADRVEYDSAG-------NIKTEIIKSPFVQIPLGVTEDRLIGSVDV 667
           N  P      ED    R  +   G       N++  + K   V++P+G TEDR++G++D+
Sbjct: 67  NLAPD-----EDDETIRECFTVTGHAMPDPDNLEVTMHKVQVVELPVGATEDRVVGTLDL 121

Query: 668 EESVKSGTTVFQPGLLA 718
           E ++K+G    +PGLLA
Sbjct: 122 EHALKTGEKRIEPGLLA 138



>pir|T31460|T31460 probable magnesium chelatase (EC 4.99.1.-) chain
           I bchI - Heliobacillus mobilis>gb:AF080002_477419
           Heliobacillus mobilis exopolyphosphatase Ppx (ppx) gene,
           partial cds; cobyric acid synthase CobQ (cobQ),
           UDP-N-acetylmuramyl tripeptide synthetase MurC (murC),
           glutamyl tRNA reductase HemA (hemA), photosynthesis gene
           cluster, complete sequence, stage II sporulation protein
           E Sp2E (sp2E), cell cycle protein MesJ (mesJ), and
           ATP-dependent zinc metallopeptidase FtsH (ftsH) genes,
           complete cds; and nucleoside diphosphate kinase B NdkB
           (ndkB) gene, partial cds.
          Length = 363

 Score = 89.4 bits (220), Expect = 6e-17
 Identities = 46/130 (35%), Positives = 72/130 (55%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           +P  A++GQ+ +K AL+L  ID  IGG+ I G RGT K+   R L  +LP +  V     
Sbjct: 21  YPFTAIIGQEEMKLALILNVIDPRIGGVMIMGDRGTGKSTTVRALAELLPEVPSVADCTF 80

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
             +P    E      +RV   +  ++ T    +  V +PLG TEDR+ G++D+++++  G
Sbjct: 81  GCNPHKTTEMCPSCRERVA--AGEDLPTVYRNTKVVDLPLGATEDRVCGTIDIQKALAEG 138

Query: 689 TTVFQPGLLA 718
              F+PGLLA
Sbjct: 139 VKAFEPGLLA 148



>gb:HVU26545_1682606 Hordeum vulgare Mg-chelatase subunit (Xantha-h)
           mRNA, partial cds.
          Length = 331

 Score = 87.0 bits (214), Expect = 3e-16
 Identities = 48/122 (39%), Positives = 68/122 (55%)
 Frame = +2

Query: 353 QDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPE 532
           Q  +   LLL  ID  IGG+ I G RGT K+   R L  +LP I +V G   N+DP  PE
Sbjct: 2   QAELHLVLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPDISVVVGDPFNSDPYDPE 61

Query: 533 EWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGL 712
                + DR+    +  + T   K   V +PLG TEDR+ G++D+++++  G   F+PGL
Sbjct: 62  VMGPEVRDRLLKGESLPVTT--TKITMVDLPLGATEDRVCGTIDIDKALTEGVKAFEPGL 119

Query: 713 LA 718
           LA
Sbjct: 120 LA 121



>pir|S64722|S64722 protoporphyrin IX magnesium chelatase (EC
           4.99.1.-) Xantha-h - barley (fragment)
          Length = 331

 Score = 87.0 bits (214), Expect = 3e-16
 Identities = 48/122 (39%), Positives = 68/122 (55%)
 Frame = +2

Query: 353 QDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPE 532
           Q  +   LLL  ID  IGG+ I G RGT K+   R L  +LP I +V G   N+DP  PE
Sbjct: 2   QAELHLVLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPDISVVVGDPFNSDPYDPE 61

Query: 533 EWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGL 712
                + DR+    +  + T   K   V +PLG TEDR+ G++D+++++  G   F+PGL
Sbjct: 62  VMGPEVRDRLLKGESLPVTT--TKITMVDLPLGATEDRVCGTIDIDKALTEGVKAFEPGL 119

Query: 713 LA 718
           LA
Sbjct: 120 LA 121



>gb:AE017283_429892 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 328

 Score = 83.2 bits (204), Expect = 4e-15
 Identities = 46/133 (34%), Positives = 76/133 (57%)
 Frame = +2

Query: 320 RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG 499
           R  +P  A+VGQ+ +K AL+L  I  ++ G+ I G++GTAK+   RGL A+LP    + G
Sbjct: 4   RPVYPFCAIVGQEEMKLALILATISPDLSGVLIRGEKGTAKSTAVRGLAALLPQHREIPG 63

Query: 500 SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV 679
                    P+E+          +     +T  ++ P V++P+G TEDR+ G++D+E ++
Sbjct: 64  PYH----LSPDEYPTHAVALNLPEVMPEPRT--VQVPVVELPVGATEDRVTGTLDMETAL 117

Query: 680 KSGTTVFQPGLLA 718
           + G   F+PGLLA
Sbjct: 118 REGRRRFEPGLLA 130



>sp|Q44498|CHLI_ANAVA Magnesium-chelatase subunit chlI (EC 6.6.1.1)
           (Mg-protoporphyrin IX chelatase)
           (Fragment).>gb:ANACHLI_553298 Anabaena variabilis genes
           for magnesium chelatase subunit (ChlI-ChlD) and orf2,
           partial cds.
          Length = 338

 Score = 82.4 bits (202), Expect = 8e-15
 Identities = 43/109 (39%), Positives = 62/109 (56%)
 Frame = +2

Query: 392 DRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYD 571
           D  IGG+ I G RGT K+   R L  +LP I +V     N+DP+ P+   D +  R +  
Sbjct: 1   DPKIGGVMIMGDRGTGKSTTIRALADLLPEIPVVANDPFNSDPSDPDLMSDEV--RQKSG 58

Query: 572 SAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
           +   I  E  K   V +PLG TEDR+ G++D+E+++  G   F+PGLLA
Sbjct: 59  TGAEIPIEFKKVQMVDLPLGATEDRVCGTIDIEKALSEGVKAFEPGLLA 107



>gb:AP006618_560481 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 637

 Score = 79.3 bits (194), Expect = 6e-14
 Identities = 44/130 (33%), Positives = 69/130 (53%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           FP +AVVGQ+ ++ AL+L A+   IGG+ + G++GTAK+ + R L  +LPP+        
Sbjct: 7   FPFSAVVGQERLQLALILCAVHPGIGGVLVRGEKGTAKSTVVRALAQLLPPV-------- 58

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
                               D  G     +     V++P+G TEDR++GS+D+E  ++ G
Sbjct: 59  -------------------VDETGARPARL-----VELPVGATEDRVVGSLDLERVLRDG 94

Query: 689 TTVFQPGLLA 718
              F+PGLLA
Sbjct: 95  EQAFRPGLLA 104



>gb:AE012819_285908 Chlorobium tepidum TLS section 40 of 194 of the
           complete genome.>gb:AE006470_933076 Chlorobium tepidum
           TLS complete genome.
          Length = 649

 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 44/133 (33%), Positives = 69/133 (51%)
 Frame = +2

Query: 320 RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG 499
           R+YFP +A++GQ+ +K ALLL A++  IGG+ + G++GTAK+   R L A+L       G
Sbjct: 3   RKYFPFSAILGQEDLKKALLLNAVNPRIGGVLVRGEKGTAKSTAVRALGALLAAARNGSG 62

Query: 500 SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV 679
                                        + E++    V +PL  TE+ + G +D ++++
Sbjct: 63  G----------------------------EGEVV----VTLPLNATEEMVAGGIDFQQTM 90

Query: 680 KSGTTVFQPGLLA 718
           K G  VFQPGLLA
Sbjct: 91  KEGRRVFQPGLLA 103



>gb:AE016867_352547 Pseudomonas syringae pv. tomato str. DC3000
           section 12 of 21 of the complete
           genome.>gb:AE016853_1037722 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 342

 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 48/139 (34%), Positives = 66/139 (47%)
 Frame = +2

Query: 302 DTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPP 481
           D++     +FPLAAVVG D +K AL L AID  IGG+ I G RG AK+ +ARGL  +L  
Sbjct: 5   DSSLSDTAHFPLAAVVGADDLKLALCLTAIDPRIGGVLIEGPRGMAKSTLARGLADLL-- 62

Query: 482 IEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSV 661
                                                      FV +PLG TE+RL+G++
Sbjct: 63  ---------------------------------------ASGQFVTLPLGATEERLVGTL 83

Query: 662 DVEESVKSGTTVFQPGLLA 718
           D++ ++  G   F PG+LA
Sbjct: 84  DLDAALAEGRARFSPGVLA 102



>gb:AE016787_332921 Pseudomonas putida KT2440 section 14 of 21 of
           the complete genome.>gb:AE015451_947998 Pseudomonas
           putida KT2440 complete genome.
          Length = 337

 Score = 76.6 bits (187), Expect = 4e-13
 Identities = 47/130 (36%), Positives = 64/130 (49%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           FPLAAVVG D +K AL L AID  IGG+ I G RG AK+ +ARGL  +L           
Sbjct: 7   FPLAAVVGADDLKLALCLTAIDPRIGGVLIEGPRGMAKSTLARGLADLLG---------- 56

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
                                          + PFV +PLG +E+RL+G++D++ ++  G
Sbjct: 57  -------------------------------EGPFVTLPLGASEERLVGTLDLDAALGQG 85

Query: 689 TTVFQPGLLA 718
              F PG+LA
Sbjct: 86  KAQFSPGVLA 95



>gb:AE017261_419195 Picrophilus torridus DSM 9790, complete genome.
          Length = 261

 Score = 75.9 bits (185), Expect = 7e-13
 Identities = 47/117 (40%), Positives = 63/117 (53%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           FP +A+V QD +K  LL+ AID  IGGI I G +G AKT M R L  +LP I+   G   
Sbjct: 6   FPFSAIVKQDLVKLGLLINAIDPGIGGILIIGPKGIAKTTMVRSLSKILPEIKST-GCRF 64

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV 679
           N DP       D   D ++      +KT   K    +IPL  T DR+ GS+DV+ ++
Sbjct: 65  NCDPDDENSLCDECLDNLKNK---KLKTVYKKIDIKEIPLSATIDRVAGSLDVKAAL 118



>pir|H84309|H84309 protoporphyrin IX magnesium chelatase [imported]
           - Halobacterium sp. NRC-1>gb:AE005068_63004
           Halobacterium sp. NRC-1 section 99 of 170 of the
           complete genome.>gb:AE004437_887923 Halobacterium sp.
           NRC-1 complete genome.
          Length = 690

 Score = 75.9 bits (185), Expect = 7e-13
 Identities = 46/129 (35%), Positives = 73/129 (56%)
 Frame = +2

Query: 332 PLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISN 511
           P  AVVGQD +KT LL  A + ++ G+ ++G++GTAK+  AR L  +LP     + ++++
Sbjct: 19  PFPAVVGQDDLKTGLLAVAANASLDGLLVTGEKGTAKSTTARALADLLPD----QRAVAD 74

Query: 512 ADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGT 691
               CP   ED      +     +   E    PFV +PLG + DR++GS+ V +++ +G 
Sbjct: 75  CPYGCPP--EDPTRQCADCRDRTDPPVESRPVPFVTLPLGASRDRVVGSLSVTDAL-AGD 131

Query: 692 TVFQPGLLA 718
             F PGLLA
Sbjct: 132 AEFSPGLLA 140



>gb:BX248343_760232 Mycobacterium bovis subsp. bovis AF2122/97
           complete genome; segment 10/14.
          Length = 629

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 43/130 (33%), Positives = 66/130 (50%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           +P +A+VG D ++ ALLL A+   IGG  I G++GTAK+   RGL A+L           
Sbjct: 4   YPFSAIVGHDRLRLALLLCAVRPEIGGALIRGEKGTAKSTAVRGLAALL----------- 52

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
                                   ++ T   ++  V++PLG TEDR++GS+D++  ++ G
Sbjct: 53  ------------------------SVATGSTETGLVELPLGATEDRVVGSLDLQRVMRDG 88

Query: 689 TTVFQPGLLA 718
              F PGLLA
Sbjct: 89  EHAFSPGLLA 98



>sp|O05809|YS50_MYCTU Hypothetical protein
           Rv2850c/MT2916.>pir|E70589|E70589 protoporphyrin IX
           magnesium chelatase (EC 4.99.1.-) - Mycobacterium
           tuberculosis (strain H37RV)>gb:BX842581_820941
           Mycobacterium tuberculosis H37Rv complete genome;
           segment 10/13.
          Length = 629

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 43/130 (33%), Positives = 66/130 (50%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           +P +A+VG D ++ ALLL A+   IGG  I G++GTAK+   RGL A+L           
Sbjct: 4   YPFSAIVGHDRLRLALLLCAVRPEIGGALIRGEKGTAKSTAVRGLAALL----------- 52

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
                                   ++ T   ++  V++PLG TEDR++GS+D++  ++ G
Sbjct: 53  ------------------------SVATGSTETGLVELPLGATEDRVVGSLDLQRVMRDG 88

Query: 689 TTVFQPGLLA 718
              F PGLLA
Sbjct: 89  EHAFSPGLLA 98



>gb:AE017237_413624 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 11 of 16 of the complete
           genome.>gb:AE016958_1057028 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 613

 Score = 73.6 bits (179), Expect = 4e-12
 Identities = 46/130 (35%), Positives = 65/130 (50%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           +P +A+VG D ++ ALLL A+   IGG  I G++GTAK+   RGL A+L       GS +
Sbjct: 4   YPFSAIVGHDRLRLALLLCAVRPEIGGALIRGEKGTAKSTAVRGLAALL---SAATGSDA 60

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
           N                                  V++PLG TEDR+IGS+D++  ++ G
Sbjct: 61  N---------------------------------LVEMPLGATEDRVIGSLDLQRVLRDG 87

Query: 689 TTVFQPGLLA 718
              F PGLLA
Sbjct: 88  EHAFSPGLLA 97



>gb:AE017283_429893 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 654

 Score = 72.8 bits (177), Expect = 6e-12
 Identities = 44/130 (33%), Positives = 66/130 (50%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           +P  AVVGQD  + ALLL A++  IGG+ +SG++GTAK+ + RGL      +E++ G I 
Sbjct: 3   YPFTAVVGQDEARLALLLCAVNPRIGGVILSGEKGTAKSTVVRGL------VELLPGHIM 56

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
                                                + LG TEDRL+G +D+E ++ +G
Sbjct: 57  RT-----------------------------------LALGTTEDRLVGGLDLEATLVAG 81

Query: 689 TTVFQPGLLA 718
            +V QPGLL+
Sbjct: 82  RSVLQPGLLS 91



>gb:AY659213_2148223 Synthetic construct Peudomonas aeruginosa clone
           FLH051224.01F PA2942 gene, partial cds.
          Length = 339

 Score = 72.4 bits (176), Expect = 8e-12
 Identities = 43/131 (32%), Positives = 64/131 (48%)
 Frame = +2

Query: 326 YFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSI 505
           ++PL+AVV  D +K AL L A+D  IGG+ I G RG AK+ +ARG+  +LP  E      
Sbjct: 6   HYPLSAVVAADELKLALCLAAVDPAIGGVLIEGPRGMAKSTLARGVAELLPAGE------ 59

Query: 506 SNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKS 685
                                              FV +PLG +E+R++GS+D++ ++  
Sbjct: 60  -----------------------------------FVTLPLGASEERIVGSLDLDAALGE 84

Query: 686 GTTVFQPGLLA 718
           G   F PG+LA
Sbjct: 85  GRARFSPGVLA 95



>pir|E83278|E83278 probable magnesium chelatase PA2942 [imported] -
           Pseudomonas aeruginosa (strain PAO1)>gb:AE004720_57178
           Pseudomonas aeruginosa PAO1, section 281 of 529 of the
           complete genome.>gb:AE004091_971278 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 338

 Score = 72.4 bits (176), Expect = 8e-12
 Identities = 43/131 (32%), Positives = 64/131 (48%)
 Frame = +2

Query: 326 YFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSI 505
           ++PL+AVV  D +K AL L A+D  IGG+ I G RG AK+ +ARG+  +LP  E      
Sbjct: 6   HYPLSAVVAADELKLALCLAAVDPAIGGVLIEGPRGMAKSTLARGVAELLPAGE------ 59

Query: 506 SNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKS 685
                                              FV +PLG +E+R++GS+D++ ++  
Sbjct: 60  -----------------------------------FVTLPLGASEERIVGSLDLDAALGE 84

Query: 686 GTTVFQPGLLA 718
           G   F PG+LA
Sbjct: 85  GRARFSPGVLA 95



>gb:AX066025_1459926 Sequence 369 from Patent WO0100842.
          Length = 189

 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 43/130 (33%), Positives = 62/130 (47%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           +P +AVVGQD ++ AL+L AI   IGG+ I G++GTAKT   R    +L           
Sbjct: 8   YPFSAVVGQDELRLALILTAISPRIGGVVIRGEKGTAKTTTVRAFAGLLG---------- 57

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
                                           +P V +PLG TEDR++GS+++E  + +G
Sbjct: 58  -------------------------------DAPLVNLPLGSTEDRVVGSLNMETVLTTG 86

Query: 689 TTVFQPGLLA 718
              +QPGLLA
Sbjct: 87  RAEYQPGLLA 96



>gb:BA000036_719724 Corynebacterium glutamicum ATCC 13032 DNA,
           complete genome.>gb:BX927153_833532 Corynebacterium
           glutamicum ATCC 13032, IS fingerprint type 4-5, complete
           genome; segment 6/10.>gb:AX066021_1459924 Sequence 365
           from Patent WO0100842.>gb:AX771871_1474836 Sequence 83
           from Patent WO03040290.
          Length = 367

 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 43/130 (33%), Positives = 62/130 (47%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           +P +AVVGQD ++ AL+L AI   IGG+ I G++GTAKT   R    +L           
Sbjct: 8   YPFSAVVGQDELRLALILTAISPRIGGVVIRGEKGTAKTTTVRAFAGLLG---------- 57

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
                                           +P V +PLG TEDR++GS+++E  + +G
Sbjct: 58  -------------------------------DAPLVNLPLGSTEDRVVGSLNMETVLTTG 86

Query: 689 TTVFQPGLLA 718
              +QPGLLA
Sbjct: 87  RAEYQPGLLA 96



>gb:AF454055_512597 Corynebacterium glutamicum putative Mg-Chelatase
           subunit ChlI gene, partial cds.
          Length = 156

 Score = 71.6 bits (174), Expect = 1e-11
 Identities = 43/130 (33%), Positives = 62/130 (47%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           +P +AVVGQD ++ AL+L AI   IGG+ I G++GTAKT   R    +L           
Sbjct: 8   YPFSAVVGQDELRLALILTAISPRIGGVVIRGEKGTAKTTTVRAFAGLLG---------- 57

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
                                           +P V +PLG TEDR++GS+++E  + +G
Sbjct: 58  -------------------------------DAPLVNLPLGSTEDRVVGSLNMETVLTTG 86

Query: 689 TTVFQPGLLA 718
              +QPGLLA
Sbjct: 87  RAEYQPGLLA 96



>gb:BA000035_716674 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 379

 Score = 70.1 bits (170), Expect = 4e-11
 Identities = 40/130 (30%), Positives = 62/130 (47%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           +P +AVVGQD ++ AL+L AI   IGG+ + G++GTAKT   R    +L           
Sbjct: 20  YPFSAVVGQDELRLALILTAISPRIGGVVVRGEKGTAKTTTVRAFAGLLG---------- 69

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
                                           +P + +PLG TEDR++GS+++E  + +G
Sbjct: 70  -------------------------------DAPLINLPLGATEDRVVGSLNMETVLTTG 98

Query: 689 TTVFQPGLLA 718
              ++PGLLA
Sbjct: 99  RAEYKPGLLA 108



>gb:AY596297_634207 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 719

 Score = 69.7 bits (169), Expect = 5e-11
 Identities = 43/127 (33%), Positives = 70/127 (55%)
 Frame = +2

Query: 338 AAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNAD 517
           AAVVGQ  +K  LL  A D ++ G+ + G++GTAK+   R L  +LP     + ++++  
Sbjct: 17  AAVVGQRDLKDGLLAVATDDDLDGLLVRGEKGTAKSTAVRALADLLPE----QRAVADCP 72

Query: 518 PTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTV 697
             CP +  D   +     S   ++T  +  P V +PLG T DR++G++ V +++  G   
Sbjct: 73  YGCPPDRPDEQCEDCRTRSDPPVETRSV--PLVTLPLGATRDRVVGTLSVADAL-DGDHE 129

Query: 698 FQPGLLA 718
           F PGLLA
Sbjct: 130 FDPGLLA 136



>gb:AJ616741_1812022 Nicotiana tabacum partial mRNA for magnesium
           chelatase subunit (su-s gene).
          Length = 116

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 32/67 (47%), Positives = 42/67 (62%)
 Frame = +2

Query: 320 RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG 499
           R  +P AA+VGQD +K  LLL  ID  IGG+ I G RGT K+   R L  +LP I+++ G
Sbjct: 50  RPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVISG 109

Query: 500 SISNADP 520
              N+DP
Sbjct: 110 DPFNSDP 116



>gb:NBE571699_1688168 Nicotiana benthamiana partial mRNA for
           magnesium chelatase subunit (su-s gene).
          Length = 116

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 32/67 (47%), Positives = 42/67 (62%)
 Frame = +2

Query: 320 RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG 499
           R  +P AA+VGQD +K  LLL  ID  IGG+ I G RGT K+   R L  +LP I+++ G
Sbjct: 50  RPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGTGKSTTVRSLVDLLPEIKVISG 109

Query: 500 SISNADP 520
              N+DP
Sbjct: 110 DPFNSDP 116



>gb:BX571965_791554 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.
          Length = 408

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 38/130 (29%), Positives = 62/130 (47%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           +P +A++GQ A++ ALLL A+D  +GG+ +SG RGTAK+  AR L  +LP          
Sbjct: 5   YPFSALIGQAALQQALLLVAVDPGLGGVLVSGPRGTAKSTAARALAELLP---------- 54

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
                                          +  FV +PL  +++++ GS+D+  ++   
Sbjct: 55  -------------------------------EGRFVTLPLSASDEQVTGSLDLASALADN 83

Query: 689 TTVFQPGLLA 718
           T  F PGL+A
Sbjct: 84  TVRFSPGLVA 93



>sp|O50313|BCHD_CHLVI Magnesium-chelatase 67 kDa subunit (EC
           6.6.1.1) (Mg-protoporphyrin IX chelatase) (Mg-chelatase
           subunit D).>pir|T17193|T17193 probable protoporphyrin IX
           magnesium chelatase (EC 4.99.1.-), 67 K chain -
           Chlorobium vibrioforme>gb:CVZ83933_119837 Chlorobium
           vibrioforme 15 kb genomic DNA fragment.
          Length = 619

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 40/125 (32%), Positives = 58/125 (46%)
 Frame = +2

Query: 344 VVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPT 523
           +VG D  K AL+L A+D ++GG+ I    G+ K+ +AR    +LP               
Sbjct: 7   IVGMDLAKQALMLLAVDPSLGGVVIPSTVGSGKSTLARAFADILPE-------------- 52

Query: 524 CPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQ 703
                                      +PFV++PL VTEDRLIG VD+E ++ SG  V Q
Sbjct: 53  --------------------------GTPFVELPLNVTEDRLIGGVDLEATLASGQRVVQ 86

Query: 704 PGLLA 718
            G+L+
Sbjct: 87  HGVLS 91



>sp|Q93SW0|BCHD_CHLTE Magnesium-chelatase 67 kDa subunit (EC
           6.6.1.1) (Mg-protoporphyrin IX chelatase) (Mg-chelatase
           subunit D).>gb:AE012889_286768 Chlorobium tepidum TLS
           section 110 of 194 of the complete
           genome.>gb:AY005135_584400 Chlorobium tepidum Ybc5
           (ybc5) gene, partial cds; Dld2 (dld2), BchI (chlI), BchD
           (bchD), and BchH3 (bchH3) genes, complete cds; and
           unknown gene.>gb:AE006470_933936 Chlorobium tepidum TLS
           complete genome.
          Length = 620

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 40/125 (32%), Positives = 58/125 (46%)
 Frame = +2

Query: 344 VVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPT 523
           +VG D  K AL+L A+D ++GG+ I    G+ K+ +AR    +LP               
Sbjct: 7   IVGMDLAKQALMLLAVDPSLGGVVIPSTVGSGKSTLARAFADILPE-------------- 52

Query: 524 CPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQ 703
                                      +PFV++PL VTEDRLIG VD+E ++ SG  V Q
Sbjct: 53  --------------------------GTPFVELPLNVTEDRLIGGVDLEATLASGQRVVQ 86

Query: 704 PGLLA 718
            G+L+
Sbjct: 87  HGVLS 91



>gb:AF288461_496037 Chloroflexus aurantiacus BchI (bchI) and BchD
           (bchD) genes, complete cds; and unknown genes.
          Length = 634

 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 41/129 (31%), Positives = 60/129 (46%)
 Frame = +2

Query: 332 PLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISN 511
           P  A+VG D  + ALLL A+D ++ G+AI    GT K+ + R    +L            
Sbjct: 14  PFTAIVGLDTARQALLLLAVDPSLAGVAIGAGAGTGKSALVRAFARML-------AGGRE 66

Query: 512 ADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGT 691
            DPT P  W+                        V++P+GV+EDRL+G +D+E +   G 
Sbjct: 67  FDPTIP--WQ-----------------------LVEMPVGVSEDRLLGGIDIESNPGDGE 101

Query: 692 TVFQPGLLA 718
            V + GLLA
Sbjct: 102 RVHRSGLLA 110



>gb:AE017248_415800 Treponema denticola ATCC 35405, section 3 of 10
           of the complete genome.>gb:AE017226_1069396 Treponema
           denticola ATCC 35405, complete genome.
          Length = 309

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 37/133 (27%), Positives = 61/133 (45%)
 Frame = +2

Query: 320 RQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKG 499
           +Q FP   + GQ+ IK A++L  I   I G+ I G++GT K+ + RG+  ++        
Sbjct: 4   KQIFPFVQIEGQEDIKLAIILNLICPAISGVLIRGEKGTGKSTIVRGIGELM-------- 55

Query: 500 SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV 679
                                      N+K        +++P+  TEDR+ GS+D+E  +
Sbjct: 56  ----------------------QRQGENLKV-------IELPINATEDRVAGSIDIERVL 86

Query: 680 KSGTTVFQPGLLA 718
           K+G  V Q G+LA
Sbjct: 87  KTGEKVLQKGILA 99



>gb:AE000516_23011 Mycobacterium tuberculosis CDC1551, complete
           genome.
          Length = 610

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 35/114 (30%), Positives = 54/114 (47%)
 Frame = +2

Query: 377 LLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLAD 556
           +L A+   IGG  I G++GTAK+   RGL A+L                           
Sbjct: 1   MLCAVRPEIGGALIRGEKGTAKSTAVRGLAALL--------------------------- 33

Query: 557 RVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
                   ++ T   ++  V++PLG TEDR++GS+D++  ++ G   F PGLLA
Sbjct: 34  --------SVATGSTETGLVELPLGATEDRVVGSLDLQRVMRDGEHAFSPGLLA 79



>gb:AE017248_415799 Treponema denticola ATCC 35405, section 3 of 10
           of the complete genome.>gb:AE017226_1069395 Treponema
           denticola ATCC 35405, complete genome.
          Length = 643

 Score = 52.4 bits (124), Expect = 8e-06
 Identities = 36/129 (27%), Positives = 53/129 (41%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
           +P + +VGQ  +  ALL+ A+   I  + I+G +GT KT+ AR L               
Sbjct: 6   YPFSLLVGQKKLVRALLVLAVSDKINSLLIAGWKGTGKTIAARSLK-------------- 51

Query: 509 NADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVKSG 688
                                        I     V IPL +TED L G +D++ S++SG
Sbjct: 52  ----------------------------NISDMSIVNIPLNITEDNLFGGLDIKASLESG 83

Query: 689 TTVFQPGLL 715
              FQ G+L
Sbjct: 84  KIKFQHGIL 92



>gb:AE017283_430576 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 600

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 41/131 (31%), Positives = 56/131 (42%)
 Frame = +2

Query: 323 QYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGS 502
           ++FP  A+VGQ   + AL L AID  IGG+ I+G  GTAK+  AR    ++P        
Sbjct: 3   RHFPFVAIVGQSEPRLALTLLAIDPMIGGVLITGPLGTAKSTCARSFVDLVP-------- 54

Query: 503 ISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESVK 682
                         G+A R                    +  G T DRLI S+D+E ++ 
Sbjct: 55  --------------GIAVR-------------------DVTAGTTVDRLIRSMDLEAALA 81

Query: 683 SGTTVFQPGLL 715
           SG      GLL
Sbjct: 82  SGRRRDHVGLL 92



>gb:AE017283_430575 Propionibacterium acnes KPA171202, complete
           genome.
          Length = 273

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 21/37 (56%), Positives = 29/37 (78%)
 Frame = +2

Query: 608 PFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
           P V++P+GVTEDR+ G++DVE ++  G   FQPGLLA
Sbjct: 39  PVVELPVGVTEDRVAGTLDVETALVRGQQRFQPGLLA 75



>gb:AP006840_569630 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 545

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 33/123 (26%), Positives = 54/123 (43%), Gaps = 4/123 (3%)
 Frame = +2

Query: 329 FPLAAVVGQDAIKTALLLGAIDRNIGG---IAISGKRGTAKTVMARGLHAVLPPIEIVKG 499
           F L    G DA+  A+ +  +    G    I   G RGT KT + R +   LP I  ++G
Sbjct: 5   FGLVRHPGNDALFRAVEMSLVSTLAGRPLHIHAEGLRGTGKTTIMRRVRKALPRIRRIRG 64

Query: 500 SISNADPTCPE-EWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEES 676
            + N DP+ P      GL+     +    +  E +  PF++I        ++GS+D+   
Sbjct: 65  CLYNCDPSAPHCPVHRGLSP----EEVAALGEERVPMPFLEISHAAKIGTVVGSIDLSRL 120

Query: 677 VKS 685
           V +
Sbjct: 121 VSA 123



>gb:AE010318_261824 Methanopyrus kandleri AV19 section 17 of 157 of
           the complete genome.>gb:AE009439_902605 Methanopyrus
           kandleri AV19, complete genome.
          Length = 818

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 43/143 (30%), Positives = 66/143 (46%), Gaps = 10/143 (6%)
 Frame = +2

Query: 317 GRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVK 496
           G+   PL  ++GQ  +K  +L   I      + I G  G  KT +AR +  +LPP E+VK
Sbjct: 19  GKGEDPLPQILGQREVKIQVLSALIAGR--HVLIEGPPGIGKTTLARAVADLLPPAEVVK 76

Query: 497 GSISNA---DPTCPEEWEDGLADRVEYDSAGNIKTEIIK--SPFVQI--PLGVTEDRLIG 655
           G   +    +P CP      L    + D    ++TE I     FV+I     +T + L+G
Sbjct: 77  GCPFHCHPKEPVCP------LCRARDED---ELETETIPGCERFVRIQGSPDLTPEDLLG 127

Query: 656 SVDVEESVKSGTT---VFQPGLL 715
            +D   +++ G T    F PG L
Sbjct: 128 DIDPIAALEYGPTDPRAFTPGKL 150



>gb:SCO939123_178949 Streptomyces coelicolor A3(2) complete genome;
           segment 20/29.
          Length = 309

 Score = 42.4 bits (98), Expect = 0.009
 Identities = 35/132 (26%), Positives = 52/132 (39%), Gaps = 4/132 (3%)
 Frame = +2

Query: 332 PLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGL----HAVLPPIEIVKG 499
           P + VV QD +K AL L  +   IGG+ ++G RGTAK+ + R      H  LP       
Sbjct: 8   PYSRVVAQDELKLALELHHVVPRIGGVLMAGPRGTAKSTLVRAFALMAHGELP------- 60

Query: 500 SISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIPLGVTEDRLIGSVDVEESV 679
                                                 V +P+  T+DR++G  D++  +
Sbjct: 61  --------------------------------------VTLPINATDDRVVGGWDLDALI 82

Query: 680 KSGTTVFQPGLL 715
           + G    QPGLL
Sbjct: 83  R-GEPRPQPGLL 93



>gb:AE017340_455980 Idiomarina loihiensis L2TR, complete genome.
          Length = 515

 Score = 40.0 bits (92), Expect = 0.043
 Identities = 22/50 (44%), Positives = 32/50 (64%)
 Frame = +2

Query: 335 LAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPI 484
           LA VVGQ+  K ALLL A  ++   +   G  GT KT++A+ L+ +LPP+
Sbjct: 193 LADVVGQEQAKRALLLSAAGKH--HLLFVGPPGTGKTMLAQRLNGILPPL 240



>pir|F82985|F82985 conserved hypothetical protein PA5290 [imported]
           - Pseudomonas aeruginosa (strain PAO1)>gb:AE004941_59522
           Pseudomonas aeruginosa PAO1, section 502 of 529 of the
           complete genome.>gb:AE004091_973622 Pseudomonas
           aeruginosa PAO1, complete genome.
          Length = 497

 Score = 35.8 bits (81), Expect = 0.82
 Identities = 22/54 (40%), Positives = 31/54 (57%)
 Frame = +2

Query: 326 YFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIE 487
           Y  LA V GQ A K ALL+ A   +   + +SG  GT KT++A  L  +LP ++
Sbjct: 188 YPDLAEVQGQAAAKRALLVAAAGAH--NLLLSGPPGTGKTLLASRLPGLLPALD 239



>gb:CR555306_107178 Azoarcus sp. EbN1 complete genome.
          Length = 497

 Score = 34.7 bits (78), Expect = 1.8
 Identities = 25/75 (33%), Positives = 38/75 (50%)
 Frame = +2

Query: 263 NGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAK 442
           NG  V  P  P   + + G     LA V GQ   + AL + A  ++   + + G  GT K
Sbjct: 168 NGRAVLPPHLPPLRSRS-GPPEADLAEVKGQLQARRALEVAAAGQH--SLLLFGPPGTGK 224

Query: 443 TVMARGLHAVLPPIE 487
           +++AR L  +LPP+E
Sbjct: 225 SMLARRLPGLLPPME 239



>sp|P43746|DP3X_HAEIN DNA polymerase III subunit gamma/tau (EC
           2.7.7.7).>pir|F64111|F64111 DNA-directed DNA polymerase
           (EC 2.7.7.7) III gamma/tau chain - Haemophilus
           influenzae (strain Rd KW20)>gb:U32802_204893 Haemophilus
           influenzae Rd KW20 section 117 of 163 of the complete
           genome.>gb:L42023_1097442 Haemophilus influenzae Rd KW20
           complete genome.
          Length = 688

 Score = 34.7 bits (78), Expect = 1.8
 Identities = 28/87 (32%), Positives = 36/87 (41%), Gaps = 1/87 (1%)
 Frame = +2

Query: 338 AAVVGQDAIKTALLLGAIDRNI-GGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSISNA 514
           A VVGQ+ I TAL  G  D  +      SG RG  KT +AR     L  +  V  +    
Sbjct: 16  ADVVGQEHIITALANGLKDNRLHHAYLFSGTRGVGKTSIARLFAKGLNCVHGVTATPCGE 75

Query: 515 DPTCPEEWEDGLADRVEYDSAGNIKTE 595
              C    +    D +E D+A   K E
Sbjct: 76  CENCKAIEQGNFIDLIEIDAASRTKVE 102



>gb:AF313480_1261599 Drosophila melanogaster gamma dynein (kl-3) mRNA,
            partial cds.
          Length = 2797

 Score = 33.9 bits (76), Expect = 3.1
 Identities = 22/79 (27%), Positives = 37/79 (46%)
 Frame = +2

Query: 329  FPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPIEIVKGSIS 508
            F    V   D ++TA LL  I + +  + + G++GTAKTVM +       P   +  S +
Sbjct: 952  FSSILVPNVDNVRTAFLLHNIAKQLKQVLLIGEQGTAKTVMIKAYMGHYDPEVHIFKSFN 1011

Query: 509  NADPTCPEEWEDGLADRVE 565
             +  T P  ++  +   VE
Sbjct: 1012 FSSATTPNMYQRIIESYVE 1030



>gb:POL505006_159106 Sorangium cellulosum spiG gene (partial), spiH
            gene, spiI gene, spiJ gene, spiK gene, spiL gene and spiZ
            gene.
          Length = 3513

 Score = 33.9 bits (76), Expect = 3.1
 Identities = 26/50 (52%), Positives = 30/50 (60%), Gaps = 2/50 (4%)
 Frame = +2

Query: 335  LAAVVGQD-AIKTALLLGAIDRNIGGI-AISGKRGTAKTVMARGLHAVLP 478
            LAAV G+  A +  LLLGA+  NIG + A SG  G AK V A   HA LP
Sbjct: 1924 LAAVYGEGRAPERPLLLGAVKTNIGHLEAASGLAGVAKIVAAM-QHATLP 1972



>pir|D69430|D69430 conserved hypothetical protein AF1445 -
           Archaeoglobus fulgidus>gb:AE001004_30480 Archaeoglobus
           fulgidus DSM 4304 section 103 of 172 of the complete
           genome.>gb:AE000782_975328 Archaeoglobus fulgidus DSM
           4304 complete genome.
          Length = 495

 Score = 33.9 bits (76), Expect = 3.1
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 5/71 (7%)
 Frame = +2

Query: 332 PLAAVVGQDA----IKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLP-PIEIVK 496
           P   ++G++     +KTAL+ G+       I   GK+G  KT  ++ +  +LP  I  +K
Sbjct: 80  PFEEIIGKEKEKEMVKTALMSGS------NILFKGKKGYGKTTFSKAISKLLPDKILAIK 133

Query: 497 GSISNADPTCP 529
           G   + DPT P
Sbjct: 134 GCRIHDDPTQP 144



>gb:AY623658_637462 Aeromicrobium erythreum erythromycin biosynthesis
            gene cluster, partial sequence.
          Length = 3528

 Score = 33.1 bits (74), Expect = 5.3
 Identities = 28/107 (26%), Positives = 48/107 (44%), Gaps = 1/107 (0%)
 Frame = +2

Query: 248  INASANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGI-AISG 424
            + A   G+ +  P + +A   AYG               +  LLLG++  N+G   A +G
Sbjct: 816  VEAHGTGTRLGDPIEASALRDAYGEDR------------ERPLLLGSVKSNVGHTQAAAG 863

Query: 425  KRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVE 565
              G  K V+A   H ++PP      ++  A+P+   +W DG  + V+
Sbjct: 864  VVGLMKLVLALR-HELVPP------TLHAAEPSTEIDWSDGTLELVQ 903



>gb:AP006840_567202 Symbiobacterium thermophilum DNA, complete
           genome.
          Length = 570

 Score = 33.1 bits (74), Expect = 5.3
 Identities = 27/91 (29%), Positives = 37/91 (40%), Gaps = 3/91 (3%)
 Frame = +2

Query: 320 RQYFP--LAAVVGQDAIKTALLLGAIDRNIG-GIAISGKRGTAKTVMARGLHAVLPPIEI 490
           R+Y P     VVGQ+ I   L    +   +     +SG RGT KT +AR L   +  +  
Sbjct: 8   REYRPQRFGEVVGQEHITRTLRNAIVQGRLHHAYLLSGPRGTGKTTVARILAKAVNCLNP 67

Query: 491 VKGSISNADPTCPEEWEDGLADRVEYDSAGN 583
             G   N    C         D +E D+A N
Sbjct: 68  QDGEPCNECEACRRITSGEALDLIEIDAASN 98



>gb:AY045575_1935093 Homo sapiens axonemal dynein heavy chain DNAH5
            mRNA, complete cds.
          Length = 4624

 Score = 32.7 bits (73), Expect = 6.9
 Identities = 23/78 (29%), Positives = 34/78 (43%)
 Frame = +2

Query: 293  PAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAV 472
            P+  T  YG    P       D ++T  L+  I +    + + G++GTAKTV        
Sbjct: 2552 PSDTTPEYGSILVP-----NVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTV-------- 2598

Query: 473  LPPIEIVKGSISNADPTC 526
                 I+KG +S  DP C
Sbjct: 2599 -----IIKGFMSKYDPEC 2611



>gb:AE016874_354338 Pseudomonas syringae pv. tomato str. DC3000
           section 19 of 21 of the complete
           genome.>gb:AE016853_1039513 Pseudomonas syringae pv.
           tomato str. DC3000 complete genome.
          Length = 253

 Score = 32.7 bits (73), Expect = 6.9
 Identities = 21/58 (36%), Positives = 29/58 (50%), Gaps = 2/58 (3%)
 Frame = -2

Query: 490 YFNWRQNCMQSTSHHSFGRPTFSR-YRN-SSYIAVNRPK*KSSFNSILSDDGS*REVL 323
           Y   + N +  T HH FG P+FSR +RN S Y  +  P  ++ F      DG  R +L
Sbjct: 56  YLKRQSNYLTHTLHHPFGEPSFSREFRNISRYRKLGIPALQAVFYGERKVDGERRAIL 113



>gb:STYPPHCM1_194600 Salmonella enterica subsp. enterica serovar
           Typhi str. CT18 plasmid pHCM1.>gb:AF105019_479445
           Salmonella typhi plasmid R27 tra2 region, complete
           sequence.>gb:AF250878_492717 Salmonella typhi R27
           plasmid complete sequence.
          Length = 1058

 Score = 32.7 bits (73), Expect = 6.9
 Identities = 21/60 (35%), Positives = 26/60 (43%)
 Frame = -2

Query: 538 PLFRTGRISI*NGAFNYFNWRQNCMQSTSHHSFGRPTFSRYRNSSYIAVNRPK*KSSFNS 359
           P+F  GR  I N      NW QNC   TS  +      + Y +      N PK K +FNS
Sbjct: 243 PMFNAGRNEIGNAVAGTGNWLQNCNTETSKQTI----TTHYPDYKEFYCNSPK-KDNFNS 297



>gb:SCO939114_176691 Streptomyces coelicolor A3(2) complete genome;
           segment 11/29.
          Length = 329

 Score = 32.7 bits (73), Expect = 6.9
 Identities = 19/43 (44%), Positives = 26/43 (60%)
 Frame = +2

Query: 341 AVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHA 469
           AVVGQDA  T L++  + R  G + + G  G AKT++ R L A
Sbjct: 31  AVVGQDAAVTGLVVALLCR--GHVLLEGVPGVAKTLLVRTLAA 71



>gb:POL505006_159105 Sorangium cellulosum spiG gene (partial), spiH
            gene, spiI gene, spiJ gene, spiK gene, spiL gene and spiZ
            gene.
          Length = 5017

 Score = 32.7 bits (73), Expect = 6.9
 Identities = 25/50 (50%), Positives = 29/50 (58%), Gaps = 2/50 (4%)
 Frame = +2

Query: 335  LAAVVGQD-AIKTALLLGAIDRNIGGI-AISGKRGTAKTVMARGLHAVLP 478
            LAAV G+  A +  LLLGA+  NIG + A SG  G AK V A   H  LP
Sbjct: 3472 LAAVYGEGRAAERPLLLGAVKSNIGHLEAASGLAGVAKIVTALE-HGALP 3520



>gb:AB017350_3205 Acidiphilium rubrum bchP, bchI, bchD, crtI genes
           and 2 ORFs, partial and complete cds.
          Length = 558

 Score = 32.7 bits (73), Expect = 6.9
 Identities = 13/38 (34%), Positives = 25/38 (65%)
 Frame = +2

Query: 605 SPFVQIPLGVTEDRLIGSVDVEESVKSGTTVFQPGLLA 718
           +P  ++P  +T+DRL+G +D+  ++  G+ +   GLLA
Sbjct: 56  TPVRRLPTHITDDRLLGGLDLAGTLSFGSRIVATGLLA 93



>gb:BA000016_674744 Clostridium perfringens str. 13 DNA, complete
           genome.
          Length = 507

 Score = 32.3 bits (72), Expect = 9.0
 Identities = 13/47 (27%), Positives = 30/47 (63%)
 Frame = +2

Query: 344 VVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKTVMARGLHAVLPPI 484
           + GQ++ K A+++ A   +   + + G  G+ KT++A+G+ ++LP +
Sbjct: 193 ICGQESAKRAMIIAAAGNH--NVILQGPPGSGKTMLAKGVKSLLPEL 237



>gb:SCU24241_181682 Sorangium cellulosum acyl-CoA dehydrogenase
            (sorE), beta-hydroxybutyryl-CoA dehydrogenase (sorD),
            putative methoxymalonyl-CoA synthase (sorC), reductase
            (sorR), soraphen polyketide synthase A (sorA), soraphen
            polyketide synthase B (sorB), O-methyltransferase (sorM),
            beta-mannanase, and xylanse-arabinofuranosidase
            bifunctional enzyme genes, complete cds; and unknown
            genes.
          Length = 6315

 Score = 32.3 bits (72), Expect = 9.0
 Identities = 22/51 (43%), Positives = 31/51 (60%), Gaps = 2/51 (3%)
 Frame = +2

Query: 335  LAAVVGQD-AIKTALLLGAIDRNIGGI-AISGKRGTAKTVMARGLHAVLPP 481
            LAAV G+  + +  L LGA+  N+G + A +G  G AK ++A  LH  LPP
Sbjct: 2413 LAAVYGEGRSAEKPLFLGAVKTNVGHLEAAAGLAGVAK-IVASLLHNALPP 2462



>gb:SCO939127_179942 Streptomyces coelicolor A3(2) complete genome;
           segment 24/29.
          Length = 2152

 Score = 32.3 bits (72), Expect = 9.0
 Identities = 28/104 (26%), Positives = 45/104 (43%), Gaps = 1/104 (0%)
 Frame = +2

Query: 248 INASANGSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIG-GIAISG 424
           + A   G+ +  P +  A   +YGRQ                L LG++  NIG  +A +G
Sbjct: 336 VEAHGTGTRLGDPIEAQALLASYGRQR----------PADRPLYLGSLKSNIGHTVAAAG 385

Query: 425 KRGTAKTVMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLAD 556
             G  K +MA   H +LP       +++  +PT   +WE G  +
Sbjct: 386 AGGVIKMIMAM-RHGILPK------TLNVDEPTPMVDWEAGAVE 422



>gb:RSU86454_168402 Rhodobacter sphaeroides hook length control
           protein FliK (flik) gene, complete cds.
          Length = 700

 Score = 32.3 bits (72), Expect = 9.0
 Identities = 39/159 (24%), Positives = 60/159 (37%), Gaps = 4/159 (2%)
 Frame = +2

Query: 266 GSVVAAPQKPAADTTAYGRQYFPLAAVVGQDAIKTALLLGAIDRNIGGIAISGKRGTAKT 445
           G V  A + PAA+  +        AA VGQD  +TAL +      + G            
Sbjct: 500 GKVADASEAPAAENAS--------AATVGQDGAETALAVEPAGATLAGSDPVAPAPLTAL 551

Query: 446 VMARGLHAVLPPIEIVKGSISNADPTCPEEWEDGLADRVEYDSAGNIKTEIIKSPFVQIP 625
                L     P     G ++ A P  P E    L DR+   +AG  + EI+ +P     
Sbjct: 552 PSDLRLERAGEPRAGADGPLALAAPDAPAE----LQDRILEAAAGEGEIEIVLAPETLGR 607

Query: 626 LGVTEDRLIGSVDVEESVKSGTTV----FQPGLLAXLIE 730
           L +  +   G+  V  + ++         Q G L+ L+E
Sbjct: 608 LRIRVEMRDGTAQVSFTTETAEAARLLSGQEGRLSDLLE 646



>pir|JC5009|JC5009 nucleotide-binding protein D - Methanosarcina
           mazei>gb:MMORFDF_149155 M.mazei ORFD and ORFF
           genes.>gb:AE013422_292186 Methanosarcina mazei strain
           Goe1, section 204 of 379 of the complete
           genome.>gb:AE008384_966295 Methanosarcina mazei strain
           Goe1, complete genome.
          Length = 317

 Score = 32.3 bits (72), Expect = 9.0
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 3/51 (5%)
 Frame = +2

Query: 362 IKTALLLGAIDRNIGG---IAISGKRGTAKTVMARGLHAVLPPIEIVKGSI 505
           IKT   L  I  +IG    +A+ G+ G  K+V A  +  +LPP   VKG++
Sbjct: 22  IKTVTALSGISFSIGERETLALVGETGCGKSVAAHAIMRLLPPESGVKGTV 72


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 676,089,295
Number of Sequences: 1806583
Number of extensions: 12400488
Number of successful extensions: 33739
Number of sequences better than 10.0: 138
Number of HSP's better than 10.0 without gapping: 32808
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 33646
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 44325214704
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)