BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig4588
         (638 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:STU307031_1723041 Solanum tuberosum mRNA for ferredoxin I (fe...   170   2e-41   
sp|Q43517|FER1_LYCES|FER1_LYCES Ferredoxin I, chloroplast precursor.>pir|T0...   169   3e-41   Solanum lycopersicum
gb:AY864890_1631114 Nicotiana tabacum chloroplast ferredoxin I (...   166   4e-40   
gb:AY552781_1613403 Nicotiana tabacum chloroplast ferredoxin I (...   165   7e-40   
sp|Q9ZTS2|FER_CAPAN|FER_CAPAN Ferredoxin, chloroplast precursor (PFLP).>gb...   164   1e-39   Capsicum annuum
gb:AY189833_1588433 Helianthus annuus ferredoxin (FER1) mRNA, co...   149   3e-35   
sp|P09911|FER1_PEA|FER1_PEA Ferredoxin I, chloroplast precursor.>pir|S114...   146   3e-34   Pisum sativum [garden pea]
sp|P16972|FER_ARATH|FER_ARATH Ferredoxin, chloroplast precursor.>pir|S0997...   144   1e-33   Arabidopsis thaliana [mouse-ear cress]
sp|O04090|FER2_ARATH|FER2_ARATH Ferredoxin 2, chloroplast precursor.>pir|E8...   142   5e-33   Arabidopsis thaliana [mouse-ear cress]
gb:AY340639_1600674 Trifolium pratense ferredoxin I mRNA, comple...   141   1e-32   
sp|P04669|FER_SILPR|FER_SILPR Ferredoxin, chloroplast precursor.>pir|A2301...   139   3e-32   Silene latifolia subsp. alba [white campion]
sp|P00221|FER1_SPIOL|FER1_SPIOL Ferredoxin I, chloroplast precursor (Fd I)....   134   1e-30   Spinacia oleracea
sp|O04683|FER1_MESCR|FER1_MESCR Ferredoxin I, chloroplast precursor.>pir|T1...   134   1e-30   Mesembryanthemum crystallinum
pir|S69935|S69935 ferredoxin [2Fe-2S] II - tomato                     133   3e-30   Solanum lycopersicum
pir|A61291|A61291 ferredoxin [2Fe-2S] - parsley                       133   3e-30   Petroselinum crispum
sp|P81372|FERA_ALOMA|FERA_ALOMA Ferredoxin A (Fd A).>pir|S28198|S28198 ferr...   131   8e-30   Alocasia macrorrhizos [ape]
sp|P83584|FER_SOLLS|FER_SOLLS Ferredoxin.                                       130   1e-29   Solanum lasiocarpum [Indian nightshade]
sp|P83526|FER_TOBAC|FER_TOBAC Ferredoxin.                                       129   4e-29   Nicotiana tabacum [American tobacco]
sp|P00228|FER_WHEAT|FER_WHEAT Ferredoxin, chloroplast precursor.>pir|S5299...   129   5e-29   Triticum aestivum [Canadian hard winter wheat]
sp|P83582|FER_SOLNI|FER_SOLNI Ferredoxin.                                       127   1e-28   Solanum nigrum
sp|P83525|FER_SCOJA|FER_SCOJA Ferredoxin.                                       127   1e-28   Scopolia japonica
pir|A00233|FEED ferredoxin [2Fe-2S] - European elder (tentative ...   127   2e-28   
sp|P00226|FER_SAMNI|FER_SAMNI Ferredoxin.                                       127   2e-28   Sambucus nigra
sp|P83520|FER_DATAR|FER_DATAR Ferredoxin.                                       127   2e-28   Brugmansia arborea
sp|P83527|FER_CAPAA|FER_CAPAA Ferredoxin.                                       127   2e-28   Capsicum annuum var. annuum [chilli pepper]
sp|P83583|FER_SOLLY|FER_SOLLY Ferredoxin.                                       126   3e-28   Solanum lyratum
sp|P83521|FER_DATME|FER_DATME Ferredoxin.                                       126   3e-28   Datura metel
gb:AY072818_1567402 Oryza sativa anti-disease protein 1 (ADI1) m...   126   4e-28   
sp|P27789|FER5_MAIZE|FER5_MAIZE Ferredoxin V, chloroplast precursor (Fd V)....   126   4e-28   Zea mays [maize]
sp|P81454|FER_DATST|FER_DATST Ferredoxin.                                       125   5e-28   Datura stramonium [common thornapple]
sp|P81373|FERB_ALOMA|FERB_ALOMA Ferredoxin B (Fd B).>pir|S28199|S28199 ferr...   125   5e-28   Alocasia macrorrhizos [ape]
sp|P83523|FER_LYCCN|FER_LYCCN Ferredoxin.                                       125   8e-28   Lycium chinense [Chinese boxthorn]
sp|P83522|FER_HORVU|FER_HORVU Ferredoxin.                                       124   1e-27   Hordeum vulgare [barley]
sp|P11051|FER1_ORYSA|FER1_ORYSA Ferredoxin I, chloroplast precursor (Anti-d...   124   1e-27   Oryza sativa [red rice]
sp|P27787|FER1_MAIZE|FER1_MAIZE Ferredoxin I, chloroplast precursor (Fd I)....   124   1e-27   Zea mays [maize]
pir|A00229|FETA ferredoxin [2Fe-2S] - taro (tentative sequence)       123   2e-27   
sp|P00222|FER_COLES|FER_COLES Ferredoxin.                                       123   2e-27   Colocasia esculenta [cocoyam]
pir|A92055|FELG ferredoxin [2Fe-2S] - white popinac (tentative s...   122   4e-27   
sp|P00225|FER_LEUGL|FER_LEUGL Ferredoxin.                                       122   4e-27   Leucaena leucocephala [cassie]
pir|S76345|FEYB6 ferredoxin [2Fe-2S] [validated] - Synechocystis...   122   7e-27   
gb:BA000045_743698 Gloeobacter violaceus PCC 7421 DNA, complete ...   121   1e-26   
sp|P07839|FER_CHLRE|FER_CHLRE Ferredoxin, chloroplast precursor.>pir|T0805...   120   2e-26   Chlamydomonas reinhardtii
pir|JX0082|JX0082 ferredoxin [2Fe-2S] A, leaf - radish                120   3e-26   Raphanus sativus
pir|B00238|FEFWF ferredoxin [2Fe-2S] I - food pokeweed                120   3e-26   
sp|P27320|FER_SYNY3|FER_SYNY3 Ferredoxin I.                                     120   3e-26   Synechocystis sp.
sp|P83585|FER_SOLAB|FER_SOLAB Ferredoxin.                                       120   3e-26   Solanum abutiloides
sp|P00227|FER_BRANA|FER_BRANA Ferredoxin.>pir|A00234|FERP ferredoxin [2Fe-...   120   3e-26   Brassica napus [oilseed rape]
sp|P14938|FER3_RAPSA|FER3_RAPSA Ferredoxin, leaf L-A.                            120   3e-26   Raphanus sativus
sp|P00230|FER1_PHYES|FER1_PHYES Ferredoxin I.                                    120   3e-26   Phytolacca acinosa [food pokeberry]
sp|P00243|FER_SYNY4|FER_SYNY4 Ferredoxin.                                       119   3e-26   
sp|P00238|FER_SCEQU|FER_SCEQU Ferredoxin.>pir|A00242|FESC ferredoxin [2Fe-...   119   3e-26   Scenedesmus quadricauda
sp|P00229|FER1_PHYAM|FER1_PHYAM Ferredoxin I.>pir|A00236|FEFW1 ferredoxin [...   118   7e-26   Phytolacca americana [common pokeberry]
sp|P83524|FER_PHYAF|FER_PHYAF Ferredoxin.                                       118   1e-25   Physalis alkekengi var. franchetii [gua jin deng]
sp|P00223|FER_ARCLA|FER_ARCLA Ferredoxin.>pir|A00230|FEBQ ferredoxin [2Fe-...   117   2e-25   Arctium lappa
gb:AF233452_1779452 Impatiens balsamina ferredoxin mRNA, complet...   117   2e-25   
pir|T01170|T01170 ferredoxin [2Fe-2S] 2 - maize>gb:AB016810_1512...   116   3e-25   Zea mays [maize]
sp|P00220|FER_MEDSA|FER_MEDSA Ferredoxin.>pir|A00227|FEAA ferredoxin [2Fe-...   116   3e-25   Medicago sativa [alfalfa]
sp|P00244|FER1_APHFL|FER1_APHFL Ferredoxin I.>pir|A00248|FEFZ1 ferredoxin [...   115   5e-25   Aphanizomenon flos-aquae
gb:AY826851_1629157 Pavlova lutheri clone PLF2 chloroplast ferre...   115   6e-25   
gb:AY267628_1314451 Bigelowiella natans ferredoxin 1 mRNA, compl...   115   6e-25   
pir|C47673|C47673 ferredoxin [2Fe-2S] - Synechococcus sp. (PCC 7...   114   1e-24   Synechococcus sp.
sp|P00232|FER2_PHYES|FER2_PHYES Ferredoxin II.>pir|A00238|FEFW2E ferredoxin...   114   2e-24   Phytolacca acinosa [food pokeberry]
sp|P00224|FER2_SPIOL|FER2_SPIOL Ferredoxin II.>pir|A00231|FESP2 ferredoxin ...   112   4e-24   Spinacia oleracea
sp|P00231|FER2_PHYAM|FER2_PHYAM Ferredoxin II.>pir|A00237|FEFW2 ferredoxin ...   112   4e-24   Phytolacca americana [common pokeberry]
sp|P31965|FER1_SYNP2|FER1_SYNP2 Ferredoxin I.                                    112   4e-24   Synechococcus sp.
pir|S62722|S62722 ferredoxin [2Fe-2S] fd1 precursor, non-photosy...   112   5e-24   Citrus sinensis [apfelsine]
gb:AC092557_1735481 Oryza sativa chromosome 3 BAC OSJNBa0096I06 ...   112   7e-24   
sp|O04166|FER_PHYPA|FER_PHYPA Ferredoxin, chloroplast precursor.>gb:PPFERR...   112   7e-24   Physcomitrella patens
sp|P27788|FER3_MAIZE|FER3_MAIZE Ferredoxin III, chloroplast precursor (Fd I...   112   7e-24   Zea mays [maize]
gb:AY826852_1629158 Acetabularia acetabulum clone AAF1 chloropla...   111   9e-24   
gb:AY826847_1629153 Heterocapsa triquetra clone HTF1 chloroplast...   111   9e-24   
pir|G84673|G84673 probable ferredoxin [imported] - Arabidopsis t...   111   9e-24   Arabidopsis thaliana [mouse-ear cress]
gb:AY826850_1629156 Isochrysis galbana clone ISF2 chloroplast fe...   110   2e-23   
gb:AF030002_470714 Fischerella PCC7605 ferredoxin (petF) gene, c...   110   2e-23   
pir|S25233|S25233 ferredoxin [2Fe-2S] I [validated] - Anabaena s...   109   3e-23   Nostoc sp. PCC 7120
sp|P56408|FER_CHLFU|FER_CHLFU Ferredoxin.>pir|A68399|A68399 ferredoxin [2F...   109   3e-23   [Chlorella] fusca
gb:AF010320_1761149 Oryza sativa ferredoxin mRNA, complete cds.       109   4e-23   
gb:AF022186_1761922 Cyanidium caldarium strain RK1 chloroplast, ...   108   6e-23   
pir|S08122|S08122 ferredoxin [2Fe-2S] I - Synechococcus sp.>gb:S...   108   6e-23   Synechococcus sp.
sp|P00248|FER_MASLA|FER_MASLA Ferredoxin.>pir|A00252|FEMW ferredoxin [2Fe-...   108   6e-23   
gb:AY826848_1629154 Heterocapsa triquetra clone HTF2 chloroplast...   108   8e-23   
pir|S69167|S69167 ferredoxin [2Fe-2S] C - Japanese radish             108   8e-23   Raphanus sativus var. niger [daikon]
sp|P06543|FER1_ANASP|FER1_ANASP Ferredoxin I.                                    107   1e-22   Anabaena sp.
pir|A25761|FEAI ferredoxin [2Fe-2S] - Anabaena variabilis>gb:ANA...   107   2e-22   
sp|P00253|FER_NOSMU|FER_NOSMU Ferredoxin.>pir|A00257|FENM ferredoxin [2Fe-...   107   2e-22   Desmonostoc muscorum
sp|P09735|FER_MARPO|FER_MARPO Ferredoxin.>pir|A24126|FELV ferredoxin [2Fe-...   107   2e-22   Marchantia polymorpha
sp|P00250|FER_APHSA|FER_APHSA Ferredoxin I.>pir|A00254|FEAH ferredoxin [2F...   107   2e-22   Aphanothece sacrum
sp|P06517|FER1_SYNP7|FER1_SYNP7 Ferredoxin I.                                    107   2e-22   Synechococcus sp.
sp|P00252|FER1_NOSMU|FER1_NOSMU Ferredoxin I.>pir|A00256|FENM1M ferredoxin ...   107   2e-22   Desmonostoc muscorum
sp|Q9TLW0|FER1_CYACA|FER1_CYACA Ferredoxin.                                      107   2e-22   Cyanidium caldarium
gb:LES270962_1684522 Lycopersicon esculentum partial mRNA for pu...   106   3e-22   
sp|P14936|FER1_RAPSA|FER1_RAPSA Ferredoxin, root R-B1.>pir|JX0084|JX0084 fe...   106   3e-22   Raphanus sativus
pir|S11048|FEKT1 ferredoxin [2Fe-2S] I - Cyanophora paradoxa cya...   106   4e-22   
gb:AF041468_1763601 Guillardia theta complete plastid genome.         105   5e-22   
sp|P00245|FER_SPIMA|FER_SPIMA Ferredoxin.>pir|A00249|FESG ferredoxin [2Fe-...   105   5e-22   Arthrospira maxima
gb:OSJN00148_1695672 Oryza sativa genomic DNA, chromosome 4, BAC...   105   6e-22   
gb:BX572093_796978 Prochlorococcus marinus MED4 complete genome;...   105   6e-22   
gb:AE017165_395889 Prochlorococcus marinus subsp. marinus str. C...   105   6e-22   
sp|P00254|FER1_ANAVA|FER1_ANAVA Ferredoxin I.                                    105   6e-22   
gb:AP003287_1827314 Oryza sativa (japonica cultivar-group) genom...   104   1e-21   
sp|P22341|FER_EUGVI|FER_EUGVI Ferredoxin.>pir|S15425|S15425 ferredoxin [2F...   104   1e-21   Euglena viridis
gb:BX569690_775437 Synechococcus sp. WH8102 complete genome; seg...   104   1e-21   
sp|P00246|FER_SPIPL|FER_SPIPL Ferredoxin.>pir|A00250|FESGAL ferredoxin [2F...   104   1e-21   Arthrospira platensis
sp|P17007|FER1_CYAPA|FER1_CYAPA Ferredoxin I.                                    104   1e-21   Cyanophora paradoxa
sp|O78510|FER_GUITH|FER_GUITH Ferredoxin.                                       103   2e-21   Guillardia theta
sp|P00247|FER_CHLFR|FER_CHLFR Ferredoxin.>pir|A00251|FEEF ferredoxin [2Fe-...   103   2e-21   Chlorogloeopsis fritschii
pir|A00243|FEDH1 ferredoxin [2Fe-2S] I - green alga (Dunaliella ...   103   3e-21   
sp|P00241|FER3_CYACA|FER3_CYACA Ferredoxin.>pir|A00245|FEKK ferredoxin [2Fe...   103   3e-21   Cyanidium caldarium
sp|P00239|FER1_DUNSA|FER1_DUNSA Ferredoxin I.                                    103   3e-21   Dunaliella salina
pir|JA0098|JA0098 ferredoxin [2Fe-2S] - Synechococcus sp.             102   5e-21   Synechococcus sp.
sp|P00234|FER1_EQUTE|FER1_EQUTE Ferredoxin I.>pir|A00240|FEEQ1 ferredoxin [...   102   5e-21   Equisetum telmateia
pir|T03742|T03742 ferredoxin [2Fe-2S], root - rice>gb:RICFERRA_1...   102   7e-21   Oryza sativa Japonica Group [Japonica rice]
gb:BX572099_798771 Prochlorococcus marinus MIT9313 complete geno...   101   9e-21   
sp|Q51577|FER1_PLEBO|FER1_PLEBO Ferredoxin I (FdI).>gb:AB017194_3192 Plecto...   101   9e-21   Leptolyngbya boryana
sp|P00235|FER1_EQUAR|FER1_EQUAR Ferredoxin I.>pir|A04609|FEEQ1F ferredoxin ...   101   1e-20   Equisetum arvense [common horsetail]
gb:AY596491_1616756 Helicosporidium sp. ex Simulium jonesii plas...   100   2e-20   
gb:AF486634_1804177 Triticum aestivum ferredoxin precursor, mRNA...   100   2e-20   
gb:AF049491_1764042 Thalassiosira weissflogii cytochrome c-550 (...   100   3e-20   
pir|A00239|FEFNG ferredoxin [2Fe-2S] - fern (Gleichenia japonica...   100   3e-20   
sp|P00255|FER_SYNLI|FER_SYNLI Ferredoxin.>pir|A00258|FEYCAL ferredoxin [2F...   100   3e-20   Synechococcus lividus
sp|P10770|FER_PERBI|FER_PERBI Ferredoxin.>pir|A30036|FEDQ ferredoxin [2Fe-...   100   3e-20   Peridinium bipes
sp|P00233|FER_GLEJA|FER_GLEJA Ferredoxin.                                       100   3e-20   Gleichenia japonica [urajiro]
pir|A00244|FEDH2 ferredoxin [2Fe-2S] II - green alga (Dunaliella...   100   4e-20   
sp|P00240|FER2_DUNSA|FER2_DUNSA Ferredoxin II.                                   100   4e-20   Dunaliella salina
sp|P15789|FER2_CYACA|FER2_CYACA Ferredoxin.                                      100   4e-20   Cyanidium caldarium
sp|P00242|FER_PORUM|FER_PORUM Ferredoxin.>pir|A00246|FEPRU ferredoxin [2Fe...    99   6e-20   Porphyra umbilicalis
pir|JA0099|JA0099 ferredoxin [2Fe-2S] - Ochromonas danica              99   8e-20   Ochromonas danica
sp|O98450|FER_THAWE|FER_THAWE Ferredoxin.                                        98   1e-19   
sp|P14937|FER2_RAPSA|FER2_RAPSA Ferredoxin, root R-B2.>pir|JX0083|JX0083 fe...    98   1e-19   Raphanus sativus
pir|S73241|S73241 ferredoxin [2Fe-2S] petF - red alga (Porphyra ...    98   1e-19   Porphyra purpurea
gb:AF012533_468659 Cyanothece PCC8801 plant-type [2Fe-2S] ferred...    97   2e-19   
gb:AY058106_1564245 Arabidopsis thaliana At1g10960/T19D16_12 mRN...    96   5e-19   
gb:AY267629_1314452 Bigelowiella natans ferredoxin 2 mRNA, parti...    96   5e-19   
sp|P51320|FER_PORPU|FER_PORPU Ferredoxin.                                        96   5e-19   Porphyra purpurea
sp|P13106|FER_BUMFI|FER_BUMFI Ferredoxin.>pir|A28857|FEBF2 ferredoxin [2Fe...    96   7e-19   Bumilleriopsis filiformis
gb:AB002583_1508884 Cyanidioschyzon merolae chloroplast DNA, com...    95   9e-19   
gb:BX569692_776245 Synechococcus sp. WH8102 complete genome; seg...    95   1e-18   
gb:D85608_120679 Synechococcus vulcanus gene for ferredoxin I, c...    95   1e-18   
sp|P15788|FER_SYNP4|FER_SYNP4 Ferredoxin.>pir|A28858|A28858 ferredoxin [2F...    95   1e-18   Synechococcus sp.
sp|P07838|FER_BRYMA|FER_BRYMA Ferredoxin.>pir|S07452|FEYO ferredoxin [2Fe-...    94   1e-18   Bryopsis maxima
sp|P00236|FER2_EQUTE|FER2_EQUTE Ferredoxin II.>pir|A00241|FEEQ2 ferredoxin ...    94   1e-18   Equisetum telmateia
gb:AY673996_1621422 Gracilaria tenuistipitata var. liui chloropl...    94   2e-18   
gb:AB038037_1519161 Ipomoea nil mRNA for non-photosynthetic ferr...    94   3e-18   
sp|P00249|FER2_NOSMU|FER2_NOSMU Ferredoxin II.>pir|A00253|FENM2M ferredoxin...    94   3e-18   Desmonostoc muscorum
sp|P94044|FER6_MAIZE|FER6_MAIZE Ferredoxin VI, chloroplast precursor (Fd VI...    93   3e-18   Zea mays [maize]
pir|S78362|S78362 ferredoxin [2Fe-2S] petF - Odontella sinensis ...    93   4e-18   
sp|P00256|FER_SYNEL|FER_SYNEL Ferredoxin I.>pir|A00259|FEYCT ferredoxin [2...    93   4e-18   Synechococcus elongatus
sp|P00237|FER2_EQUAR|FER2_EQUAR Ferredoxin II.>pir|B04609|FEEQ2F ferredoxin...    93   4e-18   Equisetum arvense [common horsetail]
sp|P49522|FER_ODOSI|FER_ODOSI Ferredoxin.                                        91   2e-17   
gb:AB116656_14063 Aphanothece sacrum gene for ferredoxin I, part...    91   2e-17   
sp|P07484|FER_RHOPL|FER_RHOPL Ferredoxin.>pir|A93760|FEPRR ferredoxin [2Fe...    89   5e-17   
gb:RICRF_1703751 Oryza sativa mRNA for root ferredoxin, partial ...    86   5e-16   
gb:AB096367_1525577 Cryptomeria japonica Ferr gene for putative ...    86   5e-16   
gb:AB096366_1525576 Cryptomeria japonica Ferr gene for putative ...    86   5e-16   
gb:AB016893_1513267 Arabidopsis thaliana genomic DNA, chromosome...    86   5e-16   
pir|S04543|S04543 ferredoxin [2Fe-2S], heterocyst [validated] - ...    84   2e-15   Nostoc sp. PCC 7120
gb:AF167538_484961 Trichodesmium sp. IMS101 nif gene cluster, pa...    83   3e-15   
sp|P11053|FERH_ANASP|FERH_ANASP Ferredoxin, heterocyst.                           82   6e-15   Anabaena sp.
gb:PFMAL13_1191253 Plasmodium falciparum 3D7 chromosome 13, *** ...    81   1e-14   
pir|S20934|S20934 ferredoxin [2Fe-2S] - Calothrix sp. (PCC 7601)...    81   1e-14   Calothrix sp.
gb:AY826849_1629155 Isochrysis galbana clone ISF1 chloroplast fe...    81   2e-14   
gb:AB188668_1529365 Datura stramonium fed mRNA for ferredoxin, p...    81   2e-14   
gb:AB188674_1529371 Datura arborea fed mRNA for ferredoxin, part...    80   2e-14   
pir|S49989|S49989 ferredoxin [2Fe-2S] fdxH1 - Anabaena variabili...    80   3e-14   Trichormus variabilis ATCC 29413
gb:AB188671_1529368 Datura metel fed mRNA for ferredoxin, partia...    80   4e-14   
gb:AY639025_1178765 Arachis hypogaea auxin-induced putative ferr...    80   4e-14   
sp|P28610|FERH_FREDI|FERH_FREDI Ferredoxin, heterocyst.                           79   5e-14   Microchaete diplosiphon
gb:TGO489783_1400176 Toxoplasma gondii partial mRNA for ferredox...    79   8e-14   
gb:BA000039_727020 Thermosynechococcus elongatus BP-1 DNA, compl...    78   1e-13   
sp|P46046|FERH_ANAVA|FERH_ANAVA Ferredoxin, heterocyst.                           78   1e-13   
pir|C49890|C49890 ferredoxin [2Fe-2S] FdxH - Plectonema boryanum...    75   9e-13   Leptolyngbya boryana
sp|P00251|FER2_APHSA|FER2_APHSA Ferredoxin II.>pir|A00255|FEAH2 ferredoxin ...    74   3e-12   Aphanothece sacrum
sp|P46035|FER2_PLEBO|FER2_PLEBO Ferredoxin II (FdII).                             73   4e-12   Leptolyngbya boryana
pir|S49996|S49996 ferredoxin [2Fe-2S] fdxH2 - Anabaena variabili...    72   8e-12   Trichormus variabilis ATCC 29413
sp|P46047|FERV_ANAVA|FERV_ANAVA Ferredoxin, vegetative.                           70   3e-11   
gb:AY571331_1502106 Cyanophage P-SSM2 photosynthetic region.           70   4e-11   
pir|S10833|FEYC2 ferredoxin [2Fe-2S] II - Synechococcus sp. (str...    67   2e-10   
sp|P08451|FER2_SYNP6|FER2_SYNP6 Ferredoxin II.                                    65   7e-10   Synechococcus sp.
gb:AB116657_14064 Aphanothece sacrum gene for ferredoxin II, par...    65   1e-09   
pir|AF1904|AF1904 ferredoxin [imported] - Nostoc sp. (strain PCC...    64   2e-09   Nostoc sp. PCC 7120
gb:AF003700_467308 Cyanothece PCC 8801 NifK (nifK) gene, partial...    63   5e-09   
pir|S76421|S76421 ferredoxin [2Fe-2S] - Synechocystis sp. (strai...    63   5e-09   Synechocystis sp. PCC 6803
gb:AP008231_581224 Synechococcus elongatus PCC 6301 DNA, complet...    58   1e-07   
gb:BX572093_797075 Prochlorococcus marinus MED4 complete genome;...    57   3e-07   
gb:AP005178_1848869 Oryza sativa (japonica cultivar-group) genom...    55   8e-07   
gb:PSP579894_161467 Pseudomonas sp. Y2 paa2 gene cluster for phe...    54   2e-06   
gb:AF029714_470655 Pseudomonas putida transcriptional activator ...    54   3e-06   
gb:AE016786_332695 Pseudomonas putida KT2440 section 13 of 21 of...    54   3e-06   
gb:AY086239_1571294 Arabidopsis thaliana clone 22861 mRNA, compl...    53   5e-06   
pir|S75687|S75687 ferredoxin [2Fe-2S] II - Synechocystis sp. (st...    53   5e-06   Synechocystis sp. PCC 6803
pir|B71412|B71412 ferredoxin [2Fe-2S] - Arabidopsis thaliana>gb:...    52   7e-06   Arabidopsis thaliana [mouse-ear cress]
gb:BX572101_799536 Prochlorococcus marinus MIT9313 complete geno...    52   8e-06   
gb:AY596297_633485 Haloarcula marismortui ATCC 43049 chromosome ...    52   8e-06   
gb:AC087851_1734188 Oryza sativa chromosome 3 BAC OSJNBb0072E24 ...    52   1e-05   
gb:CR555306_107410 Azoarcus sp. EbN1 complete genome.                  52   1e-05   
gb:CP000031_84804 Silicibacter pomeroyi DSS-3, complete genome.        52   1e-05   
pir|A86451|A86451 probable ferredoxin, 13117-10969 [imported] - ...    51   1e-05   Arabidopsis thaliana [mouse-ear cress]
gb:PSSTYCATA_161557 Pseudomonas sp. Y2 DNA for styrene catabolis...    51   2e-05   
gb:ECPAA_132009 E.coli paa cluster for phenylacetic acid degrada...    51   2e-05   
gb:D90777_122421 E.coli genomic DNA, Kohara clone #266(31.1-31.5...    51   2e-05   
sp|P76081|PAAE_ECOLI|PAAE_ECOLI Probable phenylacetic acid degradation NADH...    51   2e-05   Escherichia coli [E. coli]
gb:AP006618_558560 Nocardia farcinica IFM 10152 DNA, complete ge...    50   2e-05   
pir|AH2170|AH2170 ferredoxin [imported] - Nostoc sp. (strain PCC...    50   3e-05   Nostoc sp. PCC 7120
pir|S09338|S09338 ferredoxin [2Fe-2S] II - garden pea (fragment)       49   6e-05   Pisum sativum [garden pea]
pir|S77325|S77325 ferredoxin [2Fe-2S] I - Synechocystis sp. (str...    49   6e-05   Synechocystis sp. PCC 6803
gb:AY542798_1188323 Zea mays chromosome 1 clone Z477F24 map 1L, ...    49   7e-05   
gb:BA000039_727440 Thermosynechococcus elongatus BP-1 DNA, compl...    48   1e-04   
gb:BA000039_726271 Thermosynechococcus elongatus BP-1 DNA, compl...    48   1e-04   
gb:AF350436_503943 Sinorhizobium meliloti putative phenylacetic ...    48   1e-04   
pir|C96036|C96036 probable ferredoxin reductase electron transfe...    48   1e-04   Sinorhizobium meliloti
gb:AF176259_485678 Azoarcus evansii regulator protein gene, part...    48   2e-04   
gb:AEV278756_466919 Azoarcus evansii pac gene cluster for aerobi...    48   2e-04   
gb:SCO939131_181141 Streptomyces coelicolor A3(2) complete genom...    47   2e-04   
gb:AF195208_1775827 Pyrus pyrifolia strain Whangkeumbae ferredox...    47   3e-04   
gb:BX640428_809930 Bordetella parapertussis strain 12822, comple...    47   3e-04   
gb:BX571966_793800 Burkholderia pseudomallei strain K96243, chro...    47   3e-04   
gb:CP000031_86396 Silicibacter pomeroyi DSS-3, complete genome.        47   4e-04   
gb:AL646079_548978 Ralstonia solanacearum GMI1000 megaplasmid, c...    46   5e-04   
gb:BX569690_775399 Synechococcus sp. WH8102 complete genome; seg...    46   6e-04   
gb:CP000011_867865 Burkholderia mallei ATCC 23344 chromosome 2, ...    45   8e-04   
gb:BA000045_743257 Gloeobacter violaceus PCC 7421 DNA, complete ...    45   8e-04   
gb:AL646076_548433 Ralstonia solanacearum GMI1000 megaplasmid, c...    45   0.001   
gb:AE000516_23789 Mycobacterium tuberculosis CDC1551, complete g...    45   0.001   
pir|D84405|D84405 hypothetical protein Vng2555c [imported] - Hal...    45   0.001   Halobacterium salinarum
pir|C70678|C70678 probable electron transfer protein - Mycobacte...    45   0.001   Mycobacterium tuberculosis
gb:PLU457087_158730 Photorhabdus luminescens subsp. laumondii pa...    44   0.002   
gb:BX572092_796524 Prochlorococcus marinus MED4 complete genome;...    44   0.002   
gb:BA000040_731155 Bradyrhizobium japonicum USDA 110 DNA, comple...    43   0.004   
gb:AE017164_395449 Prochlorococcus marinus subsp. marinus str. C...    43   0.004   
gb:AF517867_1807669 Griffithsia japonica isolate Gj501 ferredoxi...    42   0.007   
gb:ECU17224_133246 Erwinia carotovora CarR (carR), CarA (carA), ...    42   0.007   
gb:AC135600_1742738 Oryza sativa chromosome 3 BAC OSJNBb0047K21 ...    42   0.009   
gb:BX572605_803377 Rhodopseudomonas palustris CGA009 complete ge...    42   0.011   
gb:AB193033_17437 Corynebacterium glutamicum DNA, strain specifi...    40   0.026   
gb:CR555306_108657 Azoarcus sp. EbN1 complete genome.                  40   0.033   
gb:BA000035_715456 Corynebacterium efficiens YS-314 DNA, complet...    40   0.044   
gb:BX640446_815856 Bordetella bronchiseptica strain RB50, comple...    39   0.057   
gb:BX640428_810152 Bordetella parapertussis strain 12822, comple...    39   0.057   
gb:BX640416_806231 Bordetella pertussis strain Tohama I, complet...    39   0.057   
gb:CP000010_866729 Burkholderia mallei ATCC 23344 chromosome 1, ...    39   0.097   
gb:BX571965_793033 Burkholderia pseudomallei strain K96243, chro...    39   0.097   
gb:BX569692_776176 Synechococcus sp. WH8102 complete genome; seg...    38   0.13    
gb:BA000012_669895 Mesorhizobium loti MAFF303099 DNA, complete g...    38   0.13    
gb:AF461768_513555 Yersinia pseudotuberculosis serogroup IA O-an...    37   0.28    
gb:YPS251712_211823 Yersinia pseudotuberculosis serotype O:1b he...    37   0.28    
pir|A36952|A36952 CDP-6-deoxy-Delta(3,4)-glucoseen reductase (EC...    37   0.28    Yersinia pseudotuberculosis
sp|P37911|ASCD_YERPE|ASCD_YERPE CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3-...    37   0.28    Yersinia pestis
gb:SME591785_184889 Sinorhizobium meliloti 1021 complete chromos...    37   0.37    
gb:AE017238_413843 Mycobacterium avium subsp. paratuberculosis s...    36   0.48    
gb:PSEPHEAA_160857 Pseudomonas putida phenol hydroxylase gene cl...    36   0.48    
pir|F37831|F37831 phenol 2-monooxygenase (EC 1.14.13.7) chain P5...    36   0.48    Pseudomonas sp.
sp|P19734|DMPP_PSESP|DMPP_PSESP Phenol hydroxylase P5 protein (EC 1.14.13.7...    36   0.48    Pseudomonas sp.
gb:AY686639_640302 Pseudomonas putida strain KL33 phenol hydroxy...    36   0.63    
gb:AY297781_606913 Alcaligenes faecalis strain NCIB 8687 arsenit...    36   0.63    
gb:PPPHEHYD_159388 P.putida genes for phenolhydroxylase.               36   0.63    
gb:AP006618_558624 Nocardia farcinica IFM 10152 DNA, complete ge...    35   0.82    
gb:AJ628766_528103 Streptomyces peucetius fdx808 gene for ferred...    35   0.82    
gb:AE014291_308886 Brucella suis 1330 chromosome I, complete seq...    35   0.82    
pir|AF3320|AF3320 flavohemoprotein [imported] - Brucella meliten...    35   0.82    Brucella melitensis
pir|JT0017|JT0017 ferredoxin [2Fe-2S] - red alga (Porphyridium c...    35   0.82    Porphyridium purpureum
sp|P18821|FER_PORCR|FER_PORCR Ferredoxin (Fragment).                             35   0.82    Porphyridium purpureum
gb:AY246697_1592580 Alternaria brassicae nonribosomal peptide sy...    35   1.1     
gb:AB076368_10081 Comamonas testosteroni tesH, tesI, ORF17, ORF1...    35   1.1     
gb:AP005592_1854637 Oryza sativa (japonica cultivar-group) genom...    35   1.4     
gb:AC104285_1737523 Oryza sativa (japonica cultivar-group) chrom...    35   1.4     
gb:AE017345_1756803 Cryptococcus neoformans var. neoformans JEC2...    34   1.8     
gb:BA000030_702237 Streptomyces avermitilis MA-4680 genomic DNA,...    34   1.8     
pir|G82970|G82970 probable ferredoxin PA5411 [imported] - Pseudo...    34   1.8     Pseudomonas aeruginosa
gb:AP004611_1842081 Oryza sativa (japonica cultivar-group) genom...    34   2.4     
gb:AB019228_1514090 Arabidopsis thaliana genomic DNA, chromosome...    34   2.4     
gb:AP006618_560497 Nocardia farcinica IFM 10152 DNA, complete ge...    34   2.4     
pir|H97447|H97447 probable ferredoxin (PA5411) [imported] - Agro...    34   2.4     Agrobacterium tumefaciens
gb:BA000036_720133 Corynebacterium glutamicum ATCC 13032 DNA, co...    33   3.1     
gb:BA000035_717090 Corynebacterium efficiens YS-314 DNA, complet...    33   3.1     
gb:AY596297_633481 Haloarcula marismortui ATCC 43049 chromosome ...    33   3.1     
gb:AF214778_488980 Micrococcus lylae RecA protein (recA) gene, p...    33   3.1     
gb:AE016857_349858 Pseudomonas syringae pv. tomato str. DC3000 s...    33   3.1     
pir|B89716|B89716 protein F45B8.3 [imported] - Caenorhabditis el...    33   3.1     Caenorhabditis elegans [roundworm]
pir|T22216|T22216 hypothetical protein F45B8.3 - Caenorhabditis ...    33   3.1     Caenorhabditis elegans [roundworm]
pir|G87673|G87673 hypothetical protein CC3425 [imported] - Caulo...    33   3.1     
sp|P07771|BENC_ACICA|BENC_ACICA Benzoate 1,2-dioxygenase electron transfer ...    33   3.1     
gb:BC055104_2101942 Mus musculus mitochondrial capsule selenopro...    33   4.1     
gb:PSP296087_161299 Pseudonocardia sp. K1 ORF y, thmS gene, thma...    33   4.1     
pir|T10081|T10081 sperm mitochondrial capsule selenoprotein - mouse    33   4.1     
sp|P15265|MCS_MOUSE|MCS_MOUSE Sperm mitochondrial associated cysteine-rich...    33   4.1     
gb:AF360864_504834 Marinosulfonomonas methylotropha strain TR3 h...    33   5.3     
gb:AB102786_13000 Cycloclasticus sp. A5 orf1, phnA1b, phnA1, phn...    33   5.3     
gb:AB008831_1349 Acinetobacter sp. YAA genes for aniline dioxyge...    33   5.3     
gb:AP003798_1833502 Oryza sativa (japonica cultivar-group) genom...    32   7.0     
gb:CP000021_873015 Vibrio fischeri ES114 chromosome II, complete...    32   7.0     
gb:BA000032_708951 Vibrio parahaemolyticus RIMD 2210633 DNA, chr...    32   7.0     
pir|T21468|T21468 hypothetical protein F28C1.2 - Caenorhabditis ...    32   7.0     
pir|G58972|S44308 phenol 2-monooxygenase (EC 1.14.13.7) reductas...    32   7.0     
sp|P49809|EG10_CAEEL|EG10_CAEEL Regulator of G-protein signaling egl-10 (Eg...    32   7.0     
gb:AP006618_561469 Nocardia farcinica IFM 10152 DNA, complete ge...    32   9.1     
gb:AF182166_486260 Acinetobacter radioresistens muconate cyclois...    32   9.1     
gb:PEENIRNRT_157787 Plectonema boryanum genes for nitrite reduct...    32   9.1     
gb:D90724_121640 Escherichia coli K12 genomic DNA. (19.4 - 19.8 ...    32   9.1     
gb:AE005674_70409 Shigella flexneri 2a str. 301, complete genome...    32   9.1     
pir|S49915|S49915 extensin-like protein - maize>gb:ZMEXTENS_1731...    32   9.1     
pir|B85599|B85599 probable enzyme Z1106 [imported] - Escherichia...    32   9.1     
sp|P75824|HCR_ECOLI|HCR_ECOLI NADH oxidoreductase hcr (EC 1.-.-.-).>pir|H6...    32   9.1     


>gb:STU307031_1723041 Solanum tuberosum mRNA for ferredoxin I (fed1
           gene).
          Length = 144

 Score =  170 bits (431), Expect = 2e-41
 Identities = 89/142 (62%), Positives = 102/142 (71%)
 Frame = +3

Query: 45  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP 224
           MA++S G+M+STSFL  KP     SL+AISN   A  GLKSG  GR+TCMASYKVKL+TP
Sbjct: 1   MASIS-GTMISTSFLPRKPVVT--SLKAISNVGEALFGLKSGRNGRITCMASYKVKLITP 57

Query: 225 TGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMD 404
            G  EF+CPDDVY+LDQAEE G DLPY            KV +GTVDQSD  FLDD+Q  
Sbjct: 58  DGPIEFECPDDVYILDQAEEEGHDLPYSCRAGSCSSCAGKVTAGTVDQSDGKFLDDDQEA 117

Query: 405 AGYVLTCVAYPTSNVVIETHKE 470
           AG+VLTCVAYP  +V IETHKE
Sbjct: 118 AGFVLTCVAYPKCDVTIETHKE 139



>sp|Q43517|FER1_LYCES Ferredoxin I, chloroplast
           precursor.>pir|T07175|T07175 ferredoxin [2Fe-2S] I
           precursor, chloroplast - tomato>gb:LESEND33_1684636
           L.esculentum mRNA for ferredoxin-I.
          Length = 144

 Score =  169 bits (429), Expect = 3e-41
 Identities = 88/142 (61%), Positives = 104/142 (73%)
 Frame = +3

Query: 45  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP 224
           MA++S G+M+STSFL  KPA    SL+AISN   A  GLKSG  GR+TCMASYKVKL+TP
Sbjct: 1   MASIS-GTMISTSFLPRKPAVT--SLKAISNVGEALFGLKSGRNGRITCMASYKVKLITP 57

Query: 225 TGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMD 404
            G  EF+CPDDVY+LDQAEE G DLPY            KV +G+VDQSD +FLD++Q  
Sbjct: 58  EGPIEFECPDDVYILDQAEEEGHDLPYSCRAGSCSSCAGKVTAGSVDQSDGNFLDEDQEA 117

Query: 405 AGYVLTCVAYPTSNVVIETHKE 470
           AG+VLTCVAYP  +V IETHKE
Sbjct: 118 AGFVLTCVAYPKGDVTIETHKE 139



>gb:AY864890_1631114 Nicotiana tabacum chloroplast ferredoxin I
           (fdn-1) mRNA, complete cds; nuclear gene for chloroplast
           product.
          Length = 144

 Score =  166 bits (419), Expect = 4e-40
 Identities = 87/142 (61%), Positives = 100/142 (70%)
 Frame = +3

Query: 45  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP 224
           MA++S G+M+STSFL  KP     SL+AI N   A  GLKS   GR+TCMASYKVKL+TP
Sbjct: 1   MASIS-GTMVSTSFLPRKPVVT--SLKAIPNVGQALFGLKSERGGRITCMASYKVKLITP 57

Query: 225 TGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMD 404
            G  EFDCPDDVY+LDQAEE G +LPY            KV  G VDQSD +FLDD+QM 
Sbjct: 58  EGTVEFDCPDDVYILDQAEEEGHELPYSCRAGSCSSCAGKVTGGNVDQSDGNFLDDDQMA 117

Query: 405 AGYVLTCVAYPTSNVVIETHKE 470
            G+VLTCVAYP S+V IETHKE
Sbjct: 118 GGFVLTCVAYPQSDVTIETHKE 139



>gb:AY552781_1613403 Nicotiana tabacum chloroplast ferredoxin I
           (fdn-1) gene, complete cds; nuclear gene for chloroplast
           product.
          Length = 144

 Score =  165 bits (417), Expect = 7e-40
 Identities = 87/142 (61%), Positives = 100/142 (70%)
 Frame = +3

Query: 45  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP 224
           MA++S G+M+STSFL  KP     SL+AI N   A  GLKS   GR+TCMASYKVKL+TP
Sbjct: 1   MASIS-GTMVSTSFLPRKPVVT--SLKAIPNVGQALFGLKSERGGRITCMASYKVKLITP 57

Query: 225 TGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMD 404
            G  EFDCPDDVY+LDQAEE G +LPY            KV  G VDQSD +FLDD+QM 
Sbjct: 58  EGTVEFDCPDDVYILDQAEEEGHELPYSCRAGSCSSCAGKVTGGNVDQSDGNFLDDDQMA 117

Query: 405 AGYVLTCVAYPTSNVVIETHKE 470
            G+VLTCVAYP S+V IETHKE
Sbjct: 118 DGFVLTCVAYPQSDVTIETHKE 139



>sp|Q9ZTS2|FER_CAPAN Ferredoxin, chloroplast precursor
           (PFLP).>gb:AF039662_1763379 Capsicum annuum
           ferredoxin-like protein (ap1) mRNA, complete cds.
          Length = 144

 Score =  164 bits (415), Expect = 1e-39
 Identities = 83/142 (58%), Positives = 102/142 (71%)
 Frame = +3

Query: 45  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP 224
           MA++SA +M+STSF+  KPA    SL+ I N   A  GLKS N G++TCMASYKVKL+TP
Sbjct: 1   MASVSA-TMISTSFMPRKPAVT--SLKPIPNVGEALFGLKSANGGKVTCMASYKVKLITP 57

Query: 225 TGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMD 404
            G  EFDCPD+VY+LDQAEE G DLPY            K+  G VDQ+D +FLDD+Q++
Sbjct: 58  DGPIEFDCPDNVYILDQAEEAGHDLPYSCRAGSCSSCAGKIAGGAVDQTDGNFLDDDQLE 117

Query: 405 AGYVLTCVAYPTSNVVIETHKE 470
            G+VLTCVAYP S+V IETHKE
Sbjct: 118 EGWVLTCVAYPQSDVTIETHKE 139



>gb:AY189833_1588433 Helianthus annuus ferredoxin (FER1) mRNA,
           complete cds.
          Length = 142

 Score =  149 bits (377), Expect = 3e-35
 Identities = 77/141 (54%), Positives = 95/141 (67%), Gaps = 1/141 (0%)
 Frame = +3

Query: 51  TLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNMGRMTCMASYKVKLVTPT 227
           T   G+M STSFL  +P          ++ +P+ + GLKS N G +T MA+YKV L+TP 
Sbjct: 6   TTLTGTMASTSFLRPQPT---------TSMKPSVMFGLKSSNRGGVTMMATYKVTLITPE 56

Query: 228 GDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDA 407
           G  EFDC DD Y+LD  E+ G DLPY            KV+SGTVDQSD SFLDD+Q++A
Sbjct: 57  GKTEFDCADDTYILDHCEDAGIDLPYSCRAGSCSSCTGKVISGTVDQSDQSFLDDDQIEA 116

Query: 408 GYVLTCVAYPTSNVVIETHKE 470
           G+VLTCVAYPTS+VVIETHKE
Sbjct: 117 GWVLTCVAYPTSDVVIETHKE 137



>sp|P09911|FER1_PEA Ferredoxin I, chloroplast
           precursor.>pir|S11495|FEPM1 ferredoxin [2Fe-2S] I
           precursor - garden pea>gb:PEAFED1X_1699678 Pea
           ferredoxin I (Fed-1)gene, complete cds.
          Length = 149

 Score =  146 bits (368), Expect = 3e-34
 Identities = 83/146 (56%), Positives = 98/146 (67%), Gaps = 4/146 (2%)
 Frame = +3

Query: 45  MATLSA--GSMMSTSFLSGKPAAAG-GSLRAISN-FRPAQLGLKSGNMGRMTCMASYKVK 212
           MAT  A  G+ +STSFL  +P      + +A SN F   +  LK G++     MASYKVK
Sbjct: 1   MATTPALYGTAVSTSFLRTQPMPMSVTTTKAFSNGFLGLKTSLKRGDLA--VAMASYKVK 58

Query: 213 LVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDD 392
           LVTP G  EF+CP DVY+LD AEE+G DLPY            KVV G VDQSD SFLDD
Sbjct: 59  LVTPDGTQEFECPSDVYILDHAEEVGIDLPYSCRAGSCSSCAGKVVGGEVDQSDGSFLDD 118

Query: 393 EQMDAGYVLTCVAYPTSNVVIETHKE 470
           EQ++AG+VLTCVAYPTS+VVIETHKE
Sbjct: 119 EQIEAGFVLTCVAYPTSDVVIETHKE 144



>sp|P16972|FER_ARATH Ferredoxin, chloroplast
           precursor.>pir|S09979|S09979 ferredoxin [2Fe-2S]
           precursor, chloroplast - Arabidopsis
           thaliana>gb:AE005173_893767 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC018908_1538444 Arabidopsis thaliana
           chromosome 1 BAC T7P1 genomic sequence, complete
           sequence.>gb:ATHFEDAA_1553181 A.thalania ferrodoxin
           mRNA, complete cds.>gb:ATPREFD_1553884 A.thaliana gene
           for pre-ferredoxin.>gb:AY093034_1574988 Arabidopsis
           thaliana ferrodoxin precursor (At1g60950) mRNA, complete
           cds.>gb:AY128936_1581016 Arabidopsis thaliana ferrodoxin
           precursor (At1g60950) mRNA, complete
           cds.>gb:AF324706_1786418 Arabidopsis thaliana At1g60950
           (At1g60950/T7P1_9) mRNA, complete
           cds.>gb:AF326885_1786745 Arabidopsis thaliana putative
           ferrodoxin precursor protein (At1g60950) mRNA, complete
           cds.>gb:AF339705_1787749 Arabidopsis thaliana putative
           ferrodoxin precursor protein (At1g60950) mRNA, complete
           cds.
          Length = 148

 Score =  144 bits (364), Expect = 1e-33
 Identities = 78/144 (54%), Positives = 96/144 (66%), Gaps = 3/144 (2%)
 Frame = +3

Query: 48  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLV 218
           +T  + +++ TSF+   PA    SLR++ +     L GLKSG    GR+T MA+YKVK +
Sbjct: 3   STALSSAIVGTSFIRRSPAPI--SLRSLPSANTQSLFGLKSGTARGGRVTAMATYKVKFI 60

Query: 219 TPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQ 398
           TP G+ E +C DDVYVLD AEE G DLPY            KVVSG+VDQSD SFLDDEQ
Sbjct: 61  TPEGELEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSFLDDEQ 120

Query: 399 MDAGYVLTCVAYPTSNVVIETHKE 470
           +  G+VLTC AYPTS+V IETHKE
Sbjct: 121 IGEGFVLTCAAYPTSDVTIETHKE 144



>sp|O04090|FER2_ARATH Ferredoxin 2, chloroplast
           precursor.>pir|E86243|E86243 ferredoxin precursor
           homolog, 63541-63095 [imported] - Arabidopsis
           thaliana>gb:AE005172_890108 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AY086012_1571073 Arabidopsis thaliana clone
           20637 mRNA, complete sequence.>gb:U95973_1726592
           Arabidopsis thaliana chromosome 1 BAC T19D16 genomic
           sequence, complete sequence.
          Length = 148

 Score =  142 bits (358), Expect = 5e-33
 Identities = 79/144 (54%), Positives = 96/144 (66%), Gaps = 3/144 (2%)
 Frame = +3

Query: 48  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLV 218
           +T  + +++STSFL  +      SLR++       L GLKS     GR+T MA+YKVK +
Sbjct: 3   STALSSAIVSTSFLRRQQTPI--SLRSLPFANTQSLFGLKSSTARGGRVTAMATYKVKFI 60

Query: 219 TPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQ 398
           TP G+ E +C +DVYVLD AEE G DLPY            KVVSG++DQSD SFLDDEQ
Sbjct: 61  TPEGEQEVECEEDVYVLDAAEEAGLDLPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDDEQ 120

Query: 399 MDAGYVLTCVAYPTSNVVIETHKE 470
           M  GYVLTCVAYPTS+VVIETHKE
Sbjct: 121 MSEGYVLTCVAYPTSDVVIETHKE 144



>gb:AY340639_1600674 Trifolium pratense ferredoxin I mRNA, complete
           cds; nuclear gene for chloroplast product.
          Length = 152

 Score =  141 bits (355), Expect = 1e-32
 Identities = 75/147 (51%), Positives = 95/147 (64%), Gaps = 5/147 (3%)
 Frame = +3

Query: 45  MATLSA--GSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGR---MTCMASYKV 209
           MAT  A  G+ +STSF+  +P     +    +   P+  GLKS +  R      MA+YKV
Sbjct: 1   MATTPALYGTAVSTSFMRRQPVPMSVATTTTTKAFPSGFGLKSVSTKRGDLAVAMATYKV 60

Query: 210 KLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLD 389
           KL+TP G  EFDCPDDVY+LD AEE+G +LPY            KVV+G V+Q D SFLD
Sbjct: 61  KLITPEGPQEFDCPDDVYILDHAEEVGIELPYSCRAGSCSSCAGKVVNGNVNQEDGSFLD 120

Query: 390 DEQMDAGYVLTCVAYPTSNVVIETHKE 470
           DEQ++ G+VLTCVA+PTS+V IETHKE
Sbjct: 121 DEQIEGGWVLTCVAFPTSDVTIETHKE 147



>sp|P04669|FER_SILPR Ferredoxin, chloroplast
           precursor.>pir|A23011|FEQH ferredoxin [2Fe-2S] precursor
           - white campion>gb:SPFER1_1721796 Silene pratensis mRNA
           for ferredoxin precursor.
          Length = 146

 Score =  139 bits (351), Expect = 3e-32
 Identities = 75/143 (52%), Positives = 95/143 (66%), Gaps = 1/143 (0%)
 Frame = +3

Query: 45  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTP 224
           MA+  +   +S S L  +      SL   +N   A  GLK+G+ GR+T MA+YKV L+T 
Sbjct: 1   MASTLSTLSVSASLLPKQQPMVASSLP--TNMGQALFGLKAGSRGRVTAMATYKVTLITK 58

Query: 225 -TGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQM 401
            +G   FDCPDDVYVLDQAEE G DLPY            KVV+G+VDQSD SFLDD+Q+
Sbjct: 59  ESGTVTFDCPDDVYVLDQAEEEGIDLPYSCRAGSCSSCAGKVVAGSVDQSDQSFLDDDQI 118

Query: 402 DAGYVLTCVAYPTSNVVIETHKE 470
           +AG+VLTC AYP+++V IETHKE
Sbjct: 119 EAGWVLTCAAYPSADVTIETHKE 141



>sp|P00221|FER1_SPIOL Ferredoxin I, chloroplast precursor (Fd
           I).>pir|S00437|FESP1 ferredoxin [2Fe-2S] I precursor -
           spinach>gb:AX168069_1462952 Sequence 24 from Patent
           WO0144447.>gb:SPIFERRI_1721861 Spinach ferredoxin I
           mRNA, complete cds.
          Length = 147

 Score =  134 bits (338), Expect = 1e-30
 Identities = 71/141 (50%), Positives = 90/141 (63%)
 Frame = +3

Query: 48  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPT 227
           AT +    M+T+F+  KP A        SN   +  GLK+G+ G    MA+YKV LVTPT
Sbjct: 3   ATTTTMMGMATTFVP-KPQAPPMMAALPSNTGRSLFGLKTGSRGGRMTMAAYKVTLVTPT 61

Query: 228 GDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDA 407
           G+ EF CPDDVY+LD AEE G DLPY            K+ +G+++Q D SFLDD+Q+D 
Sbjct: 62  GNVEFQCPDDVYILDAAEEEGIDLPYSCRAGSCSSCAGKLKTGSLNQDDQSFLDDDQIDE 121

Query: 408 GYVLTCVAYPTSNVVIETHKE 470
           G+VLTC AYP S+V IETHKE
Sbjct: 122 GWVLTCAAYPVSDVTIETHKE 142



>sp|O04683|FER1_MESCR Ferredoxin I, chloroplast
           precursor.>pir|T12417|T12417 ferredoxin [2Fe-2S] I
           precursor - common ice plant>gb:AF003125_1760644
           Mesembryanthemum crystallinum ferredoxin I precursor
           mRNA, complete cds.
          Length = 148

 Score =  134 bits (337), Expect = 1e-30
 Identities = 72/138 (52%), Positives = 87/138 (63%), Gaps = 1/138 (0%)
 Frame = +3

Query: 60  AGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSG-NMGRMTCMASYKVKLVTPTGDF 236
           +G+ MST+F    P          +N   A  GLKS  + GR+T MA+YKV LVTP G  
Sbjct: 9   SGATMSTAFAPKTPPMTAA---LPTNVGRALFGLKSSASRGRVTAMAAYKVTLVTPEGKQ 65

Query: 237 EFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYV 416
           E +CPDDVY+LD AEE G DLPY            KV SG+V+Q D SFLDD+Q+  G+V
Sbjct: 66  ELECPDDVYILDAAEEAGIDLPYSCRAGSCSSCAGKVTSGSVNQDDGSFLDDDQIKEGWV 125

Query: 417 LTCVAYPTSNVVIETHKE 470
           LTCVAYPT +V IETHKE
Sbjct: 126 LTCVAYPTGDVTIETHKE 143



>pir|S69935|S69935 ferredoxin [2Fe-2S] II - tomato
          Length = 97

 Score =  133 bits (334), Expect = 3e-30
 Identities = 62/92 (67%), Positives = 71/92 (77%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKVKL+TP G FEFDCPDDV +LD+AEE G DLPY            KV +G+VDQSD
Sbjct: 1   ATYKVKLITPEGPFEFDCPDDVSILDRAEETGLDLPYSCRAGACSSCAGKVTAGSVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           NSFLDD+Q+D G+VLTCVAYP SNV IETHKE
Sbjct: 61  NSFLDDDQIDEGFVLTCVAYPKSNVTIETHKE 92



>pir|A61291|A61291 ferredoxin [2Fe-2S] - parsley
          Length = 96

 Score =  133 bits (334), Expect = 3e-30
 Identities = 64/92 (69%), Positives = 71/92 (77%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+Y VKL+TP G+ EF C DDVYVLDQAEE G D+PY            KVVSG++DQSD
Sbjct: 1   ATYNVKLITPDGEVEFKCDDDVYVLDQAEEEGIDIPYSCRAGSCSSCAGKVVSGSIDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDDEQMDAGYVLTC AYPTS+VVIETHKE
Sbjct: 61  QSFLDDEQMDAGYVLTCHAYPTSDVVIETHKE 92



>sp|P81372|FERA_ALOMA Ferredoxin A (Fd A).>pir|S28198|S28198
           ferredoxin [2Fe-2S] A - giant taro
          Length = 97

 Score =  131 bits (330), Expect = 8e-30
 Identities = 64/92 (69%), Positives = 70/92 (76%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKVKLVTP G  EFDCPDDVY+LDQAEE G DLPY            KV  G VDQSD
Sbjct: 1   ATYKVKLVTPQGQQEFDCPDDVYILDQAEEEGIDLPYSCRAGSCSSCAGKVKQGEVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDDEQM+ G+VLTCVA+PTS+VVIETHKE
Sbjct: 61  GSFLDDEQMEQGWVLTCVAFPTSDVVIETHKE 92



>sp|P83584|FER_SOLLS Ferredoxin.
          Length = 97

 Score =  130 bits (328), Expect = 1e-29
 Identities = 61/92 (66%), Positives = 70/92 (76%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           ASYKVKL+TP G  EF+CPDDVY+LD+AEE G DLPY            K+V G+VDQSD
Sbjct: 1   ASYKVKLITPDGPIEFNCPDDVYILDRAEEEGHDLPYSCRAGACSSCAGKIVDGSVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           NSFLDD+Q+  G+VLTCVAYP SNV IETHKE
Sbjct: 61  NSFLDDDQIGGGFVLTCVAYPKSNVTIETHKE 92



>sp|P83526|FER_TOBAC Ferredoxin.
          Length = 97

 Score =  129 bits (324), Expect = 4e-29
 Identities = 61/92 (66%), Positives = 69/92 (75%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           ASYKVKL+TP G  EFDCPDDVY+LDQAEE+G DLPY            KV +G VDQSD
Sbjct: 1   ASYKVKLITPEGAVEFDCPDDVYILDQAEEMGHDLPYSCRAGSCSSCAGKVTAGNVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            +FLDD+QM  G+VLTCVAYP S+V IETHKE
Sbjct: 61  GNFLDDDQMADGFVLTCVAYPQSDVTIETHKE 92



>sp|P00228|FER_WHEAT Ferredoxin, chloroplast
           precursor.>pir|S52993|FEWT ferredoxin [2Fe-2S] precursor
           - wheat>gb:TAPETFFE_1724604 Triticum aestivum petF gene
           for ferredoxin.
          Length = 143

 Score =  129 bits (323), Expect = 5e-29
 Identities = 68/127 (53%), Positives = 83/127 (65%), Gaps = 9/127 (7%)
 Frame = +3

Query: 117 SLRAISN------FRPAQLGLKSGNM---GRMTCMASYKVKLVTPTGDFEFDCPDDVYVL 269
           SLRA++         PA L L +       R+   A+YKVKLVTP G+ E + PDDVY+L
Sbjct: 12  SLRAVAPPAPRVALAPAALSLAAAKQVRGARLRAQATYKVKLVTPEGEVELEVPDDVYIL 71

Query: 270 DQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNV 449
           DQAEE G DLPY            K+VSG +DQSD SFLDD+QM+AG+VLTC AYP S++
Sbjct: 72  DQAEEEGIDLPYSCRAGSCSSCAGKLVSGEIDQSDQSFLDDDQMEAGWVLTCHAYPKSDI 131

Query: 450 VIETHKE 470
           VIETHKE
Sbjct: 132 VIETHKE 138



>sp|P83582|FER_SOLNI Ferredoxin.
          Length = 97

 Score =  127 bits (320), Expect = 1e-28
 Identities = 61/92 (66%), Positives = 69/92 (75%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKVKLVTP G  EFDCPDDVY+LDQAEE G +LPY            KV +GTVDQSD
Sbjct: 1   ATYKVKLVTPDGPIEFDCPDDVYILDQAEEEGHELPYSCRAGSCSSCAGKVTAGTVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            +FLDD+QM  G+VLTCVAYP S+V IETHKE
Sbjct: 61  GNFLDDDQMADGFVLTCVAYPKSDVTIETHKE 92



>sp|P83525|FER_SCOJA Ferredoxin.
          Length = 97

 Score =  127 bits (320), Expect = 1e-28
 Identities = 61/92 (66%), Positives = 70/92 (76%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKVKLVTP G  EFDCPDDVY+LDQAEE G +LPY            KV +GTVDQSD
Sbjct: 1   ATYKVKLVTPDGPVEFDCPDDVYILDQAEEEGHELPYSCRAGSCSSCAGKVSAGTVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            +FLDD+QM  G+VLTCVAYP S+V+IETHKE
Sbjct: 61  GNFLDDDQMADGFVLTCVAYPQSDVIIETHKE 92



>pir|A00233|FEED ferredoxin [2Fe-2S] - European elder (tentative
           sequence)
          Length = 97

 Score =  127 bits (319), Expect = 2e-28
 Identities = 59/92 (64%), Positives = 71/92 (77%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           ASYKVKL+TP G  EF+CPDDVY+L+ AEELG D+PY            K+V+G+VDQSD
Sbjct: 1   ASYKVKLITPDGPQEFECPDDVYILEHAEELGIDIPYSCRAGSCSSCAGKLVAGSVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDDEQ++ G+VLTCVAYP S+V IETHKE
Sbjct: 61  QSFLDDEQIEEGWVLTCVAYPKSDVTIETHKE 92



>sp|P00226|FER_SAMNI Ferredoxin.
          Length = 97

 Score =  127 bits (319), Expect = 2e-28
 Identities = 59/92 (64%), Positives = 71/92 (77%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           ASYKVKL+TP G  EF+CPDDVY+L+ AEELG D+PY            K+V+G+VDQSD
Sbjct: 1   ASYKVKLITPDGPQEFECPDDVYILEHAEELGIDIPYSCRAGSCSSCAGKLVAGSVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDDEQ++ G+VLTCVAYP S+V IETHKE
Sbjct: 61  QSFLDDEQIEEGWVLTCVAYPKSDVTIETHKE 92



>sp|P83520|FER_DATAR Ferredoxin.
          Length = 97

 Score =  127 bits (319), Expect = 2e-28
 Identities = 61/92 (66%), Positives = 69/92 (75%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKVKLVTP G  EFDCPDDVY+LDQAEE G +LPY            KV +GTVDQSD
Sbjct: 1   ATYKVKLVTPDGPVEFDCPDDVYILDQAEEEGHELPYSCRAGSCSSCAGKVTAGTVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            +FLDD+QM  G+VLTCVAYP S+V IETHKE
Sbjct: 61  GNFLDDDQMADGFVLTCVAYPQSDVTIETHKE 92



>sp|P83527|FER_CAPAA Ferredoxin.
          Length = 97

 Score =  127 bits (319), Expect = 2e-28
 Identities = 58/92 (63%), Positives = 68/92 (73%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           ASYKVKL+TP G  EFDCPDDVY+LDQAEE G DLPY            K+  G VDQ+D
Sbjct: 1   ASYKVKLITPDGPIEFDCPDDVYILDQAEEAGHDLPYSCRAGSCSSCAGKIAGGAVDQTD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            +FLDD+Q++ G+VLTCVAYP S+V IETHKE
Sbjct: 61  GNFLDDDQLEEGWVLTCVAYPQSDVTIETHKE 92



>sp|P83583|FER_SOLLY Ferredoxin.
          Length = 97

 Score =  126 bits (317), Expect = 3e-28
 Identities = 59/92 (64%), Positives = 68/92 (73%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKVKL+TP G  EF+CPDDVY+LD AEE G DLPY            K+ +G VDQSD
Sbjct: 1   ATYKVKLITPEGPVEFNCPDDVYILDSAEENGHDLPYSCRAGACSSCAGKITAGNVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           NSFLDD+Q+  G+VLTCVAYP SNV IETHKE
Sbjct: 61  NSFLDDDQVAEGFVLTCVAYPKSNVTIETHKE 92



>sp|P83521|FER_DATME Ferredoxin.
          Length = 97

 Score =  126 bits (317), Expect = 3e-28
 Identities = 60/92 (65%), Positives = 69/92 (75%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKVKLVTP G  EFDCPDDVY+LD+AEE G DLPY            KV +GTVDQSD
Sbjct: 1   ATYKVKLVTPDGPVEFDCPDDVYILDRAEEEGHDLPYSCRAGSCSSCAGKVTAGTVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            ++LDD+QM  G+VLTCVAYP S+V IETHKE
Sbjct: 61  GNYLDDDQMAEGFVLTCVAYPQSDVTIETHKE 92



>gb:AY072818_1567402 Oryza sativa anti-disease protein 1 (ADI1)
           mRNA, complete cds.
          Length = 138

 Score =  126 bits (316), Expect = 4e-28
 Identities = 66/120 (55%), Positives = 80/120 (66%), Gaps = 2/120 (1%)
 Frame = +3

Query: 117 SLRAISNFRPAQLGLKSGNM--GRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELG 290
           SLR  +   PA++ L + N    R+   A+Y VKL+TP G+ E   PDDVY+LDQAEE G
Sbjct: 15  SLRVATAPAPARVVLPASNKLGDRLRMQATYNVKLITPDGEVELQVPDDVYILDQAEEEG 74

Query: 291 ADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            DLPY            KVVSG +DQSD SFLDD+Q+ AG+VLTC AYP S+VVIETHKE
Sbjct: 75  IDLPYSCRAGSCSSCAGKVVSGEIDQSDQSFLDDDQVAAGWVLTCHAYPKSDVVIETHKE 134



>sp|P27789|FER5_MAIZE Ferredoxin V, chloroplast precursor (Fd
           V).>pir|T03288|T03288 ferredoxin [2Fe-2S] -
           maize>gb:MZEFD5_1687906 Maize ferredoxin (Fd) isoprotein
           mRNA, pFD5.
          Length = 135

 Score =  126 bits (316), Expect = 4e-28
 Identities = 68/133 (51%), Positives = 82/133 (61%)
 Frame = +3

Query: 72  MSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFEFDCP 251
           M+T   S +  A   SLRA        + +  G   R+   A+Y VKL+TP G+ E   P
Sbjct: 1   MATVLSSPRAPAFSFSLRAAP---ATTVAMTRGASSRLRAQATYNVKLITPEGEVELQVP 57

Query: 252 DDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVA 431
           DDVY+LD AEE G DLPY            KVVSG++DQSD SFLDD Q+  G+VLTCVA
Sbjct: 58  DDVYILDYAEEEGIDLPYSCRAGSCSSCAGKVVSGSLDQSDQSFLDDSQVADGWVLTCVA 117

Query: 432 YPTSNVVIETHKE 470
           YPTS+VVIETHKE
Sbjct: 118 YPTSDVVIETHKE 130



>sp|P81454|FER_DATST Ferredoxin.
          Length = 97

 Score =  125 bits (315), Expect = 5e-28
 Identities = 60/92 (65%), Positives = 69/92 (75%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKVKLVTP G  EF+CPDDVY+LDQAEE G DLPY            KV +GTVDQSD
Sbjct: 1   ATYKVKLVTPDGPVEFNCPDDVYILDQAEEEGHDLPYSCRAGSCSSCAGKVTAGTVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            ++LDD+QM  G+VLTCVAYP S+V IETHKE
Sbjct: 61  GNYLDDDQMADGFVLTCVAYPQSDVTIETHKE 92



>sp|P81373|FERB_ALOMA Ferredoxin B (Fd B).>pir|S28199|S28199
           ferredoxin [2Fe-2S] B - giant taro
          Length = 98

 Score =  125 bits (315), Expect = 5e-28
 Identities = 62/93 (66%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = +3

Query: 195 ASYKVKLVTPTGD-FEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQS 371
           A+YKVKLVTP+G   EF+CPDDVY+LDQAEE G DLPY            KV +G VDQS
Sbjct: 1   ATYKVKLVTPSGQPLEFECPDDVYILDQAEEEGIDLPYSCRAGSCSSCAGKVKNGNVDQS 60

Query: 372 DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           D SFLDD+Q+  G+VLTCVAYPTS+VVIETHKE
Sbjct: 61  DGSFLDDDQIGEGWVLTCVAYPTSDVVIETHKE 93



>sp|P83523|FER_LYCCN Ferredoxin.
          Length = 97

 Score =  125 bits (313), Expect = 8e-28
 Identities = 60/92 (65%), Positives = 69/92 (75%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKVKLVTP G  EFDCPDDVY+LDQAEE G +LPY            KV +GTVDQSD
Sbjct: 1   ATYKVKLVTPDGPVEFDCPDDVYILDQAEEEGHELPYSCRAGSCSSCAGKVSAGTVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            +FLDD+Q+  G+VLTCVAYP S+V IETHKE
Sbjct: 61  GNFLDDDQIADGFVLTCVAYPQSDVTIETHKE 92



>sp|P83522|FER_HORVU Ferredoxin.
          Length = 97

 Score =  124 bits (311), Expect = 1e-27
 Identities = 59/92 (64%), Positives = 69/92 (75%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKVKLVTP G+ E + PDDVY+LDQAEE G DLPY            K+VSG +DQSD
Sbjct: 1   ATYKVKLVTPEGEVELEVPDDVYILDQAEEEGIDLPYSCRAGSCSSCAGKLVSGEIDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDD+QM+ G+VLTC AYP S+VVIETHKE
Sbjct: 61  QSFLDDDQMEEGWVLTCAAYPKSDVVIETHKE 92



>sp|P11051|FER1_ORYSA Ferredoxin I, chloroplast precursor
           (Anti-disease protein 1).>pir|T03738|FERZ ferredoxin
           [2Fe-2S] I precursor - rice>gb:RICFERR_1703609 Oryza
           sativa (japonica cultivar-group) mRNA for ferredoxin,
           complete cds.>gb:AP003909_1835045 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1300_E01.
          Length = 139

 Score =  124 bits (311), Expect = 1e-27
 Identities = 66/121 (54%), Positives = 81/121 (66%), Gaps = 3/121 (2%)
 Frame = +3

Query: 117 SLRAISNFRPAQLGL--KSGNMG-RMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEEL 287
           SLR  +   PA++ +   S  +G R+   A+Y VKL+TP G+ E   PDDVY+LDQAEE 
Sbjct: 15  SLRVATAPAPARVSVLPASNKLGDRLRMQATYNVKLITPDGEVELQVPDDVYILDQAEEE 74

Query: 288 GADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHK 467
           G DLPY            KVVSG +DQSD SFLDD+Q+ AG+VLTC AYP S+VVIETHK
Sbjct: 75  GIDLPYSCRAGSCSSCAGKVVSGEIDQSDQSFLDDDQVAAGWVLTCHAYPKSDVVIETHK 134

Query: 468 E 470
           E
Sbjct: 135 E 135



>sp|P27787|FER1_MAIZE Ferredoxin I, chloroplast precursor (Fd
           I).>pir|T03286|T03286 ferredoxin [2Fe-2S] -
           maize>gb:MZEFD1_1687903 Maize ferredoxin I (Fd)
           isoprotein mRNA, pFD1.>gb:MZEFD1P_1687904 Maize
           ferredoxin I (Fd) isoprotein mRNA, pFD1'.
          Length = 150

 Score =  124 bits (311), Expect = 1e-27
 Identities = 67/132 (50%), Positives = 83/132 (62%)
 Frame = +3

Query: 75  STSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFEFDCPD 254
           S+S L   PA    +L A    +   +G  + +  R+   A+Y VKL+TP G+ E   PD
Sbjct: 16  SSSSLRAAPAPTAVALPAA---KVGIMGRSASSRRRLRAQATYNVKLITPEGEVELQVPD 72

Query: 255 DVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAY 434
           DVY+LDQAEE G DLPY            KVVSG+VDQSD S+LDD Q+  G+VLTC AY
Sbjct: 73  DVYILDQAEEDGIDLPYSCRAGSCSSCAGKVVSGSVDQSDQSYLDDGQIADGWVLTCHAY 132

Query: 435 PTSNVVIETHKE 470
           PTS+VVIETHKE
Sbjct: 133 PTSDVVIETHKE 144



>pir|A00229|FETA ferredoxin [2Fe-2S] - taro (tentative sequence)
          Length = 97

 Score =  123 bits (309), Expect = 2e-27
 Identities = 60/92 (65%), Positives = 67/92 (72%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKVKLVTP+G  EF CPDDVY+LDQAEE+G DLPY            KV  G VDQSD
Sbjct: 1   ATYKVKLVTPSGQQEFQCPDDVYILDQAEEVGIDLPYSCRAGSCSSCAGKVKVGDVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDDEQ+  G+VLTCVAYP S+  IETHKE
Sbjct: 61  GSFLDDEQIGEGWVLTCVAYPVSDGTIETHKE 92



>sp|P00222|FER_COLES Ferredoxin.
          Length = 97

 Score =  123 bits (309), Expect = 2e-27
 Identities = 60/92 (65%), Positives = 67/92 (72%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKVKLVTP+G  EF CPDDVY+LDQAEE+G DLPY            KV  G VDQSD
Sbjct: 1   ATYKVKLVTPSGQQEFQCPDDVYILDQAEEVGIDLPYSCRAGSCSSCAGKVKVGDVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDDEQ+  G+VLTCVAYP S+  IETHKE
Sbjct: 61  GSFLDDEQIGEGWVLTCVAYPVSDGTIETHKE 92



>pir|A92055|FELG ferredoxin [2Fe-2S] - white popinac (tentative
           sequence)
          Length = 96

 Score =  122 bits (307), Expect = 4e-27
 Identities = 57/91 (62%), Positives = 69/91 (75%)
 Frame = +3

Query: 198 SYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDN 377
           ++KVKL+TP G  EF+CPDDVY+LDQAEELG +LPY            K+V G +DQSD 
Sbjct: 1   AFKVKLLTPDGPKEFECPDDVYILDQAEELGIELPYSCRAGSCSSCAGKLVEGDLDQSDQ 60

Query: 378 SFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SFLDDEQ++ G+VLTC AYP S+VVIETHKE
Sbjct: 61  SFLDDEQIEEGWVLTCAAYPRSDVVIETHKE 91



>sp|P00225|FER_LEUGL Ferredoxin.
          Length = 96

 Score =  122 bits (307), Expect = 4e-27
 Identities = 57/91 (62%), Positives = 69/91 (75%)
 Frame = +3

Query: 198 SYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDN 377
           ++KVKL+TP G  EF+CPDDVY+LDQAEELG +LPY            K+V G +DQSD 
Sbjct: 1   AFKVKLLTPDGPKEFECPDDVYILDQAEELGIELPYSCRAGSCSSCAGKLVEGDLDQSDQ 60

Query: 378 SFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SFLDDEQ++ G+VLTC AYP S+VVIETHKE
Sbjct: 61  SFLDDEQIEEGWVLTCAAYPRSDVVIETHKE 91



>pir|S76345|FEYB6 ferredoxin [2Fe-2S] [validated] - Synechocystis
           sp.>gb:D85607_120678 Synechocystis sp. gene for
           ferredoxin I, complete cds.>gb:SSU38802_191482
           Synechocystis sp. lipid A disaccharide synthase (lpxB),
           ferredoxin (fed), transposase, and MgtC genes, complete
           cds.>gb:BA000022_689586 Synechocystis sp. PCC 6803 DNA,
           complete genome.
          Length = 97

 Score =  122 bits (305), Expect = 7e-27
 Identities = 56/93 (60%), Positives = 67/93 (72%)
 Frame = +3

Query: 192 MASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQS 371
           MASY VKL+TP G+   +C DD Y+LD AEE G DLPY            K+ +G+VDQS
Sbjct: 1   MASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQS 60

Query: 372 DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           D SFLDD+Q++AGYVLTCVAYPTS+  IETHKE
Sbjct: 61  DQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKE 93



>gb:BA000045_743698 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 97

 Score =  121 bits (303), Expect = 1e-26
 Identities = 58/93 (62%), Positives = 66/93 (70%)
 Frame = +3

Query: 192 MASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQS 371
           MA+YKV LVTP+G  E DCP D Y+LD AE  G DLP+            K+VSGT+DQ 
Sbjct: 1   MATYKVTLVTPSGKKEIDCPSDEYILDAAERQGLDLPFSCRAGACSTCAGKMVSGTIDQG 60

Query: 372 DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           D SFLDD+Q+ AGYVLTCVAYPTSN  IETHKE
Sbjct: 61  DQSFLDDDQIAAGYVLTCVAYPTSNCSIETHKE 93



>sp|P07839|FER_CHLRE Ferredoxin, chloroplast
           precursor.>pir|T08054|FEKM ferredoxin [2Fe-2S]
           precursor, chloroplast - Chlamydomonas
           reinhardtii>gb:CREFERREDO_1673370 Chlamydomonas
           reinhardtii ferredoxin mRNA, complete
           cds.>gb:CRU29516_1673658 Chlamydomonas reinhardtii
           ferredoxin precursor gene, complete cds.
          Length = 126

 Score =  120 bits (301), Expect = 2e-26
 Identities = 65/123 (52%), Positives = 76/123 (61%)
 Frame = +3

Query: 102 AAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAE 281
           AA  G+  A+   RPA          RM+CMA YKV L TP+GD   +CP D Y+LD AE
Sbjct: 10  AARVGAKPAVRGARPAS---------RMSCMA-YKVTLKTPSGDKTIECPADTYILDAAE 59

Query: 282 ELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIET 461
           E G DLPY            KV +GTVDQSD SFLDD QM  G+VLTCVAYPTS+  I+T
Sbjct: 60  EAGLDLPYSCRAGACSSCAGKVAAGTVDQSDQSFLDDAQMGNGFVLTCVAYPTSDCTIQT 119

Query: 462 HKE 470
           H+E
Sbjct: 120 HQE 122



>pir|JX0082|JX0082 ferredoxin [2Fe-2S] A, leaf - radish
          Length = 96

 Score =  120 bits (300), Expect = 3e-26
 Identities = 57/92 (61%), Positives = 67/92 (72%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKVK +TP G+ E +C DDVYVLD AEE G DLPY            KVVSG+VDQSD
Sbjct: 1   ATYKVKFITPEGEQEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDD+Q+  G+VLTC AYPTS+V IETH+E
Sbjct: 61  QSFLDDDQIAEGFVLTCAAYPTSDVTIETHRE 92



>pir|B00238|FEFWF ferredoxin [2Fe-2S] I - food pokeweed
          Length = 96

 Score =  120 bits (300), Expect = 3e-26
 Identities = 57/92 (61%), Positives = 65/92 (70%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKV LVTP+G    DCPDD YVLD AEE G DLPY            KV +GTVDQ D
Sbjct: 1   ATYKVTLVTPSGTQTIDCPDDTYVLDAAEEAGLDLPYSCRAGSCSSCTGKVTAGTVDQED 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDD+Q++AG+VLTCVAYP  +V IETHKE
Sbjct: 61  QSFLDDDQIEAGFVLTCVAYPKGDVTIETHKE 92



>sp|P27320|FER_SYNY3 Ferredoxin I.
          Length = 96

 Score =  120 bits (300), Expect = 3e-26
 Identities = 55/92 (59%), Positives = 66/92 (71%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           ASY VKL+TP G+   +C DD Y+LD AEE G DLPY            K+ +G+VDQSD
Sbjct: 1   ASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDD+Q++AGYVLTCVAYPTS+  IETHKE
Sbjct: 61  QSFLDDDQIEAGYVLTCVAYPTSDCTIETHKE 92



>sp|P83585|FER_SOLAB Ferredoxin.
          Length = 97

 Score =  120 bits (300), Expect = 3e-26
 Identities = 56/92 (60%), Positives = 68/92 (73%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKVKLVTP G  EF+CPDD Y+LD+AEE G DLPY            K+ +G+VDQSD
Sbjct: 1   ATYKVKLVTPDGPVEFECPDDEYILDRAEEEGHDLPYSCRAGSCSSCAGKIAAGSVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            +FLDD+Q+  G+VLTCVAYP S+V IETHKE
Sbjct: 61  GNFLDDDQIADGFVLTCVAYPQSDVTIETHKE 92



>sp|P00227|FER_BRANA Ferredoxin.>pir|A00234|FERP ferredoxin [2Fe-2S]
           - rape
          Length = 96

 Score =  120 bits (300), Expect = 3e-26
 Identities = 58/92 (63%), Positives = 66/92 (71%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKVK +TP G+ E +C DDVYVLD AEE G DLPY            KVVSG VDQSD
Sbjct: 1   ATYKVKFITPEGEQEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGFVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDD+Q+  G+VLTC AYPTS+V IETHKE
Sbjct: 61  ESFLDDDQIAEGFVLTCAAYPTSDVTIETHKE 92



>sp|P14938|FER3_RAPSA Ferredoxin, leaf L-A.
          Length = 96

 Score =  120 bits (300), Expect = 3e-26
 Identities = 57/92 (61%), Positives = 67/92 (72%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKVK +TP G+ E +C DDVYVLD AEE G DLPY            KVVSG+VDQSD
Sbjct: 1   ATYKVKFITPEGEQEVECDDDVYVLDAAEEAGIDLPYSCRAGSCSSCAGKVVSGSVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDD+Q+  G+VLTC AYPTS+V IETH+E
Sbjct: 61  QSFLDDDQIAEGFVLTCAAYPTSDVTIETHRE 92



>sp|P00230|FER1_PHYES Ferredoxin I.
          Length = 96

 Score =  120 bits (300), Expect = 3e-26
 Identities = 57/92 (61%), Positives = 65/92 (70%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKV LVTP+G    DCPDD YVLD AEE G DLPY            KV +GTVDQ D
Sbjct: 1   ATYKVTLVTPSGTQTIDCPDDTYVLDAAEEAGLDLPYSCRAGSCSSCAGKVTAGTVDQED 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDD+Q++AG+VLTCVAYP  +V IETHKE
Sbjct: 61  QSFLDDDQIEAGFVLTCVAYPKGDVTIETHKE 92



>sp|P00243|FER_SYNY4 Ferredoxin.
          Length = 96

 Score =  119 bits (299), Expect = 3e-26
 Identities = 55/92 (59%), Positives = 66/92 (71%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           ASY VKL+TP G+   +C DD Y+LD AEE G DLPY            K+ +G+VDQSD
Sbjct: 1   ASYTVKLITPDGENSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDD+Q++AGYVLTCVAYPTS+  IETHKE
Sbjct: 61  QSFLDDDQIEAGYVLTCVAYPTSDCTIETHKE 92



>sp|P00238|FER_SCEQU Ferredoxin.>pir|A00242|FESC ferredoxin [2Fe-2S]
           - green alga (Scenedesmus quadricauda)
          Length = 96

 Score =  119 bits (299), Expect = 3e-26
 Identities = 57/92 (61%), Positives = 64/92 (69%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKV L TP+GD   +CPDD Y+LD AEE G DLPY            KV +GTVDQSD
Sbjct: 1   ATYKVTLKTPSGDQTIECPDDTYILDAAEEAGLDLPYSCRAGACSSCAGKVEAGTVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDD QMD G+VLTCVAYPTS+  I THKE
Sbjct: 61  QSFLDDSQMDGGFVLTCVAYPTSDCTIATHKE 92



>sp|P00229|FER1_PHYAM Ferredoxin I.>pir|A00236|FEFW1 ferredoxin
           [2Fe-2S] I - Virginian pokeweed
          Length = 96

 Score =  118 bits (296), Expect = 7e-26
 Identities = 56/92 (60%), Positives = 65/92 (70%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKV LVTP+G    DCPDD YVLD AEE G DLPY            KV +GTVDQ D
Sbjct: 1   ATYKVTLVTPSGTQTIDCPDDTYVLDAAEEAGLDLPYSCRAGSCSSCTGKVTAGTVDQED 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDD+Q++AG+VLTCVA+P  +V IETHKE
Sbjct: 61  QSFLDDDQIEAGFVLTCVAFPKGDVTIETHKE 92



>sp|P83524|FER_PHYAF Ferredoxin.
          Length = 97

 Score =  118 bits (295), Expect = 1e-25
 Identities = 56/92 (60%), Positives = 66/92 (71%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKVKL+TP G   FDCPD+ Y+LD AEE G DLPY            KV +GTVDQSD
Sbjct: 1   ATYKVKLITPDGPVVFDCPDNEYILDAAEEQGHDLPYSCRAGSCSSCAGKVTAGTVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            +FLDD+Q+  G+VLTCVAYP S+V IETHKE
Sbjct: 61  GNFLDDDQVADGFVLTCVAYPQSDVTIETHKE 92



>sp|P00223|FER_ARCLA Ferredoxin.>pir|A00230|FEBQ ferredoxin [2Fe-2S]
           - great burdock
          Length = 97

 Score =  117 bits (293), Expect = 2e-25
 Identities = 56/92 (60%), Positives = 67/92 (72%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKV L+TP G  EF+ PDDVY+LD A E   DLPY            KV +G+VDQSD
Sbjct: 1   ATYKVTLITPEGKQEFEVPDDVYILDHAAEEVGDLPYSCRAGSCSSCAGKVTAGSVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            S+LDD+QM+AG+VLTCVAYPTS+V IETHKE
Sbjct: 61  GSYLDDDQMEAGWVLTCVAYPTSDVTIETHKE 92



>gb:AF233452_1779452 Impatiens balsamina ferredoxin mRNA, complete
           cds; nuclear gene for chloroplast product.
          Length = 152

 Score =  117 bits (292), Expect = 2e-25
 Identities = 68/152 (44%), Positives = 87/152 (57%), Gaps = 10/152 (6%)
 Frame = +3

Query: 45  MATLSAGSMMSTSFLSGKPA---------AAGGSLRAISNFRPAQLGLKSGNMGRMTCMA 197
           MAT+S  S      L G P          A+  SL ++        GL+S +  R+T  A
Sbjct: 1   MATVSLSSQF---MLQGAPKRENARVSLKASSSSLGSVRRNVSKSFGLRSSSGFRVTA-A 56

Query: 198 SYKVKLVTPTG-DFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           +YK+KL+T  G + EF+C DD Y+LD AEE G DLPY            K+ SGTVDQ+D
Sbjct: 57  AYKIKLITEEGAEHEFECTDDKYILDAAEEAGVDLPYSCRAGACSTCAGKIASGTVDQND 116

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLD+ QM  GY+LTCV+YP S+ VI THKE
Sbjct: 117 GSFLDEGQMKEGYLLTCVSYPASDCVIHTHKE 148



>pir|T01170|T01170 ferredoxin [2Fe-2S] 2 - maize>gb:AB016810_1512868
           Zea mays mRNA for ferredoxin, complete cds.
          Length = 140

 Score =  116 bits (291), Expect = 3e-25
 Identities = 67/139 (48%), Positives = 81/139 (58%), Gaps = 2/139 (1%)
 Frame = +3

Query: 60  AGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGR--MTCMASYKVKLVTPTGD 233
           A + +S S L   P      LR     R A     +  M R  +   A+Y VKL+TP G+
Sbjct: 2   AATALSMSILRAPPPCFSSPLR----LRVAVAKPLAAPMRRQLLRAQATYNVKLITPEGE 57

Query: 234 FEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGY 413
            E   PDDVY+LD AEE G DLP+            KVVSG+VDQSD SFL+D Q+  G+
Sbjct: 58  VELQVPDDVYILDFAEEEGIDLPFSCRAGSCSSCAGKVVSGSVDQSDQSFLNDNQVADGW 117

Query: 414 VLTCVAYPTSNVVIETHKE 470
           VLTC AYPTS+VVIETHKE
Sbjct: 118 VLTCAAYPTSDVVIETHKE 136



>sp|P00220|FER_MEDSA Ferredoxin.>pir|A00227|FEAA ferredoxin [2Fe-2S]
           - alfalfa
          Length = 97

 Score =  116 bits (291), Expect = 3e-25
 Identities = 57/92 (61%), Positives = 66/92 (71%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           ASYKVKLVTP G  EF+CPDDVY+LD AEE G  LPY            KV +G V+QSD
Sbjct: 1   ASYKVKLVTPEGTQEFECPDDVYILDHAEEEGIVLPYSCRAGSCSSCAGKVAAGEVNQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDD+Q++ G+VLTCVAY  S+V IETHKE
Sbjct: 61  GSFLDDDQIEEGWVLTCVAYAKSDVTIETHKE 92



>sp|P00244|FER1_APHFL Ferredoxin I.>pir|A00248|FEFZ1 ferredoxin
           [2Fe-2S] I - Aphanizomenon flos-aquae
          Length = 97

 Score =  115 bits (289), Expect = 5e-25
 Identities = 56/93 (60%), Positives = 66/93 (70%), Gaps = 1/93 (1%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFE-FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQS 371
           A+YKV L+   G     DCPDD Y+LD AEE G DLPY            K+V+GT+DQS
Sbjct: 1   ATYKVTLIDAEGTTTTIDCPDDTYILDAAEEAGLDLPYSCRAGACSTCAGKLVTGTIDQS 60

Query: 372 DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           D SFLDD+Q++AGYVLTCVAYPTS+V IETHKE
Sbjct: 61  DQSFLDDDQVEAGYVLTCVAYPTSDVTIETHKE 93



>gb:AY826851_1629157 Pavlova lutheri clone PLF2 chloroplast
           ferredixon mRNA, partial cds; nuclear gene for
           chloroplast product.
          Length = 137

 Score =  115 bits (288), Expect = 6e-25
 Identities = 54/98 (55%), Positives = 69/98 (70%)
 Frame = +3

Query: 177 GRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSG 356
           G  + ++ Y V L TP+G+ + +CP+D Y+LD+AEE G DLPY            KV SG
Sbjct: 36  GAASTVSMYTVTLKTPSGESKIECPEDTYILDKAEEEGIDLPYSCRAGACSTCCGKVASG 95

Query: 357 TVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           TVDQSD SFLDD QM++G+VLTCVAYP+S+  IETHKE
Sbjct: 96  TVDQSDQSFLDDGQMESGFVLTCVAYPSSDCTIETHKE 133



>gb:AY267628_1314451 Bigelowiella natans ferredoxin 1 mRNA, complete
           cds; nuclear gene for plastid product.
          Length = 188

 Score =  115 bits (288), Expect = 6e-25
 Identities = 56/96 (58%), Positives = 67/96 (69%)
 Frame = +3

Query: 183 MTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTV 362
           MT  A+YKV L TP G+   +CPDD YVLD+AEE G DLPY            KVV+G+V
Sbjct: 89  MTAAATYKVTLQTPEGESVIECPDDTYVLDKAEEEGLDLPYSCRAGACSTCAGKVVAGSV 148

Query: 363 DQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           DQSD SFL+D Q+  G+VLTCVAYPTS+V I TH+E
Sbjct: 149 DQSDQSFLEDSQVADGFVLTCVAYPTSDVTIATHQE 184



>pir|C47673|C47673 ferredoxin [2Fe-2S] - Synechococcus sp. (PCC
           7002)>gb:SYOPETF_195645 Synechococcus sp. ferredoxin I
           (petF) gene, complete cds.
          Length = 97

 Score =  114 bits (286), Expect = 1e-24
 Identities = 53/93 (56%), Positives = 67/93 (72%)
 Frame = +3

Query: 192 MASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQS 371
           MA+YKV L+TP G+  +D PDD Y+LD A + G DLP             K+VSGTVDQS
Sbjct: 1   MATYKVTLITPDGEVSYDAPDDEYILDSAGDAGYDLPASCRAGACSTCAGKIVSGTVDQS 60

Query: 372 DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           + SFLDD+Q++AGYVLTC+AYP S+V IET+KE
Sbjct: 61  EQSFLDDDQIEAGYVLTCIAYPQSDVTIETNKE 93



>sp|P00232|FER2_PHYES Ferredoxin II.>pir|A00238|FEFW2E ferredoxin
           [2Fe-2S] II - food pokeweed
          Length = 98

 Score =  114 bits (284), Expect = 2e-24
 Identities = 55/92 (59%), Positives = 64/92 (69%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           ASYKV  VTP+G     CP D YVLD AE+ G DLPY            KV +G+V+Q D
Sbjct: 2   ASYKVTFVTPSGTKTITCPADTYVLDAAEDTGLDLPYSCRAGACSSCAGKVTAGSVNQED 61

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLD+EQM+AG+VLTCVAYPTS+V IETHKE
Sbjct: 62  GSFLDEEQMEAGWVLTCVAYPTSDVTIETHKE 93



>sp|P00224|FER2_SPIOL Ferredoxin II.>pir|A00231|FESP2 ferredoxin
           [2Fe-2S] II - spinach
          Length = 97

 Score =  112 bits (281), Expect = 4e-24
 Identities = 54/92 (58%), Positives = 64/92 (69%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKV LVTP+G    +C DD Y+LD AEE G DLPY            KV SG+VDQSD
Sbjct: 1   ATYKVTLVTPSGSQVIECGDDEYILDAAEEKGMDLPYSCRAGACSSCAGKVTSGSVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFL+D QM+ G+VLTC+AYPT +V IETHKE
Sbjct: 61  QSFLEDGQMEEGWVLTCIAYPTGDVTIETHKE 92



>sp|P00231|FER2_PHYAM Ferredoxin II.>pir|A00237|FEFW2 ferredoxin
           [2Fe-2S] II - Virginian pokeweed
          Length = 98

 Score =  112 bits (281), Expect = 4e-24
 Identities = 55/92 (59%), Positives = 63/92 (68%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           ASYKV  VTP+G     CP D YVLD AEE G DLPY            KV +G V+Q D
Sbjct: 2   ASYKVTFVTPSGTNTITCPADTYVLDAAEESGLDLPYSCRAGACSSCAGKVTAGAVNQED 61

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFL++EQM+AG+VLTCVAYPTS+V IETHKE
Sbjct: 62  GSFLEEEQMEAGWVLTCVAYPTSDVTIETHKE 93



>sp|P31965|FER1_SYNP2 Ferredoxin I.
          Length = 96

 Score =  112 bits (281), Expect = 4e-24
 Identities = 52/92 (56%), Positives = 66/92 (71%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKV L+TP G+  +D PDD Y+LD A + G DLP             K+VSGTVDQS+
Sbjct: 1   ATYKVTLITPDGEVSYDAPDDEYILDSAGDAGYDLPASCRAGACSTCAGKIVSGTVDQSE 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDD+Q++AGYVLTC+AYP S+V IET+KE
Sbjct: 61  QSFLDDDQIEAGYVLTCIAYPQSDVTIETNKE 92



>pir|S62722|S62722 ferredoxin [2Fe-2S] fd1 precursor,
           non-photosynthetic - sweet orange>gb:CSNPHFDXN_1674001
           C.sinensis mRNA for non-photosynthetic ferredoxin.
          Length = 150

 Score =  112 bits (280), Expect = 5e-24
 Identities = 53/94 (56%), Positives = 68/94 (72%), Gaps = 1/94 (1%)
 Frame = +3

Query: 192 MASYKVKLVTPTGD-FEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQ 368
           MA YK+KL+ P G+  EF+  +D Y+LD AEE G DLPY            K+VSG+VDQ
Sbjct: 53  MAVYKIKLIGPMGEEHEFEAQEDQYILDAAEEAGVDLPYSCRAGACSTCAGKLVSGSVDQ 112

Query: 369 SDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SD SFLDD QM+AGY+LTC++YPTS+ VI++HKE
Sbjct: 113 SDGSFLDDNQMEAGYLLTCISYPTSDCVIQSHKE 146



>gb:AC092557_1735481 Oryza sativa chromosome 3 BAC OSJNBa0096I06
           genomic sequence, complete sequence.
          Length = 153

 Score =  112 bits (279), Expect = 7e-24
 Identities = 53/97 (54%), Positives = 67/97 (69%), Gaps = 1/97 (1%)
 Frame = +3

Query: 183 MTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGT 359
           ++ MA+YKVKL+TP G + EF+ PDD Y+LD AE  G +LPY            K+ +G+
Sbjct: 53  VSAMATYKVKLITPEGQEHEFEAPDDTYILDAAETAGVELPYSCRAGACSTCAGKIEAGS 112

Query: 360 VDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           VDQSD SFLDD Q + GYVLTCV+YP S+ VI THKE
Sbjct: 113 VDQSDGSFLDDAQQEEGYVLTCVSYPKSDCVIHTHKE 149



>sp|O04166|FER_PHYPA Ferredoxin, chloroplast
           precursor.>gb:PPFERREDO_1701324 P.patens mRNA for
           ferredoxin.
          Length = 145

 Score =  112 bits (279), Expect = 7e-24
 Identities = 61/142 (42%), Positives = 82/142 (57%), Gaps = 8/142 (5%)
 Frame = +3

Query: 69  MMSTSFLSGKPAAAGGSLRAISNFRPAQL------GLKSGNMGRMTCMASYKVKLVTPTG 230
           M + +  S  P A+   +  ++N RP+ +      GLKS +MGR+TCMA+YKV  +    
Sbjct: 1   MAAAAMTSIVPVASIAPVSKVANVRPSSVSVAKAFGLKSRSMGRLTCMATYKVTFLDGET 60

Query: 231 DFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMD 404
             E   +C D+ Y LD AE  G DLPY             + +G VDQSD SFLDD Q+D
Sbjct: 61  GAENVXECSDEEYXLDAAERAGMDLPYSCRAGACSSCAGIIKAGEVDQSDQSFLDDSQID 120

Query: 405 AGYVLTCVAYPTSNVVIETHKE 470
            G+VLTCVAYP S+ +I TH+E
Sbjct: 121 DGFVLTCVAYPASDCIIXTHQE 142



>sp|P27788|FER3_MAIZE Ferredoxin III, chloroplast precursor (Fd
           III).>pir|T02881|T02881 ferredoxin [2Fe-2S] 3 -
           maize>gb:AB001387_1508468 Maize DNA for Fd III, complete
           cds.>gb:MZEFD3_1687905 Maize ferredoxin III (Fd)
           isoprotein mRNA, pFD3.
          Length = 152

 Score =  112 bits (279), Expect = 7e-24
 Identities = 57/105 (54%), Positives = 68/105 (64%), Gaps = 1/105 (0%)
 Frame = +3

Query: 159 LKSGNMGRMTCMASYKVKLVTPTGD-FEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXX 335
           LK+     ++ MA YKVKLV P G+  EFD PDD Y+LD AE  G +LPY          
Sbjct: 44  LKTSKKLDVSAMAVYKVKLVGPEGEEHEFDAPDDAYILDAAETAGVELPYSCRAGACSTC 103

Query: 336 XXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
             K+ SG+VDQSD SFLDD Q + GYVLTCV+YP S+ VI THKE
Sbjct: 104 AGKIESGSVDQSDGSFLDDGQQEEGYVLTCVSYPKSDCVIHTHKE 148



>gb:AY826852_1629158 Acetabularia acetabulum clone AAF1 chloroplast
           ferredoxin mRNA, complete cds; nuclear gene for
           chloroplast product.
          Length = 137

 Score =  111 bits (278), Expect = 9e-24
 Identities = 65/138 (47%), Positives = 81/138 (58%), Gaps = 1/138 (0%)
 Frame = +3

Query: 60  AGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFE 239
           A S +  S ++ KPA       AI+    ++  LK         + +YKV L+TP G+  
Sbjct: 5   ATSPLLGSRVTLKPATTSQIFAAITRPIASRRSLK---------VLAYKVTLITPDGNQN 55

Query: 240 -FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYV 416
            F+C DDVY+LD AEE G DLPY             V SGT+DQSD SFLDD+QM  G+V
Sbjct: 56  SFECADDVYILDAAEEEGIDLPYSCRAGSCSSCTGVVKSGTIDQSDQSFLDDDQMGNGFV 115

Query: 417 LTCVAYPTSNVVIETHKE 470
           LTCVAYPTS+  IETHKE
Sbjct: 116 LTCVAYPTSDCTIETHKE 133



>gb:AY826847_1629153 Heterocapsa triquetra clone HTF1 chloroplast
           ferredoxin mRNA, complete cds; nuclear gene for
           chloroplast product.
          Length = 164

 Score =  111 bits (278), Expect = 9e-24
 Identities = 57/123 (46%), Positives = 77/123 (62%)
 Frame = +3

Query: 102 AAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAE 281
           A A G+  AI + +PA+ G+           A + VKL TP G+  F+CPDDVY+LDQAE
Sbjct: 49  APAFGAAPAIISAKPARPGVA----------AHFTVKLQTPDGEQSFECPDDVYILDQAE 98

Query: 282 ELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIET 461
           E G +LPY            KV+ G++DQSD +FLD++Q D+G+ LTCV Y TS+V I+T
Sbjct: 99  EEGIELPYSCRAGSCSSCAGKVIDGSIDQSDQAFLDEDQTDSGFCLTCVTYATSDVTIKT 158

Query: 462 HKE 470
           H E
Sbjct: 159 HCE 161



>pir|G84673|G84673 probable ferredoxin [imported] - Arabidopsis
           thaliana>gb:AC006232_1533758 Arabidopsis thaliana
           chromosome 2 clone F10A12 map B68, complete
           sequence.>gb:AY086622_1571668 Arabidopsis thaliana clone
           26333 mRNA, complete sequence.>gb:BT004187_1637284
           Arabidopsis thaliana clone RAFL15-43-O10 (R50123)
           putative ferredoxin (At2g27510) mRNA, complete
           cds.>gb:BT005393_1638333 Arabidopsis thaliana clone
           U50123 putative ferredoxin (At2g27510) mRNA, complete
           cds.
          Length = 155

 Score =  111 bits (278), Expect = 9e-24
 Identities = 62/121 (51%), Positives = 74/121 (61%), Gaps = 2/121 (1%)
 Frame = +3

Query: 114 GSLRAISNFRPAQLGLK-SGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQAEEL 287
           GS + +S       GLK S N G  T  A YKVKL+ P G + EF+  DD Y+LD AEE 
Sbjct: 35  GSTKRVSR----SFGLKCSANSGGATMSAVYKVKLLGPDGQEDEFEVQDDQYILDAAEEA 90

Query: 288 GADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHK 467
           G DLPY            ++VSG VDQSD SFL+D  ++ GYVLTCVAYP S+ VI THK
Sbjct: 91  GVDLPYSCRAGACSTCAGQIVSGNVDQSDGSFLEDSHLEKGYVLTCVAYPQSDCVIHTHK 150

Query: 468 E 470
           E
Sbjct: 151 E 151



>gb:AY826850_1629156 Isochrysis galbana clone ISF2 chloroplast
           ferredoxin mRNA, partial cds; nuclear gene for
           chloroplast product.
          Length = 132

 Score =  110 bits (276), Expect = 2e-23
 Identities = 53/102 (51%), Positives = 64/102 (62%)
 Frame = +3

Query: 165 SGNMGRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXK 344
           S  + R +    Y V L+ PTG +  DCP D Y+LD+AEE G DLPY            K
Sbjct: 27  SSRIARASPAQMYTVTLIHPTGTYTIDCPADTYILDKAEEEGIDLPYSCRAGACSTCAGK 86

Query: 345 VVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           V +GTVDQSD S LDD+QM  G+ LTCV+YPTS+  IETHKE
Sbjct: 87  VTAGTVDQSDGSLLDDDQMAKGFCLTCVSYPTSDCTIETHKE 128



>gb:AF030002_470714 Fischerella PCC7605 ferredoxin (petF) gene,
           complete cds.
          Length = 99

 Score =  110 bits (276), Expect = 2e-23
 Identities = 55/95 (57%), Positives = 65/95 (68%), Gaps = 2/95 (2%)
 Frame = +3

Query: 192 MASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVD 365
           MA+YKV L+          + PDD Y+LD AEE G DLPY            K++SGTVD
Sbjct: 1   MATYKVTLINEAEGLNKTIEVPDDQYILDAAEEAGIDLPYSCRAGACSTCAGKLISGTVD 60

Query: 366 QSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           QSD SFLDD+Q++AGYVLTCVAYPTS+ VIETHKE
Sbjct: 61  QSDQSFLDDDQIEAGYVLTCVAYPTSDCVIETHKE 95



>pir|S25233|S25233 ferredoxin [2Fe-2S] I [validated] - Anabaena sp.
           (strain PCC 7120)>pir|AE2324|AE2324 ferredoxin I
           [imported] - Nostoc sp. (strain PCC
           7120)>gb:ANAPETF_553342 Anabaena sp. petF gene encoding
           ferredoxin I, complete cds.>gb:BA000019_685137 Nostoc
           sp. PCC 7120 DNA, complete genome.
          Length = 99

 Score =  109 bits (273), Expect = 3e-23
 Identities = 55/95 (57%), Positives = 67/95 (70%), Gaps = 2/95 (2%)
 Frame = +3

Query: 192 MASYKVKLVTPTGD--FEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVD 365
           MA++KV L+        E + PDD Y+LD AEE G DLP+            K+VSGTVD
Sbjct: 1   MATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVD 60

Query: 366 QSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           QSD SFLDD+Q++AGYVLTCVAYPTS+VVI+THKE
Sbjct: 61  QSDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKE 95



>sp|P56408|FER_CHLFU Ferredoxin.>pir|A68399|A68399 ferredoxin
           [2Fe-2S] [validated] - Chlorella fusca
          Length = 94

 Score =  109 bits (273), Expect = 3e-23
 Identities = 53/90 (58%), Positives = 61/90 (67%)
 Frame = +3

Query: 201 YKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNS 380
           YKV L TP+G+   +CP+D Y+LD AEE G DLPY            KV SG VDQSD S
Sbjct: 1   YKVTLKTPSGEETIECPEDTYILDAAEEAGLDLPYSCRAGACSSCAGKVESGEVDQSDQS 60

Query: 381 FLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           FLDD QM  G+VLTCVAYPTS+V I TH+E
Sbjct: 61  FLDDAQMGKGFVLTCVAYPTSDVTILTHQE 90



>gb:AF010320_1761149 Oryza sativa ferredoxin mRNA, complete cds.
          Length = 139

 Score =  109 bits (272), Expect = 4e-23
 Identities = 58/121 (47%), Positives = 76/121 (62%), Gaps = 3/121 (2%)
 Frame = +3

Query: 117 SLRAISNFRPAQLGLKSGNM---GRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEEL 287
           SLR  +   PA++ +   N     R+   A+Y VKL+TP G+ E   PD+V++LDQAEE 
Sbjct: 15  SLRVATAPAPARVSVLPANNKLGNRLRMQATYNVKLITPDGEVELQVPDNVFILDQAEEE 74

Query: 288 GADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHK 467
           G DLPY            KVVSG ++QSD +FL + Q+ AG+VLTC A P S+VVIETHK
Sbjct: 75  GIDLPYSCRAGSCSSCAGKVVSGEINQSDQNFLHNNQVAAGWVLTCHANPKSDVVIETHK 134

Query: 468 E 470
           E
Sbjct: 135 E 135



>gb:AF022186_1761922 Cyanidium caldarium strain RK1 chloroplast,
           complete genome.
          Length = 99

 Score =  108 bits (271), Expect = 6e-23
 Identities = 55/95 (57%), Positives = 63/95 (66%), Gaps = 2/95 (2%)
 Frame = +3

Query: 192 MASYKVKLVTPTG--DFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVD 365
           M SYKVKL       D E +CP+D Y+LD AEE G DLPY            K++SGTVD
Sbjct: 1   MTSYKVKLTNEKEGIDVEINCPNDQYILDAAEEQGIDLPYSCRAGACSTCAGKLISGTVD 60

Query: 366 QSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           QSD SFLDDEQ+  G+VLTCVAYPTSN  I TH+E
Sbjct: 61  QSDQSFLDDEQIKEGFVLTCVAYPTSNCTILTHQE 95



>pir|S08122|S08122 ferredoxin [2Fe-2S] I - Synechococcus
           sp.>gb:SYNPETF1_195545 Synechococcus petF1 gene for
           ferredoxin.>gb:ANFD_553398 Anacystis nidulans R2 (=
           Synechococcus PCC7942) ferredoxin
           gene.>gb:ANIPETF_553604 A.nidulans petF gene encoding
           ferredoxin I, complete cds.>gb:ANIPETF1A_553605
           A.nidulans ferredoxin (petF1) gene, complete
           cds.>gb:AP008231_582179 Synechococcus elongatus PCC 6301
           DNA, complete genome.
          Length = 99

 Score =  108 bits (271), Expect = 6e-23
 Identities = 57/95 (60%), Positives = 63/95 (66%), Gaps = 2/95 (2%)
 Frame = +3

Query: 192 MASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVD 365
           MA+YKV LV          D  DD Y+LD AEE G DLPY            KVVSGTVD
Sbjct: 1   MATYKVTLVNAAEGLNTTIDVADDTYILDAAEEQGIDLPYSCRAGACSTCAGKVVSGTVD 60

Query: 366 QSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           QSD SFLDD+Q+ AG+VLTCVAYPTS+V IETHKE
Sbjct: 61  QSDQSFLDDDQIAAGFVLTCVAYPTSDVTIETHKE 95



>sp|P00248|FER_MASLA Ferredoxin.>pir|A00252|FEMW ferredoxin [2Fe-2S]
           - Fischerella sp.
          Length = 98

 Score =  108 bits (271), Expect = 6e-23
 Identities = 54/94 (57%), Positives = 64/94 (68%), Gaps = 2/94 (2%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQ 368
           A+YKV L+          + PDD Y+LD AEE G DLPY            K++SGTVDQ
Sbjct: 1   ATYKVTLINEAEGLNKTIEVPDDQYILDAAEEAGIDLPYSCRAGACSTCAGKLISGTVDQ 60

Query: 369 SDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SD SFLDD+Q++AGYVLTCVAYPTS+ VIETHKE
Sbjct: 61  SDQSFLDDDQIEAGYVLTCVAYPTSDCVIETHKE 94



>gb:AY826848_1629154 Heterocapsa triquetra clone HTF2 chloroplast
           ferredoxin mRNA, complete cds; nuclear gene for
           chloroplast product.
          Length = 165

 Score =  108 bits (270), Expect = 8e-23
 Identities = 58/129 (44%), Positives = 80/129 (62%), Gaps = 1/129 (0%)
 Frame = +3

Query: 87  LSGKPAA-AGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFEFDCPDDVY 263
           +SG  AA A G+  AI + +PA+ G+           A + VKL TP G+  F+CP+DVY
Sbjct: 44  VSGSAAAPAFGAAPAIISAKPARPGVA----------AHFTVKLQTPDGEQSFECPEDVY 93

Query: 264 VLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTS 443
           +LDQAEE G +LPY            KV+ G++DQSD +FLD++Q  +G+ LTCV Y TS
Sbjct: 94  ILDQAEEEGIELPYSCRAGSCSSCAGKVIDGSIDQSDQAFLDEDQTGSGFCLTCVTYATS 153

Query: 444 NVVIETHKE 470
           +V I+TH E
Sbjct: 154 DVTIKTHCE 162



>pir|S69167|S69167 ferredoxin [2Fe-2S] C - Japanese radish
          Length = 96

 Score =  108 bits (270), Expect = 8e-23
 Identities = 53/92 (57%), Positives = 64/92 (69%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKVK +TP  D E +C +  YVLD AEE G DLPY            KVVSG+VDQSD
Sbjct: 1   AAYKVKFITPDEDKEVECDESEYVLDAAEESGIDLPYSCRAGACSSCAGKVVSGSVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDD+Q+  G+VLTC+A PTS+VVI TH+E
Sbjct: 61  QSFLDDDQVADGFVLTCIARPTSDVVIRTHQE 92



>sp|P06543|FER1_ANASP Ferredoxin I.
          Length = 98

 Score =  107 bits (268), Expect = 1e-22
 Identities = 54/94 (57%), Positives = 66/94 (70%), Gaps = 2/94 (2%)
 Frame = +3

Query: 195 ASYKVKLVTPTGD--FEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQ 368
           A++KV L+        E + PDD Y+LD AEE G DLP+            K+VSGTVDQ
Sbjct: 1   ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQ 60

Query: 369 SDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SD SFLDD+Q++AGYVLTCVAYPTS+VVI+THKE
Sbjct: 61  SDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKE 94



>pir|A25761|FEAI ferredoxin [2Fe-2S] - Anabaena
           variabilis>gb:ANAPETF1_553343 Anabaena petF1 gene for
           ferredoxin I.>gb:AVFD_583580 Anabaena variabilis
           ferredoxin gene.
          Length = 99

 Score =  107 bits (267), Expect = 2e-22
 Identities = 54/95 (56%), Positives = 65/95 (68%), Gaps = 2/95 (2%)
 Frame = +3

Query: 192 MASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVD 365
           MA++KV L+          D PDD Y+LD AEE G DLP+            K+VSGTVD
Sbjct: 1   MATFKVTLINEAEGTSNTIDVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVD 60

Query: 366 QSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           QSD SFLDD+Q++AGYVLTCVAYPTS+V I+THKE
Sbjct: 61  QSDQSFLDDDQIEAGYVLTCVAYPTSDVTIQTHKE 95



>sp|P00253|FER_NOSMU Ferredoxin.>pir|A00257|FENM ferredoxin [2Fe-2S]
           - Nostoc muscorum
          Length = 98

 Score =  107 bits (267), Expect = 2e-22
 Identities = 54/94 (57%), Positives = 66/94 (70%), Gaps = 2/94 (2%)
 Frame = +3

Query: 195 ASYKVKLVTPTGD--FEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQ 368
           A++KV L+        E + PDD Y+LD AEE G DLP+            K+VSGTVDQ
Sbjct: 1   ATFKVTLINEAEGTKHEIEVPDDEYILDAAEEEGYDLPFSCRAGACSTCAGKLVSGTVDQ 60

Query: 369 SDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SD SFLDD+Q++AGYVLTCVAYPTS+VVI+THKE
Sbjct: 61  SDQSFLDDDQIEAGYVLTCVAYPTSDVVIQTHKE 94



>sp|P09735|FER_MARPO Ferredoxin.>pir|A24126|FELV ferredoxin [2Fe-2S]
           - liverwort (Marchantia polymorpha)
          Length = 95

 Score =  107 bits (267), Expect = 2e-22
 Identities = 51/91 (56%), Positives = 61/91 (67%)
 Frame = +3

Query: 198 SYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDN 377
           ++KV L TPTG    D  DD Y+LD AEE G  LPY            KV +G VDQSD 
Sbjct: 1   TFKVTLNTPTGQSVIDVEDDEYILDAAEEAGLSLPYSCRAGACSSCAGKVTAGEVDQSDE 60

Query: 378 SFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SFLDD+QMD GYVLTC+AYPTS++ I+TH+E
Sbjct: 61  SFLDDDQMDEGYVLTCIAYPTSDLTIDTHQE 91



>sp|P00250|FER_APHSA Ferredoxin I.>pir|A00254|FEAH ferredoxin
           [2Fe-2S] I [validated] - Aphanothece sacrum
          Length = 96

 Score =  107 bits (266), Expect = 2e-22
 Identities = 53/92 (57%), Positives = 59/92 (64%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           ASYKV L TP GD     PDD Y+LD AEE G DLPY            K+VSG     D
Sbjct: 1   ASYKVTLKTPDGDNVITVPDDEYILDVAEEEGLDLPYSCRAGACSTCAGKLVSGPAPDED 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDD+Q+ AGY+LTCVAYPT + VIETHKE
Sbjct: 61  QSFLDDDQIQAGYILTCVAYPTGDCVIETHKE 92



>sp|P06517|FER1_SYNP7 Ferredoxin I.
          Length = 98

 Score =  107 bits (266), Expect = 2e-22
 Identities = 56/94 (59%), Positives = 62/94 (65%), Gaps = 2/94 (2%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQ 368
           A+YKV LV          D  DD Y+LD AEE G DLPY            KVVSGTVDQ
Sbjct: 1   ATYKVTLVNAAEGLNTTIDVADDTYILDAAEEQGIDLPYSCRAGACSTCAGKVVSGTVDQ 60

Query: 369 SDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SD SFLDD+Q+ AG+VLTCVAYPTS+V IETHKE
Sbjct: 61  SDQSFLDDDQIAAGFVLTCVAYPTSDVTIETHKE 94



>sp|P00252|FER1_NOSMU Ferredoxin I.>pir|A00256|FENM1M ferredoxin
           [2Fe-2S] I - Nostoc muscorum
          Length = 98

 Score =  107 bits (266), Expect = 2e-22
 Identities = 54/91 (59%), Positives = 63/91 (69%), Gaps = 1/91 (1%)
 Frame = +3

Query: 201 YKVKLVTPTG-DFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDN 377
           YKV LV   G +   D PDD Y+LD AE+ G DLPY            K+VSGTVDQSD 
Sbjct: 4   YKVTLVDQEGTETTIDVPDDEYILDIAEDQGLDLPYSCRAGACSTCAGKIVSGTVDQSDQ 63

Query: 378 SFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SFLDD+Q++ GYVLTCVAYPTS++ IETHKE
Sbjct: 64  SFLDDDQIEKGYVLTCVAYPTSDLKIETHKE 94



>sp|Q9TLW0|FER1_CYACA Ferredoxin.
          Length = 98

 Score =  107 bits (266), Expect = 2e-22
 Identities = 54/93 (58%), Positives = 62/93 (66%), Gaps = 2/93 (2%)
 Frame = +3

Query: 198 SYKVKLVTPTG--DFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQS 371
           SYKVKL       D E +CP+D Y+LD AEE G DLPY            K++SGTVDQS
Sbjct: 2   SYKVKLTNEKEGIDVEINCPNDQYILDAAEEQGIDLPYSCRAGACSTCAGKLISGTVDQS 61

Query: 372 DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           D SFLDDEQ+  G+VLTCVAYPTSN  I TH+E
Sbjct: 62  DQSFLDDEQIKEGFVLTCVAYPTSNCTILTHQE 94



>gb:LES270962_1684522 Lycopersicon esculentum partial mRNA for
           putative ferredoxin, clone mo5-10G1.
          Length = 98

 Score =  106 bits (265), Expect = 3e-22
 Identities = 52/91 (57%), Positives = 60/91 (65%), Gaps = 1/91 (1%)
 Frame = +3

Query: 201 YKVKLVTPTG-DFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDN 377
           YKVKLV P G + EF+ P D Y+LD AE  G DLPY            K+ SGTVDQSD 
Sbjct: 4   YKVKLVCPDGTEHEFEAPSDTYILDAAENAGVDLPYSCRAGACSTCAGKIESGTVDQSDG 63

Query: 378 SFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SFLDD Q+  GY+LTCV+YP S+ VI THKE
Sbjct: 64  SFLDDNQIKEGYLLTCVSYPNSDCVIHTHKE 94



>sp|P14936|FER1_RAPSA Ferredoxin, root R-B1.>pir|JX0084|JX0084
           ferredoxin [2Fe-2S] B1, root - radish
          Length = 98

 Score =  106 bits (265), Expect = 3e-22
 Identities = 53/93 (56%), Positives = 61/93 (65%), Gaps = 1/93 (1%)
 Frame = +3

Query: 195 ASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQS 371
           A YKVKL+ P G + EFD PDD Y+LD AEE G DLPY            K+  G VDQS
Sbjct: 2   AVYKVKLIGPDGQENEFDVPDDQYILDAAEEAGVDLPYSCRAGACSTCAGKIEKGQVDQS 61

Query: 372 DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           D SFL+D   + GYVLTCVAYP S++VI THKE
Sbjct: 62  DGSFLEDHHFEKGYVLTCVAYPQSDLVIHTHKE 94



>pir|S11048|FEKT1 ferredoxin [2Fe-2S] I - Cyanophora paradoxa
           cyanelle>gb:CHCPFDRP_1646579 Cyanophora paradoxa
           cyanelle petFI gene and rps10 gene for ferredoxin I and
           ribosomal protein S10.>gb:CPACYFPRFA_1648509 C.paradoxa
           cyanelle ferredoxin (petF) and ribosomal protein S10
           (rps10; rpsJ) genes, complete cds, and elongation factor
           Tu (tufA) gene, 5' end.>gb:CPU30821_1648804 Cyanophora
           paradoxa cyanelle, complete genome.
          Length = 99

 Score =  106 bits (264), Expect = 4e-22
 Identities = 53/95 (55%), Positives = 63/95 (66%), Gaps = 2/95 (2%)
 Frame = +3

Query: 192 MASYKVKLVTPTG--DFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVD 365
           MA YKV+L+      D   +CPDD Y+LD AEE G DLPY            KVV GTVD
Sbjct: 1   MAVYKVRLICEEQGLDTTIECPDDEYILDAAEEQGIDLPYSCRAGACSTCAGKVVEGTVD 60

Query: 366 QSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           QSD SFLDD Q+ AGYVLTCVAYP+S+  ++TH+E
Sbjct: 61  QSDQSFLDDAQLAAGYVLTCVAYPSSDCTVKTHQE 95



>gb:AF041468_1763601 Guillardia theta complete plastid genome.
          Length = 97

 Score =  105 bits (263), Expect = 5e-22
 Identities = 53/93 (56%), Positives = 61/93 (65%)
 Frame = +3

Query: 192 MASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQS 371
           MA+YKVKL     D   DCPDD Y+LD AEE G DLPY            KV +G+VDQS
Sbjct: 1   MATYKVKLSGEGVDKTIDCPDDQYILDAAEEQGIDLPYSCRAGACSTCAGKVAAGSVDQS 60

Query: 372 DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           D SFLDD Q+  G+VLTCVAYPTS+  I TH+E
Sbjct: 61  DQSFLDDSQIGDGFVLTCVAYPTSDCTILTHQE 93



>sp|P00245|FER_SPIMA Ferredoxin.>pir|A00249|FESG ferredoxin [2Fe-2S]
           - Spirulina maxima
          Length = 98

 Score =  105 bits (263), Expect = 5e-22
 Identities = 50/94 (53%), Positives = 63/94 (67%), Gaps = 2/94 (2%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQ 368
           A+YKV L++         DC DD Y+LD AEE G DLPY            K+ SG++DQ
Sbjct: 1   ATYKVTLISEAEGINETIDCDDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITSGSIDQ 60

Query: 369 SDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SD SFLDD+Q++AGYVLTCVAYPTS+  I+TH+E
Sbjct: 61  SDQSFLDDDQIEAGYVLTCVAYPTSDCTIQTHQE 94



>gb:OSJN00148_1695672 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0073L04, complete sequence.
          Length = 152

 Score =  105 bits (262), Expect = 6e-22
 Identities = 54/93 (58%), Positives = 61/93 (65%), Gaps = 1/93 (1%)
 Frame = +3

Query: 195 ASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQS 371
           A Y VKL+ P G +     P+D Y+LD AEE G DLPY            KVV G VDQS
Sbjct: 56  AVYTVKLIGPEGQESVIKVPEDTYILDAAEEAGVDLPYSCRAGACSTCAGKVVEGGVDQS 115

Query: 372 DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           D SFLDD Q+ AGYVLTCVAYPT+N VI+THKE
Sbjct: 116 DQSFLDDAQVGAGYVLTCVAYPTANSVIQTHKE 148



>gb:BX572093_796978 Prochlorococcus marinus MED4 complete genome;
           segment 4/5.
          Length = 99

 Score =  105 bits (262), Expect = 6e-22
 Identities = 52/95 (54%), Positives = 64/95 (67%), Gaps = 2/95 (2%)
 Frame = +3

Query: 192 MASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVD 365
           MASYKV L++ +       + PDD Y+LD AEE G DLPY            K+ SGTVD
Sbjct: 1   MASYKVTLISESEGLNSTIEVPDDQYILDAAEEQGVDLPYSCRAGACSTCAGKITSGTVD 60

Query: 366 QSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           QSD SFLDD+Q++AG+VLTCVAYP+S+V I TH E
Sbjct: 61  QSDQSFLDDDQLEAGFVLTCVAYPSSDVTITTHAE 95



>gb:AE017165_395889 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 5 of 6 of the complete
           genome.>gb:AE017126_1031558 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 99

 Score =  105 bits (262), Expect = 6e-22
 Identities = 53/95 (55%), Positives = 64/95 (67%), Gaps = 2/95 (2%)
 Frame = +3

Query: 192 MASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVD 365
           MASYKV LV+ +       + PDD Y+LD AEE G DLPY            K+ SG+VD
Sbjct: 1   MASYKVTLVSESEGLNQTIEVPDDQYILDAAEEQGIDLPYSCRAGACSTCAGKITSGSVD 60

Query: 366 QSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           QSD SFLDD+Q++AG+VLTCVAYPTS+V I TH E
Sbjct: 61  QSDQSFLDDDQLEAGFVLTCVAYPTSDVTITTHAE 95



>sp|P00254|FER1_ANAVA Ferredoxin I.
          Length = 98

 Score =  105 bits (262), Expect = 6e-22
 Identities = 53/94 (56%), Positives = 64/94 (68%), Gaps = 2/94 (2%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQ 368
           A++KV L+          D PDD Y+LD AEE G DLP+            K+VSGTVDQ
Sbjct: 1   ATFKVTLINEAEGTSNTIDVPDDEYILDAAEEQGYDLPFSCRAGACSTCAGKLVSGTVDQ 60

Query: 369 SDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SD SFLDD+Q++AGYVLTCVAYPTS+V I+THKE
Sbjct: 61  SDQSFLDDDQIEAGYVLTCVAYPTSDVTIQTHKE 94



>gb:AP003287_1827314 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0679C12.>gb:AP003794_1833472 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0489B03.
          Length = 165

 Score =  104 bits (260), Expect = 1e-21
 Identities = 57/116 (49%), Positives = 70/116 (60%), Gaps = 6/116 (5%)
 Frame = +3

Query: 141 RPAQLGLKSGNMG-----RMTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELGADLP 302
           RP  L L SG        R +  A +KVKL+ P G + E + P+D YVLD AEE G +LP
Sbjct: 46  RPGNLQLTSGGARFSGRFRASAAAVHKVKLIGPDGAESELEVPEDTYVLDAAEEAGLELP 105

Query: 303 YXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           Y            K+ SG VDQSD SFL DEQ++ GYVLTC++YP S+ VI THKE
Sbjct: 106 YSCRAGSCSTCAGKLASGEVDQSDGSFLADEQIEQGYVLTCISYPKSDCVIYTHKE 161



>sp|P22341|FER_EUGVI Ferredoxin.>pir|S15425|S15425 ferredoxin
           [2Fe-2S] - Euglena viridis
          Length = 96

 Score =  104 bits (260), Expect = 1e-21
 Identities = 49/92 (53%), Positives = 58/92 (63%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+Y VKL+ P G+   +C +D Y+LD AE+ G DLPY             V  GTVDQSD
Sbjct: 1   ATYSVKLINPDGEVTIECGEDQYILDAAEDAGIDLPYSCRAGACSSCTGIVKEGTVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDD+QM  G+ LTC  YPTSN  IETHKE
Sbjct: 61  QSFLDDDQMAKGFCLTCTTYPTSNCTIETHKE 92



>gb:BX569690_775437 Synechococcus sp. WH8102 complete genome;
           segment 2/7.
          Length = 99

 Score =  104 bits (259), Expect = 1e-21
 Identities = 52/95 (54%), Positives = 64/95 (67%), Gaps = 2/95 (2%)
 Frame = +3

Query: 192 MASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVD 365
           MASYKV LV+ +       + PDD Y+LD AEE G DLPY            K+ +GTVD
Sbjct: 1   MASYKVTLVSESEGLNKTIEVPDDQYILDAAEEQGIDLPYSCRAGACSTCAGKITAGTVD 60

Query: 366 QSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           QSD SFLDD+Q++AG+VLTCVAYPTS+  I+TH E
Sbjct: 61  QSDQSFLDDDQIEAGFVLTCVAYPTSDCTIKTHAE 95



>sp|P00246|FER_SPIPL Ferredoxin.>pir|A00250|FESGAL ferredoxin
           [2Fe-2S] [validated] - Spirulina platensis
          Length = 98

 Score =  104 bits (259), Expect = 1e-21
 Identities = 50/94 (53%), Positives = 61/94 (64%), Gaps = 2/94 (2%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQ 368
           A+YKV L+          DC DD Y+LD AEE G DLPY             + SGT+DQ
Sbjct: 1   ATYKVTLINEAEGINETIDCDDDTYILDAAEEAGLDLPYSCRAGACSTCAGTITSGTIDQ 60

Query: 369 SDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SD SFLDD+Q++AGYVLTCVAYPTS+  I+TH+E
Sbjct: 61  SDQSFLDDDQIEAGYVLTCVAYPTSDCTIKTHQE 94



>sp|P17007|FER1_CYAPA Ferredoxin I.
          Length = 98

 Score =  104 bits (259), Expect = 1e-21
 Identities = 52/94 (55%), Positives = 62/94 (65%), Gaps = 2/94 (2%)
 Frame = +3

Query: 195 ASYKVKLVTPTG--DFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQ 368
           A YKV+L+      D   +CPDD Y+LD AEE G DLPY            KVV GTVDQ
Sbjct: 1   AVYKVRLICEEQGLDTTIECPDDEYILDAAEEQGIDLPYSCRAGACSTCAGKVVEGTVDQ 60

Query: 369 SDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SD SFLDD Q+ AGYVLTCVAYP+S+  ++TH+E
Sbjct: 61  SDQSFLDDAQLAAGYVLTCVAYPSSDCTVKTHQE 94



>sp|O78510|FER_GUITH Ferredoxin.
          Length = 96

 Score =  103 bits (258), Expect = 2e-21
 Identities = 52/92 (56%), Positives = 60/92 (65%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKVKL     D   DCPDD Y+LD AEE G DLPY            KV +G+VDQSD
Sbjct: 1   ATYKVKLSGEGVDKTIDCPDDQYILDAAEEQGIDLPYSCRAGACSTCAGKVAAGSVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDD Q+  G+VLTCVAYPTS+  I TH+E
Sbjct: 61  QSFLDDSQIGDGFVLTCVAYPTSDCTILTHQE 92



>sp|P00247|FER_CHLFR Ferredoxin.>pir|A00251|FEEF ferredoxin [2Fe-2S]
           - Chlorogloeopsis fritschii
          Length = 98

 Score =  103 bits (258), Expect = 2e-21
 Identities = 52/94 (55%), Positives = 61/94 (64%), Gaps = 2/94 (2%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQ 368
           A+YKV L+          +  DD Y+LD AEE G DLPY            K+ SGTVDQ
Sbjct: 1   ATYKVTLINDAEGLNQTIEVDDDTYILDAAEEAGLDLPYSCRAGACSTCAGKIKSGTVDQ 60

Query: 369 SDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SD SFLDD+Q++AGYVLTCVAYPTS+  IETHKE
Sbjct: 61  SDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKE 94



>pir|A00243|FEDH1 ferredoxin [2Fe-2S] I - green alga (Dunaliella
           salina)  (tentative sequence)
          Length = 95

 Score =  103 bits (256), Expect = 3e-21
 Identities = 51/91 (56%), Positives = 61/91 (67%)
 Frame = +3

Query: 198 SYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDN 377
           SY V L TP+G+ + +   D Y+LD AEE G DLPY            KV SGTVDQSD 
Sbjct: 1   SYMVTLKTPSGEQKVEVSPDSYILDAAEEAGVDLPYSCRAGSCSSCAGKVESGTVDQSDQ 60

Query: 378 SFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SFLDD+QMD+G+VLTCVAY TS+  I TH+E
Sbjct: 61  SFLDDDQMDSGFVLTCVAYATSDCTIVTHQE 91



>sp|P00241|FER3_CYACA Ferredoxin.>pir|A00245|FEKK ferredoxin
           [2Fe-2S] - red alga (Cyanidium caldarium)
          Length = 98

 Score =  103 bits (256), Expect = 3e-21
 Identities = 52/94 (55%), Positives = 61/94 (64%), Gaps = 2/94 (2%)
 Frame = +3

Query: 195 ASYKVKLVTPTG--DFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQ 368
           ASYK+ LV      D   +CPDD Y+LD AEE G DLPY            K++ G VDQ
Sbjct: 1   ASYKIHLVNKDQGIDETIECPDDQYILDAAEEQGLDLPYSCRAGACSTCAGKLLEGEVDQ 60

Query: 369 SDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SD SFLDD+Q+ AG+VLTCVAYPTSN  I TH+E
Sbjct: 61  SDQSFLDDDQVKAGFVLTCVAYPTSNATILTHQE 94



>sp|P00239|FER1_DUNSA Ferredoxin I.
          Length = 95

 Score =  103 bits (256), Expect = 3e-21
 Identities = 51/91 (56%), Positives = 61/91 (67%)
 Frame = +3

Query: 198 SYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDN 377
           SY V L TP+G+ + +   D Y+LD AEE G DLPY            KV SGTVDQSD 
Sbjct: 1   SYMVTLKTPSGEQKVEVSPDSYILDAAEEAGVDLPYSCRAGSCSSCAGKVESGTVDQSDQ 60

Query: 378 SFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SFLDD+QMD+G+VLTCVAY TS+  I TH+E
Sbjct: 61  SFLDDDQMDSGFVLTCVAYATSDCTIVTHQE 91



>pir|JA0098|JA0098 ferredoxin [2Fe-2S] - Synechococcus sp.
          Length = 98

 Score =  102 bits (254), Expect = 5e-21
 Identities = 52/94 (55%), Positives = 62/94 (65%), Gaps = 2/94 (2%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQ 368
           ASYKV LV  +       + PDD Y+LD AEE G DLPY            K+ SGTVDQ
Sbjct: 1   ASYKVTLVNESEGLNKTIEVPDDQYILDAAEEQGIDLPYSCRAGACSTCAGKLTSGTVDQ 60

Query: 369 SDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SD SFLDD+Q++AG+VLTCVAYPTS+  I+TH E
Sbjct: 61  SDQSFLDDDQIEAGFVLTCVAYPTSDCTIKTHTE 94



>sp|P00234|FER1_EQUTE Ferredoxin I.>pir|A00240|FEEQ1 ferredoxin
           [2Fe-2S] I - horsetail (Equisetum telmateia)
          Length = 95

 Score =  102 bits (254), Expect = 5e-21
 Identities = 49/91 (53%), Positives = 62/91 (68%)
 Frame = +3

Query: 198 SYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDN 377
           +YK  L TP+G+F  D P+   +LD AEE G DLP+            KVVSG+VDQS+ 
Sbjct: 1   AYKTVLKTPSGEFTLDVPEGTTILDAAEEAGYDLPFSCRAGACSSCLGKVVSGSVDQSEG 60

Query: 378 SFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SFLDD QM+ G+VLTC+A P S++VIETHKE
Sbjct: 61  SFLDDGQMEEGFVLTCIAIPESDLVIETHKE 91



>pir|T03742|T03742 ferredoxin [2Fe-2S], root -
           rice>gb:RICFERRA_1703610 Oryza sativa (japonica
           cultivar-group) gene for ferredoxin, complete
           cds.>gb:AC137611_1743532 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBa0020H14,
           complete sequence.>gb:AC147462_1744727 Oryza sativa
           (japonica cultivar-group) chromosome 5 clone B1110B01,
           complete sequence.
          Length = 148

 Score =  102 bits (253), Expect = 7e-21
 Identities = 49/106 (46%), Positives = 68/106 (64%), Gaps = 1/106 (0%)
 Frame = +3

Query: 156 GLKSGNMGRMTCMASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXX 332
           GL+  N  R++  A +KVKL+ P G + EF+ P+D Y+L+ AE  G +LP+         
Sbjct: 39  GLRISNKFRVSATAVHKVKLIGPDGVEHEFEAPEDTYILEAAETAGVELPFSCRAGSCST 98

Query: 333 XXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
              K+ SG VDQS+ SFLD+ QM  GYVLTC++YP ++ VI THKE
Sbjct: 99  CAGKMSSGEVDQSEGSFLDENQMGEGYVLTCISYPKADCVIHTHKE 144



>gb:BX572099_798771 Prochlorococcus marinus MIT9313 complete genome;
           segment 5/7.
          Length = 99

 Score =  101 bits (252), Expect = 9e-21
 Identities = 50/95 (52%), Positives = 63/95 (66%), Gaps = 2/95 (2%)
 Frame = +3

Query: 192 MASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVD 365
           MASYKV L++ +       + PDD Y+LD AEE G DLPY            K+  G+VD
Sbjct: 1   MASYKVTLISESEGLNKTIEVPDDQYILDAAEEQGIDLPYSCRAGACSTCAGKLTGGSVD 60

Query: 366 QSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           QSD SFLDD+Q++AG+VLTCVAYPTS+  I+TH E
Sbjct: 61  QSDQSFLDDDQLEAGFVLTCVAYPTSDCTIKTHAE 95



>sp|Q51577|FER1_PLEBO Ferredoxin I (FdI).>gb:AB017194_3192
           Plectonema boryanum ORF270, proline iminopeptidase,
           ferredoxin and amidase enhancer genes, complete and
           partial cds.>gb:PBU33848_157401 Plectonema boryanum
           ferredoxin 1 (petF1) gene, complete cds.
          Length = 99

 Score =  101 bits (252), Expect = 9e-21
 Identities = 51/95 (53%), Positives = 61/95 (64%), Gaps = 2/95 (2%)
 Frame = +3

Query: 192 MASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVD 365
           M S+KV L+  T       + PDD Y+LD AEE G DLPY            K+ +GTVD
Sbjct: 1   MPSFKVTLINETEGLNTTIEVPDDEYILDAAEEQGIDLPYSCRAGACSTCAGKITAGTVD 60

Query: 366 QSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           QSD SFLDD+Q+ AGYVLTCVAYPTS+  I TH+E
Sbjct: 61  QSDQSFLDDDQIQAGYVLTCVAYPTSDCTILTHQE 95



>sp|P00235|FER1_EQUAR Ferredoxin I.>pir|A04609|FEEQ1F ferredoxin
           [2Fe-2S] I [validated] - field horsetail
          Length = 95

 Score =  101 bits (251), Expect = 1e-20
 Identities = 48/91 (52%), Positives = 62/91 (68%)
 Frame = +3

Query: 198 SYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDN 377
           +YK  L TP+G+F  D P+   +LD AEE G DLP+            KVVSG+VD+S+ 
Sbjct: 1   AYKTVLKTPSGEFTLDVPEGTTILDAAEEAGYDLPFSCRAGACSSCLGKVVSGSVDESEG 60

Query: 378 SFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SFLDD QM+ G+VLTC+A P S++VIETHKE
Sbjct: 61  SFLDDGQMEEGFVLTCIAIPESDLVIETHKE 91



>gb:AY596491_1616756 Helicosporidium sp. ex Simulium jonesii plastid
           ferredoxin mRNA, complete cds; nuclear gene for plastid
           product.
          Length = 140

 Score =  100 bits (250), Expect = 2e-20
 Identities = 52/109 (47%), Positives = 66/109 (60%), Gaps = 1/109 (0%)
 Frame = +3

Query: 147 AQLGLKSGNMGRMTCMASYKVKLVTPTGDFE-FDCPDDVYVLDQAEELGADLPYXXXXXX 323
           +QL   S  +      ASYK+    P  + E  + P+D Y+LD A++ G DLPY      
Sbjct: 28  SQLRYLSAPVRHQKVRASYKITFKMPENEEETIEAPEDQYILDAADDAGLDLPYSCRSGT 87

Query: 324 XXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
                 +VV G+VDQSD SFLDD+QM  GY L CVAYPTS++VIETHKE
Sbjct: 88  CSTCLGRVVEGSVDQSDQSFLDDDQMGKGYSLLCVAYPTSDLVIETHKE 136



>gb:AF486634_1804177 Triticum aestivum ferredoxin precursor, mRNA,
           complete cds.
          Length = 151

 Score =  100 bits (249), Expect = 2e-20
 Identities = 49/125 (39%), Positives = 74/125 (59%), Gaps = 1/125 (0%)
 Frame = +3

Query: 99  PAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGD-FEFDCPDDVYVLDQ 275
           PA    S    +   P    L+  N  R++  A +KVKL++P G+  EF+ P+D Y+L+ 
Sbjct: 23  PAIRSASFIGYAKQPPNLSCLRMSNKFRVSAAAVHKVKLISPDGEEHEFEAPEDTYILEA 82

Query: 276 AEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVI 455
           AE  G +LP+            K+ +G VDQS+ SFLD+ QM  GY+LTC++YP ++ VI
Sbjct: 83  AENAGVELPFSCRAGSCSTCAGKMTTGEVDQSEGSFLDENQMGEGYLLTCISYPKADCVI 142

Query: 456 ETHKE 470
           +TH+E
Sbjct: 143 QTHQE 147



>gb:AF049491_1764042 Thalassiosira weissflogii cytochrome c-550
           (psbV) gene, partial cds; tRNA-Arg, tmRNA and tRNA-Met
           genes, complete sequence; and ribosomal protein L19
           (rpL19) and 2 Fe-2 S ferredoxin (petF) genes, complete
           cds, chloroplast genes for chloroplast products.
          Length = 99

 Score =  100 bits (248), Expect = 3e-20
 Identities = 49/95 (51%), Positives = 61/95 (64%), Gaps = 2/95 (2%)
 Frame = +3

Query: 192 MASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVD 365
           MA+YKV L++   D     DC DDV+VLD AEE G DLPY            KV  GT+D
Sbjct: 1   MATYKVTLISEEHDINTTIDCNDDVFVLDAAEEAGIDLPYSCRAGACSTCAGKVTEGTID 60

Query: 366 QSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           QS+ +FLDD+QM AG+VLTC+AYP S+  I  H+E
Sbjct: 61  QSEQTFLDDDQMGAGFVLTCIAYPKSDCTILVHQE 95



>pir|A00239|FEFNG ferredoxin [2Fe-2S] - fern (Gleichenia japonica)
           (tentative sequence)
          Length = 95

 Score =  100 bits (248), Expect = 3e-20
 Identities = 46/92 (50%), Positives = 59/92 (64%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A +KVK +TP G+   + PDD ++LD  EE G DLPY            K++ G VDQS+
Sbjct: 1   AIFKVKFLTPDGERTIEVPDDKFILDAGEEAGLDLPYSCRAGACSSCTGKLLDGRVDQSE 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDD+QM  G+VLTCVAYP  ++ IETH E
Sbjct: 61  QSFLDDDQMAEGFVLTCVAYPAGDITIETHAE 92



>sp|P00255|FER_SYNLI Ferredoxin.>pir|A00258|FEYCAL ferredoxin
           [2Fe-2S] - Synechococcus lividus
          Length = 96

 Score =  100 bits (248), Expect = 3e-20
 Identities = 48/92 (52%), Positives = 61/92 (66%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+YKV LV P G+   D P+D Y+LD AEE G DLP+            K++ G VDQSD
Sbjct: 1   ATYKVTLVRPDGETTIDVPEDEYILDVAEEQGLDLPFSCRAGACSTCAGKLLEGEVDQSD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDD+Q++ G+VLTCVAYP S+  I TH+E
Sbjct: 61  QSFLDDDQIEKGFVLTCVAYPRSDCKILTHQE 92



>sp|P10770|FER_PERBI Ferredoxin.>pir|A30036|FEDQ ferredoxin [2Fe-2S]
           - dinoflagellate (Peridinium bipes)
          Length = 93

 Score =  100 bits (248), Expect = 3e-20
 Identities = 47/90 (52%), Positives = 60/90 (66%)
 Frame = +3

Query: 201 YKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNS 380
           +KV L TP G   F+CP D Y+LD+AEE G +LPY            KV++G++DQSD +
Sbjct: 1   FKVTLDTPDGKKSFECPGDSYILDKAEEEGLELPYSCRAGSCSSCAGKVLTGSIDQSDQA 60

Query: 381 FLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           FLDD+Q   GY LTCV YPTS+V I+TH E
Sbjct: 61  FLDDDQGGDGYCLTCVTYPTSDVTIKTHCE 90



>sp|P00233|FER_GLEJA Ferredoxin.
          Length = 95

 Score =  100 bits (248), Expect = 3e-20
 Identities = 46/92 (50%), Positives = 59/92 (64%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A +KVK +TP G+   + PDD ++LD  EE G DLPY            K++ G VDQS+
Sbjct: 1   AIFKVKFLTPDGERTIEVPDDKFILDAGEEAGLDLPYSCRAGACSSCTGKLLDGRVDQSE 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDD+QM  G+VLTCVAYP  ++ IETH E
Sbjct: 61  QSFLDDDQMAEGFVLTCVAYPAGDITIETHAE 92



>pir|A00244|FEDH2 ferredoxin [2Fe-2S] II - green alga (Dunaliella
           salina)  (tentative sequence)
          Length = 95

 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 48/91 (52%), Positives = 58/91 (63%)
 Frame = +3

Query: 198 SYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDN 377
           +YKV L TP+GD   +   D Y+LD AEE G DLPY            KV +GT+DQSD 
Sbjct: 1   AYKVTLKTPSGDQTIEVSPDAYILDAAEEAGLDLPYSCRAGACSSCAGKVEAGTIDQSDQ 60

Query: 378 SFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SFLDD+Q   G+VLTCVAY TS+  I TH+E
Sbjct: 61  SFLDDDQQGRGFVLTCVAYATSDCTISTHQE 91



>sp|P00240|FER2_DUNSA Ferredoxin II.
          Length = 95

 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 48/91 (52%), Positives = 58/91 (63%)
 Frame = +3

Query: 198 SYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDN 377
           +YKV L TP+GD   +   D Y+LD AEE G DLPY            KV +GT+DQSD 
Sbjct: 1   AYKVTLKTPSGDQTIEVSPDAYILDAAEEAGLDLPYSCRAGACSSCAGKVEAGTIDQSDQ 60

Query: 378 SFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SFLDD+Q   G+VLTCVAY TS+  I TH+E
Sbjct: 61  SFLDDDQQGRGFVLTCVAYATSDCTISTHQE 91



>sp|P15789|FER2_CYACA Ferredoxin.
          Length = 97

 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 48/92 (52%), Positives = 62/92 (67%), Gaps = 2/92 (2%)
 Frame = +3

Query: 201 YKVKLVTPTG--DFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           YK++LV      D   +CP D Y+LD AEE G DLPY            K+V G+VDQSD
Sbjct: 2   YKIQLVNQKEGVDVTINCPGDQYILDAAEEQGVDLPYSCRAGACSTCAGKLVKGSVDQSD 61

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLD+EQ++ G++LTCVAYPTS+ VI+TH+E
Sbjct: 62  QSFLDEEQINNGFILTCVAYPTSDCVIQTHQE 93



>sp|P00242|FER_PORUM Ferredoxin.>pir|A00246|FEPRU ferredoxin
           [2Fe-2S] - red alga (Porphyra umbilicalis)
          Length = 98

 Score = 99.0 bits (245), Expect = 6e-20
 Identities = 51/94 (54%), Positives = 58/94 (61%), Gaps = 2/94 (2%)
 Frame = +3

Query: 195 ASYKVKLVTPTG--DFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQ 368
           A YK+ LV+     D  FDC +D Y+LD AEE G +LPY            KV  GTVDQ
Sbjct: 1   ADYKIHLVSKEEGIDVTFDCSEDTYILDAAEEEGIELPYSCRAGACSTCAGKVTEGTVDQ 60

Query: 369 SDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SD SFLDDEQM  GYVLTC+AYP S+  I TH E
Sbjct: 61  SDQSFLDDEQMLKGYVLTCIAYPESDCTILTHVE 94



>pir|JA0099|JA0099 ferredoxin [2Fe-2S] - Ochromonas danica
          Length = 98

 Score = 98.6 bits (244), Expect = 8e-20
 Identities = 47/94 (50%), Positives = 62/94 (65%), Gaps = 2/94 (2%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQ 368
           A YKV+L+  + + +   DCPDD ++L+ AE+   +LPY            K+  GTVDQ
Sbjct: 1   AKYKVRLLNNSHNLDTIIDCPDDKFILEAAEDNNIELPYSCRAGSCSTCLGKITKGTVDQ 60

Query: 369 SDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SD SFLDDEQ+  G+VLTCVAYPTS+V I TH+E
Sbjct: 61  SDQSFLDDEQIQEGFVLTCVAYPTSDVTISTHEE 94



>sp|O98450|FER_THAWE Ferredoxin.
          Length = 98

 Score = 98.2 bits (243), Expect = 1e-19
 Identities = 48/94 (51%), Positives = 60/94 (63%), Gaps = 2/94 (2%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQ 368
           A+YKV L++   D     DC DDV+VLD AEE G DLPY            KV  GT+DQ
Sbjct: 1   ATYKVTLISEEHDINTTIDCNDDVFVLDAAEEAGIDLPYSCRAGACSTCAGKVTEGTIDQ 60

Query: 369 SDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           S+ +FLDD+QM AG+VLTC+AYP S+  I  H+E
Sbjct: 61  SEQTFLDDDQMGAGFVLTCIAYPKSDCTILVHQE 94



>sp|P14937|FER2_RAPSA Ferredoxin, root R-B2.>pir|JX0083|JX0083
           ferredoxin [2Fe-2S] B2, root - radish
          Length = 98

 Score = 98.2 bits (243), Expect = 1e-19
 Identities = 48/93 (51%), Positives = 61/93 (65%), Gaps = 1/93 (1%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDF-EFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQS 371
           A YKVKL+ P G+  EF+  DD ++LD AEE G DLPY            ++V G VDQS
Sbjct: 2   AVYKVKLIGPEGEENEFEVQDDQFILDAAEEAGVDLPYSCRAGACSTCAGQIVKGQVDQS 61

Query: 372 DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           + SFL+D+  + G+VLTCVAYP S+ VI THKE
Sbjct: 62  EGSFLEDDHFEKGFVLTCVAYPQSDCVIHTHKE 94



>pir|S73241|S73241 ferredoxin [2Fe-2S] petF - red alga (Porphyra
           purpurea) chloroplast>gb:PPU38804_1701636 Porphyra
           purpurea chloroplast, complete genome.
          Length = 99

 Score = 97.8 bits (242), Expect = 1e-19
 Identities = 49/95 (51%), Positives = 59/95 (62%), Gaps = 2/95 (2%)
 Frame = +3

Query: 192 MASYKVKLVTPTG--DFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVD 365
           MA YK+ L++     D  FDC +D Y+LD AEE G +LPY            KV  G+VD
Sbjct: 1   MADYKIHLLSEDEGIDVTFDCSEDTYILDAAEEAGIELPYSCRAGACSTCAGKVTEGSVD 60

Query: 366 QSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           QSD SFLDDEQ+  GYVLTC+AYP S+  I TH E
Sbjct: 61  QSDQSFLDDEQLLKGYVLTCIAYPESDCTILTHVE 95



>gb:AF012533_468659 Cyanothece PCC8801 plant-type [2Fe-2S]
           ferredoxin (petF1) gene, complete cds.
          Length = 99

 Score = 97.4 bits (241), Expect = 2e-19
 Identities = 50/95 (52%), Positives = 61/95 (64%), Gaps = 2/95 (2%)
 Frame = +3

Query: 192 MASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVD 365
           MA+YKV L+          D P+D Y+LD AEE G DLP             K+V+GTVD
Sbjct: 1   MATYKVTLINEQEGINATIDVPEDEYILDAAEEQGIDLPSSCRAGACSTCAGKLVTGTVD 60

Query: 366 QSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           QSD SFLDD+Q+ AG+VLTCVAYP S+  IETH+E
Sbjct: 61  QSDQSFLDDDQVAAGFVLTCVAYPKSDCTIETHQE 95



>gb:AY058106_1564245 Arabidopsis thaliana At1g10960/T19D16_12 mRNA,
           complete cds.>gb:AY127948_1580491 Arabidopsis thaliana
           At1g10960/T19D16_12 mRNA, complete cds.
          Length = 118

 Score = 95.9 bits (237), Expect = 5e-19
 Identities = 56/118 (47%), Positives = 72/118 (61%), Gaps = 3/118 (2%)
 Frame = +3

Query: 48  ATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQL-GLKSGNM--GRMTCMASYKVKLV 218
           +T  + +++STSFL  +      SLR++       L GLKS     GR+T MA+YKVK +
Sbjct: 3   STALSSAIVSTSFLRRQQTPI--SLRSLPFANTQSLFGLKSSTARGGRVTAMATYKVKFI 60

Query: 219 TPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDD 392
           TP G+ E +C +DVYVLD AEE G DLPY            KVVSG++DQSD SFLDD
Sbjct: 61  TPEGEQEVECEEDVYVLDAAEEAGLDLPYSCRAGSCSSCAGKVVSGSIDQSDQSFLDD 118



>gb:AY267629_1314452 Bigelowiella natans ferredoxin 2 mRNA, partial
           cds; nuclear gene for plastid product.
          Length = 172

 Score = 95.9 bits (237), Expect = 5e-19
 Identities = 61/152 (40%), Positives = 84/152 (55%), Gaps = 10/152 (6%)
 Frame = +3

Query: 45  MATLSAGSMMSTSFLSGKPAAAGGSLRAISNFRPAQLGLK-------SGNMGRMTCMAS- 200
           + TLS+ S +S    SG   +   S  ++S+FR + L L+       SG M R     + 
Sbjct: 21  VVTLSSSSSLS----SGLARSRISSRSSLSSFR-SPLSLQNRVCHQASGTMARRGVSVNG 75

Query: 201 --YKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
             YKV L TP GD E +CPDD+Y+LD+AE  G  LPY             +  GTVDQSD
Sbjct: 76  QTYKVTLKTPGGDHEIECPDDMYILDKAEMDGIALPYSCRAGFCISCAGIMEDGTVDQSD 135

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            +FL+++Q+  G VLTC A PTS++ + TH E
Sbjct: 136 QTFLNEDQVKQGIVLTCFARPTSDMTVRTHVE 167



>sp|P51320|FER_PORPU Ferredoxin.
          Length = 98

 Score = 95.9 bits (237), Expect = 5e-19
 Identities = 48/94 (51%), Positives = 58/94 (61%), Gaps = 2/94 (2%)
 Frame = +3

Query: 195 ASYKVKLVTPTG--DFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQ 368
           A YK+ L++     D  FDC +D Y+LD AEE G +LPY            KV  G+VDQ
Sbjct: 1   ADYKIHLLSEDEGIDVTFDCSEDTYILDAAEEAGIELPYSCRAGACSTCAGKVTEGSVDQ 60

Query: 369 SDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SD SFLDDEQ+  GYVLTC+AYP S+  I TH E
Sbjct: 61  SDQSFLDDEQLLKGYVLTCIAYPESDCTILTHVE 94



>sp|P13106|FER_BUMFI Ferredoxin.>pir|A28857|FEBF2 ferredoxin
           [2Fe-2S] - yellow-green alga (Bumilleriopsis filiformis)
          Length = 98

 Score = 95.5 bits (236), Expect = 7e-19
 Identities = 46/93 (49%), Positives = 60/93 (64%), Gaps = 2/93 (2%)
 Frame = +3

Query: 198 SYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQS 371
           +Y V LV    +      CPDD ++LD AEE G +LPY            KV+SGT+DQS
Sbjct: 2   TYSVTLVNEEKNINAVIKCPDDQFILDAAEEQGIELPYSCRAGACSTCAGKVLSGTIDQS 61

Query: 372 DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           + SFLDD+QM AG++LTCVAYPTS+  ++TH E
Sbjct: 62  EQSFLDDDQMGAGFLLTCVAYPTSDCKVQTHAE 94



>gb:AB002583_1508884 Cyanidioschyzon merolae chloroplast DNA,
           complete genome, strain:10D.
          Length = 97

 Score = 95.1 bits (235), Expect = 9e-19
 Identities = 46/92 (50%), Positives = 59/92 (64%), Gaps = 2/92 (2%)
 Frame = +3

Query: 201 YKVKLVTPTG--DFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           YK++LV      D    C  D Y+LD AEE G DLPY            K+V G+VDQSD
Sbjct: 2   YKIQLVNQKEGIDVTIQCAGDQYILDAAEEQGVDLPYSCRAGACSTCAGKLVKGSVDQSD 61

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLD++Q+  G++LTCVAYPTS+ VI+TH+E
Sbjct: 62  QSFLDEDQISKGFILTCVAYPTSDCVIQTHQE 93



>gb:BX569692_776245 Synechococcus sp. WH8102 complete genome;
           segment 4/7.
          Length = 93

 Score = 94.7 bits (234), Expect = 1e-18
 Identities = 46/93 (49%), Positives = 60/93 (64%)
 Frame = +3

Query: 192 MASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQS 371
           MASYK+ +    G   F+C DDVY+LD AEE G DLPY            KV+SG+VDQ+
Sbjct: 1   MASYKISI---EGGSTFECADDVYILDAAEEAGVDLPYSCRAGACSTCAGKVLSGSVDQT 57

Query: 372 DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           D SFLDD+Q+  G+ L CV+YPTS+  I+ + E
Sbjct: 58  DQSFLDDDQIGQGFALLCVSYPTSDCSIKANAE 90



>gb:D85608_120679 Synechococcus vulcanus gene for ferredoxin I,
           complete cds.>gb:SEY10288_182643 S.elongatus petF1
           gene.>gb:BA000039_726793 Thermosynechococcus elongatus
           BP-1 DNA, complete genome.
          Length = 98

 Score = 94.7 bits (234), Expect = 1e-18
 Identities = 48/94 (51%), Positives = 62/94 (65%), Gaps = 1/94 (1%)
 Frame = +3

Query: 192 MASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQ 368
           MA+YKV LV P G +   D P+D Y+LD AEE G DLP+            K++ G VDQ
Sbjct: 1   MATYKVTLVRPDGSETTIDVPEDEYILDVAEEQGLDLPFSCRAGACSTCAGKLLEGEVDQ 60

Query: 369 SDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SD SFLDD+Q++ G+VLTCVAYP S+  I T++E
Sbjct: 61  SDQSFLDDDQIEKGFVLTCVAYPRSDCKILTNQE 94



>sp|P15788|FER_SYNP4 Ferredoxin.>pir|A28858|A28858 ferredoxin
           [2Fe-2S] - Synechococcus sp.
          Length = 98

 Score = 94.7 bits (234), Expect = 1e-18
 Identities = 48/94 (51%), Positives = 58/94 (61%), Gaps = 2/94 (2%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQ 368
           ASYKV L+          + PDD Y+LD AEE G DLPY            K+  G +DQ
Sbjct: 1   ASYKVTLINEEMGLNETIEVPDDEYILDVAEEEGIDLPYSCRAGACSTCAGKIKEGEIDQ 60

Query: 369 SDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SD SFLDD+Q++AGYVLTCVAYP S+  I TH+E
Sbjct: 61  SDQSFLDDDQIEAGYVLTCVAYPASDCTIITHQE 94



>sp|P07838|FER_BRYMA Ferredoxin.>pir|S07452|FEYO ferredoxin [2Fe-2S]
           - green alga (Bryopsis maxima)
          Length = 98

 Score = 94.4 bits (233), Expect = 1e-18
 Identities = 47/93 (50%), Positives = 60/93 (64%), Gaps = 1/93 (1%)
 Frame = +3

Query: 195 ASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQS 371
           ASYKV L    G +   DC +D ++LD AEE G D+P+            K+  GTVDQS
Sbjct: 1   ASYKVTLKLDDGSEAVIDCDEDSFILDVAEEEGIDIPFSCRSGSCSTCAGKIEGGTVDQS 60

Query: 372 DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           + +FLDD+QM+ GYVLTCVAYPTS+  I TH+E
Sbjct: 61  EQTFLDDDQMEEGYVLTCVAYPTSDCTILTHQE 93



>sp|P00236|FER2_EQUTE Ferredoxin II.>pir|A00241|FEEQ2 ferredoxin
           [2Fe-2S] II - horsetail (Equisetum telmateia)
          Length = 93

 Score = 94.4 bits (233), Expect = 1e-18
 Identities = 50/91 (54%), Positives = 59/91 (64%)
 Frame = +3

Query: 198 SYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDN 377
           +YKV L TP GD  FD      ++D A E  ADLP             K+VSGTVDQS+ 
Sbjct: 1   AYKVTLKTPDGDITFDVEPGERLIDIASEK-ADLPLSCQAGACSTCLGKIVSGTVDQSEG 59

Query: 378 SFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SFLDDEQ++ GYVLTC+A P S+VVIETHKE
Sbjct: 60  SFLDDEQIEQGYVLTCIAIPESDVVIETHKE 90



>gb:AY673996_1621422 Gracilaria tenuistipitata var. liui
           chloroplast, complete genome.
          Length = 98

 Score = 94.0 bits (232), Expect = 2e-18
 Identities = 42/75 (56%), Positives = 52/75 (69%)
 Frame = +3

Query: 246 CPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTC 425
           CPD  Y+LDQAEE G +LPY            K+VSGT+DQ D SFLDD+Q+  G+VLTC
Sbjct: 20  CPDTTYILDQAEESGYELPYSCRAGACSTCAGKLVSGTIDQDDQSFLDDDQIQEGFVLTC 79

Query: 426 VAYPTSNVVIETHKE 470
           +AYPTS+  I TH+E
Sbjct: 80  IAYPTSDCTILTHQE 94



>gb:AB038037_1519161 Ipomoea nil mRNA for non-photosynthetic
           ferredoxin, complete cds.
          Length = 151

 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 53/107 (49%), Positives = 63/107 (58%), Gaps = 2/107 (1%)
 Frame = +3

Query: 156 GLKSGNMGRMTCMASYKVKLV-TPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXX 332
           GLK+    R+T  A YK KLV T   ++EFD P D Y+LD AE  G +LPY         
Sbjct: 42  GLKADRY-RVTASAVYKGKLVCTKMAEYEFDVPADTYILDSAEAAGVELPYSCRAGACST 100

Query: 333 -XXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
               K V+G+VDQSD SFLDD QM     +TC  YPTS+ VI THKE
Sbjct: 101 CARGKTVTGSVDQSDGSFLDDNQMKRDMSVTCCLYPTSDCVIHTHKE 147



>sp|P00249|FER2_NOSMU Ferredoxin II.>pir|A00253|FENM2M ferredoxin
           [2Fe-2S] II - Nostoc muscorum
          Length = 98

 Score = 93.6 bits (231), Expect = 3e-18
 Identities = 49/94 (52%), Positives = 59/94 (62%), Gaps = 2/94 (2%)
 Frame = +3

Query: 195 ASYKVKLVTPTG--DFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQ 368
           A+YKV+L       D   + PDD Y+LD AEE G DLP+             +  GTVDQ
Sbjct: 1   ATYKVRLFNAAEGLDETIEVPDDEYILDAAEEAGLDLPFSCRSGSCSSCNGILKKGTVDQ 60

Query: 369 SDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SD +FLDD+Q+ AG VLTCVAYPTSN  IETH+E
Sbjct: 61  SDQNFLDDDQIAAGNVLTCVAYPTSNCEIETHRE 94



>sp|P94044|FER6_MAIZE Ferredoxin VI, chloroplast precursor (Fd
           VI).>pir|T02880|T02880 ferredoxin [2Fe-2S] 4 -
           maize>gb:AB001385_1508466 Maize mRNA for Fd VI, complete
           cds.>gb:AB001386_1508467 Maize DNA for Fd VI, complete
           cds.
          Length = 155

 Score = 93.2 bits (230), Expect = 3e-18
 Identities = 44/91 (48%), Positives = 60/91 (65%), Gaps = 1/91 (1%)
 Frame = +3

Query: 201 YKVKLVTPTG-DFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDN 377
           +KVKLV P G + EF+ PDD Y+L+ AE  G +LP+            ++ +G VDQS+ 
Sbjct: 61  HKVKLVGPDGTEHEFEAPDDTYILEAAETAGVELPFSCRAGSCSTCAGRMSAGEVDQSEG 120

Query: 378 SFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SFLDD QM  GY+LTC++YP ++ VI THKE
Sbjct: 121 SFLDDGQMAEGYLLTCISYPKADCVIHTHKE 151



>pir|S78362|S78362 ferredoxin [2Fe-2S] petF - Odontella sinensis
           chloroplast>gb:OSCHLPLXX_1692947 Odontella sinensis
           complete chloroplast genome.
          Length = 99

 Score = 92.8 bits (229), Expect = 4e-18
 Identities = 44/95 (46%), Positives = 61/95 (64%), Gaps = 2/95 (2%)
 Frame = +3

Query: 192 MASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVD 365
           MA+YKV L++   D +   DC DDV++LD AEE G +LPY            KV  G +D
Sbjct: 1   MATYKVTLLSEEHDIDATIDCNDDVFLLDAAEEQGIELPYSCRAGACSTCAGKVTEGDID 60

Query: 366 QSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           QS+ +FLDD+Q+ AG+VLTC+AYP S+  +  H+E
Sbjct: 61  QSEQTFLDDDQVGAGFVLTCIAYPKSDCTVLVHQE 95



>sp|P00256|FER_SYNEL Ferredoxin I.>pir|A00259|FEYCT ferredoxin
           [2Fe-2S] [validated] - Synechococcus sp.
          Length = 97

 Score = 92.8 bits (229), Expect = 4e-18
 Identities = 47/93 (50%), Positives = 61/93 (65%), Gaps = 1/93 (1%)
 Frame = +3

Query: 195 ASYKVKLVTPTG-DFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQS 371
           A+YKV LV P G +   D P+D Y+LD AEE G DLP+            K++ G VDQS
Sbjct: 1   ATYKVTLVRPDGSETTIDVPEDEYILDVAEEQGLDLPFSCRAGACSTCAGKLLEGEVDQS 60

Query: 372 DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           D SFLDD+Q++ G+VLTCVAYP S+  I T++E
Sbjct: 61  DQSFLDDDQIEKGFVLTCVAYPRSDCKILTNQE 93



>sp|P00237|FER2_EQUAR Ferredoxin II.>pir|B04609|FEEQ2F ferredoxin
           [2Fe-2S] II - field horsetail
          Length = 93

 Score = 92.8 bits (229), Expect = 4e-18
 Identities = 49/91 (53%), Positives = 58/91 (63%)
 Frame = +3

Query: 198 SYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDN 377
           +YKV L TP GD  FD      ++D   E  ADLP             K+VSGTVDQS+ 
Sbjct: 1   AYKVTLKTPDGDITFDVEPGERLIDIGSEK-ADLPLSCQAGACSTCLGKIVSGTVDQSEG 59

Query: 378 SFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SFLDDEQ++ GYVLTC+A P S+VVIETHKE
Sbjct: 60  SFLDDEQIEQGYVLTCIAIPESDVVIETHKE 90



>sp|P49522|FER_ODOSI Ferredoxin.
          Length = 98

 Score = 90.9 bits (224), Expect = 2e-17
 Identities = 43/94 (45%), Positives = 60/94 (63%), Gaps = 2/94 (2%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQ 368
           A+YKV L++   D +   DC DDV++LD AEE G +LPY            KV  G +DQ
Sbjct: 1   ATYKVTLLSEEHDIDATIDCNDDVFLLDAAEEQGIELPYSCRAGACSTCAGKVTEGDIDQ 60

Query: 369 SDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           S+ +FLDD+Q+ AG+VLTC+AYP S+  +  H+E
Sbjct: 61  SEQTFLDDDQVGAGFVLTCIAYPKSDCTVLVHQE 94



>gb:AB116656_14063 Aphanothece sacrum gene for ferredoxin I, partial
           cds.
          Length = 81

 Score = 90.5 bits (223), Expect = 2e-17
 Identities = 46/81 (56%), Positives = 52/81 (64%), Gaps = 1/81 (1%)
 Frame = +3

Query: 219 TPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTV-DQSDNSFLDDE 395
           TP GD     PDD Y+LD AEE G DLPY            K+VSG   DQSD SFLDD+
Sbjct: 1   TPDGDNVITVPDDEYILDVAEEQGLDLPYSCRAGACSTCAGKLVSGPAPDQSDQSFLDDD 60

Query: 396 QMDAGYVLTCVAYPTSNVVIE 458
           Q+ AGY+LTCVAYPT + VIE
Sbjct: 61  QIQAGYILTCVAYPTGDCVIE 81



>sp|P07484|FER_RHOPL Ferredoxin.>pir|A93760|FEPRR ferredoxin
           [2Fe-2S] - red alga (Palmaria palmata)
          Length = 97

 Score = 89.4 bits (220), Expect = 5e-17
 Identities = 46/90 (51%), Positives = 56/90 (62%)
 Frame = +3

Query: 201 YKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNS 380
           Y V L TP G  E +  +  YVLD AE+ G DLPY             V  GTVDQSD S
Sbjct: 4   YTVTLSTPGGVEEIEGDETTYVLDSAEDQGIDLPYSCRAGACSTCAGIVELGTVDQSDQS 63

Query: 381 FLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           FLDD+Q++  +VLTCVAYPTS+  I+TH+E
Sbjct: 64  FLDDDQLNDSFVLTCVAYPTSDCQIKTHQE 93



>gb:RICRF_1703751 Oryza sativa mRNA for root ferredoxin, partial
           cds.
          Length = 87

 Score = 85.9 bits (211), Expect = 5e-16
 Identities = 38/78 (48%), Positives = 51/78 (65%)
 Frame = +3

Query: 237 EFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYV 416
           EF+ P+D Y+L+ AE  G +LP+            K+ SG VDQS+ SFLD+ QM  GYV
Sbjct: 6   EFEAPEDTYILEAAETAGVELPFSCRAGSCSTCAGKMSSGEVDQSEGSFLDENQMGEGYV 65

Query: 417 LTCVAYPTSNVVIETHKE 470
           LTC++YP ++ VI THKE
Sbjct: 66  LTCISYPKADCVIHTHKE 83



>gb:AB096367_1525577 Cryptomeria japonica Ferr gene for putative
           ferredoxin, partial cds,
           isolate:Minami-shitara2.>gb:AB096368_1525578 Cryptomeria
           japonica Ferr gene for putative ferredoxin, partial cds,
           isolate:Minami-shitara6.>gb:AB096370_1525580 Cryptomeria
           japonica Ferr gene for putative ferredoxin, partial cds,
           isolate:Amagi3.>gb:AB096373_1525583 Cryptomeria japonica
           Ferr gene for putative ferredoxin, partial cds,
           isolate:Higashi-kamo2.>gb:AB096375_1525585 Cryptomeria
           japonica Ferr gene for putative ferredoxin, partial cds,
           isolate:Higashi-kamo6.>gb:AB096376_1525586 Cryptomeria
           japonica Ferr gene for putative ferredoxin, partial cds,
           isolate:Higashi-kamo7.>gb:AB096378_1525588 Cryptomeria
           japonica Ferr gene for putative ferredoxin, partial cds,
           isolate:Keta4.>gb:AB096380_1525590 Cryptomeria japonica
           Ferr gene for putative ferredoxin, partial cds,
           isolate:Nishikawa7.>gb:AB096382_1525592 Cryptomeria
           japonica Ferr gene for putative ferredoxin, partial cds,
           isolate:Kita-kabahara1.>gb:AB096385_1525595 Cryptomeria
           japonica Ferr gene for putative ferredoxin, partial cds,
           isolate:Higashi-kubiki2.>gb:AB096386_1525596 Cryptomeria
           japonica Ferr gene for putative ferredoxin, partial cds,
           isolate:Nagaoka-shi2.>gb:AB096388_1525598 Cryptomeria
           japonica Ferr gene for putative ferredoxin, partial cds,
           isolate:Naoetsu1.>gb:AB096391_1525601 Cryptomeria
           japonica Ferr gene for putative ferredoxin, partial cds,
           isolate:Ohara15.>gb:AB096392_1525602 Cryptomeria
           japonica Ferr gene for putative ferredoxin, partial cds,
           isolate:Ohara504.>gb:AB096394_1525604 Cryptomeria
           japonica Ferr gene for putative ferredoxin, partial cds,
           isolate:Isurugi2.>gb:AB096395_1525605 Cryptomeria
           japonica Ferr gene for putative ferredoxin, partial cds,
           isolate:Ohyama1.>gb:AB096397_1525607 Cryptomeria
           japonica Ferr gene for putative ferredoxin, partial cds,
           isolate:Kamiichi3.>gb:AB096398_1525608 Cryptomeria
           japonica Ferr gene for putative ferredoxin, partial cds,
           isolate:Kami-hei2.>gb:AB096399_1525609 Cryptomeria
           japonica Ferr gene for putative ferredoxin, partial cds,
           isolate:Kami-hei4.>gb:AB096401_1525611 Cryptomeria
           japonica Ferr gene for putative ferredoxin, partial cds,
           isolate:Kami-hei8.>gb:AB096402_1525612 Cryptomeria
           japonica Ferr gene for putative ferredoxin, partial cds,
           isolate:Kami-hei11.>gb:AB096409_1525619 Cryptomeria
           japonica Ferr gene for putative ferredoxin, partial cds,
           isolate:Iwateken10.
          Length = 115

 Score = 85.9 bits (211), Expect = 5e-16
 Identities = 38/84 (45%), Positives = 52/84 (61%)
 Frame = +3

Query: 162 KSGNMGRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXX 341
           K G   + +  A+YKVKLVTP G+ E +CPDD Y+LD AE+ G DLPY            
Sbjct: 32  KMGLKAKRSVKAAYKVKLVTPDGETEIECPDDQYILDAAEDAGIDLPYSCRSGSCSSCAA 91

Query: 342 KVVSGTVDQSDNSFLDDEQMDAGY 413
           KV+ G ++  D SFLDD+Q+ +G+
Sbjct: 92  KVIEGEIEMEDQSFLDDDQIGSGF 115



>gb:AB096366_1525576 Cryptomeria japonica Ferr gene for putative
           ferredoxin, partial cds,
           isolate:Kita-shitara2.>gb:AB096369_1525579 Cryptomeria
           japonica Ferr gene for putative ferredoxin, partial cds,
           isolate:Amagi1.>gb:AB096371_1525581 Cryptomeria japonica
           Ferr gene for putative ferredoxin, partial cds,
           isolate:Amagi6.>gb:AB096372_1525582 Cryptomeria japonica
           Ferr gene for putative ferredoxin, partial cds,
           isolate:Amagi7.>gb:AB096374_1525584 Cryptomeria japonica
           Ferr gene for putative ferredoxin, partial cds,
           isolate:Higashi-kamo3.>gb:AB096377_1525587 Cryptomeria
           japonica Ferr gene for putative ferredoxin, partial cds,
           isolate:Kanra1.>gb:AB096379_1525589 Cryptomeria japonica
           Ferr gene for putative ferredoxin, partial cds,
           isolate:Tenryu10.>gb:AB096381_1525591 Cryptomeria
           japonica Ferr gene for putative ferredoxin, partial cds,
           isolate:Senzu2.>gb:AB096383_1525593 Cryptomeria japonica
           Ferr gene for putative ferredoxin, partial cds,
           isolate:Kita-kabahara2.>gb:AB096384_1525594 Cryptomeria
           japonica Ferr gene for putative ferredoxin, partial cds,
           isolate:Higashi-kabahara1.>gb:AB096387_1525597
           Cryptomeria japonica Ferr gene for putative ferredoxin,
           partial cds,
           isolate:Kashiwazaki-shi2.>gb:AB096389_1525599
           Cryptomeria japonica Ferr gene for putative ferredoxin,
           partial cds, isolate:Iwafune5.>gb:AB096390_1525600
           Cryptomeria japonica Ferr gene for putative ferredoxin,
           partial cds, isolate:Ohara7.>gb:AB096393_1525603
           Cryptomeria japonica Ferr gene for putative ferredoxin,
           partial cds, isolate:Johana1.>gb:AB096396_1525606
           Cryptomeria japonica Ferr gene for putative ferredoxin,
           partial cds, isolate:Hayatsuki17.>gb:AB096400_1525610
           Cryptomeria japonica Ferr gene for putative ferredoxin,
           partial cds, isolate:Kami-hei5.>gb:AB096403_1525613
           Cryptomeria japonica Ferr gene for putative ferredoxin,
           partial cds, isolate:Shimo-hei1.>gb:AB096404_1525614
           Cryptomeria japonica Ferr gene for putative ferredoxin,
           partial cds, isolate:Kesen5.>gb:AB096405_1525615
           Cryptomeria japonica Ferr gene for putative ferredoxin,
           partial cds, isolate:Kesen6.>gb:AB096406_1525616
           Cryptomeria japonica Ferr gene for putative ferredoxin,
           partial cds, isolate:Ninohe1.>gb:AB096407_1525617
           Cryptomeria japonica Ferr gene for putative ferredoxin,
           partial cds, isolate:Iwateken1.>gb:AB096408_1525618
           Cryptomeria japonica Ferr gene for putative ferredoxin,
           partial cds, isolate:Iwateken9.>gb:AB096410_1525620
           Cryptomeria japonica Ferr gene for putative ferredoxin,
           partial cds, isolate:Iwateken12.>gb:AB096411_1525621
           Cryptomeria japonica Ferr gene for putative ferredoxin,
           partial cds, isolate:Higashi-iwai1.>gb:AB096412_1525622
           Cryptomeria japonica Ferr gene for putative ferredoxin,
           partial cds, isolate:Higashi-iwai2.>gb:AB096413_1525623
           Cryptomeria japonica Ferr gene for putative ferredoxin,
           partial cds, isolate:Nishi-iwai1.
          Length = 115

 Score = 85.9 bits (211), Expect = 5e-16
 Identities = 38/84 (45%), Positives = 52/84 (61%)
 Frame = +3

Query: 162 KSGNMGRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXX 341
           K G   + +  A+YKVKLVTP G+ E +CPDD Y+LD AE+ G DLPY            
Sbjct: 32  KMGLKAKRSVKAAYKVKLVTPDGETEIECPDDQYILDAAEDAGIDLPYSCRSGSCSSCAA 91

Query: 342 KVVSGTVDQSDNSFLDDEQMDAGY 413
           KV+ G ++  D SFLDD+Q+ +G+
Sbjct: 92  KVIEGEIEMEDQSFLDDDQIGSGF 115



>gb:AB016893_1513267 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MYH9.
          Length = 148

 Score = 85.9 bits (211), Expect = 5e-16
 Identities = 46/108 (42%), Positives = 65/108 (60%), Gaps = 3/108 (2%)
 Frame = +3

Query: 156 GLKS--GNMGRMTCMASYKVKLVTPTGDF-EFDCPDDVYVLDQAEELGADLPYXXXXXXX 326
           GL S  GN G++    S KVKL++P G+  E +  +D  +L+ AE  G +LPY       
Sbjct: 37  GLSSSRGNFGKVFAKESRKVKLISPEGEEQEIEGNEDCCILESAENAGLELPYSCRSGTC 96

Query: 327 XXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
                K+VSG VDQS  SFL++EQ+  GY+LTC+A P  + V+ THK+
Sbjct: 97  GTCCGKLVSGKVDQSLGSFLEEEQIQKGYILTCIALPLEDCVVYTHKQ 144



>pir|S04543|S04543 ferredoxin [2Fe-2S], heterocyst [validated] -
           Anabaena sp.  (strain PCC 7120)>pir|AC1985|AC1985
           heterocyst ferredoxin [imported] - Nostoc sp. (strain
           PCC 7120)>gb:ASFDXH_582703 Anabaena fdxH gene for
           heterocyst ferredoxin.>gb:BA000019_682421 Nostoc sp. PCC
           7120 DNA, complete genome.
          Length = 99

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 43/95 (45%), Positives = 56/95 (58%), Gaps = 2/95 (2%)
 Frame = +3

Query: 192 MASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVD 365
           MASY+V+L+    D +   +  ++  +LD AEE G +LP+            KVV G VD
Sbjct: 1   MASYQVRLINKKQDIDTTIEIDEETTILDGAEENGIELPFSCHSGSCSSCVGKVVEGEVD 60

Query: 366 QSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           QSD  FLDDEQM  G+ L CV YP SN  I+TH+E
Sbjct: 61  QSDQIFLDDEQMGKGFALLCVTYPRSNCTIKTHQE 95



>gb:AF167538_484961 Trichodesmium sp. IMS101 nif gene cluster,
           partial sequence.
          Length = 104

 Score = 83.2 bits (204), Expect = 3e-15
 Identities = 40/99 (40%), Positives = 56/99 (56%), Gaps = 6/99 (6%)
 Frame = +3

Query: 192 MASYKVKLVT------PTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVS 353
           M +YKV+L+       P  D   D  +D Y+LD A+E G DLP             ++V 
Sbjct: 1   MTTYKVRLIKGKKNKPPEMDVTIDVDEDTYILDAADEAGIDLPVSCRAGACSSCTGRLVE 60

Query: 354 GTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           G +DQ D +FLDDE M+ G++L CV YP S+  I+TH+E
Sbjct: 61  GEIDQEDQNFLDDEVMEKGFLLMCVTYPRSDCTIKTHQE 99



>sp|P11053|FERH_ANASP Ferredoxin, heterocyst.
          Length = 98

 Score = 82.4 bits (202), Expect = 6e-15
 Identities = 42/94 (44%), Positives = 55/94 (58%), Gaps = 2/94 (2%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQ 368
           ASY+V+L+    D +   +  ++  +LD AEE G +LP+            KVV G VDQ
Sbjct: 1   ASYQVRLINKKQDIDTTIEIDEETTILDGAEENGIELPFSCHSGSCSSCVGKVVEGEVDQ 60

Query: 369 SDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SD  FLDDEQM  G+ L CV YP SN  I+TH+E
Sbjct: 61  SDQIFLDDEQMGKGFALLCVTYPRSNCTIKTHQE 94



>gb:PFMAL13_1191253 Plasmodium falciparum 3D7 chromosome 13, ***
           SEQUENCING IN PROGRESS ***, 33 ordered pieces.
          Length = 194

 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 37/90 (41%), Positives = 51/90 (56%)
 Frame = +3

Query: 201 YKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNS 380
           Y + L T  G+ + +C +D Y+LD +E    +LPY            K+V G VD  D S
Sbjct: 99  YNITLRTNDGEKKIECNEDEYILDASERQNVELPYSCRGGSCSTCAAKLVEGEVDNDDQS 158

Query: 381 FLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           +LD+EQ+   Y+L C  YP S+ VIETHKE
Sbjct: 159 YLDEEQIKKKYILLCTCYPKSDCVIETHKE 188



>pir|S20934|S20934 ferredoxin [2Fe-2S] - Calothrix sp. (PCC
           7601)>gb:CSFDXH_119232 Calothrix sp. PCC7601 fdxH gene
           for heterocyst ferredoxin.
          Length = 99

 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 41/95 (43%), Positives = 55/95 (57%), Gaps = 2/95 (2%)
 Frame = +3

Query: 192 MASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVD 365
           MA+Y+V+L+    D +   +  +D  +L+ A E G +LP+            KVV G VD
Sbjct: 1   MATYQVRLINKKEDLDSTIEIDEDTTILEGAAENGIELPFSCHSGSCSSCVGKVVEGEVD 60

Query: 366 QSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           QSD  FLDDEQM  G+ L CV YP SN  I+TH+E
Sbjct: 61  QSDQIFLDDEQMSKGFALLCVTYPRSNCTIKTHQE 95



>gb:AY826849_1629155 Isochrysis galbana clone ISF1 chloroplast
           ferredoxin mRNA, partial cds; nuclear gene for
           chloroplast product.
          Length = 169

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 37/82 (45%), Positives = 49/82 (59%)
 Frame = +3

Query: 165 SGNMGRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXK 344
           +  + R +    Y V L+ P+G F  +CP+D Y+LD+AEE G DLPY            K
Sbjct: 29  ASRVARASPAQMYAVTLIDPSGTFNIECPNDTYILDKAEEDGIDLPYSCRAGACSTCAGK 88

Query: 345 VVSGTVDQSDNSFLDDEQMDAG 410
           V +GT+DQSD SFLDD+QM  G
Sbjct: 89  VTAGTIDQSDGSFLDDDQMGQG 110



>gb:AB188668_1529365 Datura stramonium fed mRNA for ferredoxin,
           partial cds.>gb:AB188669_1529366 Datura tatula fed mRNA
           for ferredoxin, partial cds.>gb:AB188670_1529367 Datura
           quercifolia fed mRNA for ferredoxin, partial cds.
          Length = 66

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 39/66 (59%), Positives = 46/66 (69%)
 Frame = +3

Query: 258 VYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYP 437
           VY+LDQAEE G DLPY            KV +GTVDQSD ++LDD+QM  G+VLTCVAYP
Sbjct: 1   VYILDQAEEEGHDLPYSCRAGSCSSCAGKVTAGTVDQSDGNYLDDDQMADGFVLTCVAYP 60

Query: 438 TSNVVI 455
            S+V I
Sbjct: 61  QSDVTI 66



>gb:AB188674_1529371 Datura arborea fed mRNA for ferredoxin, partial
           cds.
          Length = 66

 Score = 80.5 bits (197), Expect = 2e-14
 Identities = 39/66 (59%), Positives = 46/66 (69%)
 Frame = +3

Query: 258 VYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYP 437
           VY+LDQAEE G +LPY            KV +GTVDQSD +FLDD+QM  G+VLTCVAYP
Sbjct: 1   VYILDQAEEEGHELPYSCRAGSCSSCAGKVTAGTVDQSDGNFLDDDQMADGFVLTCVAYP 60

Query: 438 TSNVVI 455
            S+V I
Sbjct: 61  QSDVTI 66



>pir|S49989|S49989 ferredoxin [2Fe-2S] fdxH1 - Anabaena
           variabilis>gb:AVFDXH1_583583 A.variabilis fdxH1 gene.
          Length = 99

 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 40/95 (42%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = +3

Query: 192 MASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVD 365
           MA+Y+V+L++   + +   +  ++  +LD AEE G +LP+            KVV G VD
Sbjct: 1   MATYQVRLISKKENIDTTIEIDEETTILDGAEENGIELPFSCHSGSCSSCVGKVVEGEVD 60

Query: 366 QSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           QSD  FLDDEQ+  G+ L CV YP SN  I+TH+E
Sbjct: 61  QSDQIFLDDEQVGKGFALLCVTYPRSNCTIKTHQE 95



>gb:AB188671_1529368 Datura metel fed mRNA for ferredoxin, partial
           cds.>gb:AB188672_1529369 Datura fastuosa fed mRNA for
           ferredoxin, partial cds.>gb:AB188673_1529370 Datura
           innoxia fed mRNA for ferredoxin, partial cds.
          Length = 66

 Score = 79.7 bits (195), Expect = 4e-14
 Identities = 38/66 (57%), Positives = 46/66 (69%)
 Frame = +3

Query: 258 VYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYP 437
           VY+LD+AEE G DLPY            KV +GTVDQSD ++LDD+QM  G+VLTCVAYP
Sbjct: 1   VYILDRAEEEGHDLPYSCRAGSCSSCAGKVTAGTVDQSDGNYLDDDQMAEGFVLTCVAYP 60

Query: 438 TSNVVI 455
            S+V I
Sbjct: 61  QSDVTI 66



>gb:AY639025_1178765 Arachis hypogaea auxin-induced putative
           ferredoxin mRNA, partial cds.
          Length = 75

 Score = 79.7 bits (195), Expect = 4e-14
 Identities = 36/65 (55%), Positives = 46/65 (70%)
 Frame = +3

Query: 276 AEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVI 455
           AE  G +LPY            K+VSGTVDQSD +FLD+ Q++ G++LTCV+YPTS+ VI
Sbjct: 7   AENAGVELPYSCRAGACSTCAGKIVSGTVDQSDGAFLDENQLNKGFLLTCVSYPTSDCVI 66

Query: 456 ETHKE 470
           ETHKE
Sbjct: 67  ETHKE 71



>sp|P28610|FERH_FREDI Ferredoxin, heterocyst.
          Length = 98

 Score = 79.3 bits (194), Expect = 5e-14
 Identities = 40/94 (42%), Positives = 54/94 (57%), Gaps = 2/94 (2%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQ 368
           A+Y+V+L+    D +   +  +D  +L+ A E G +LP+            KVV G VDQ
Sbjct: 1   ATYQVRLINKKEDLDSTIEIDEDTTILEGAAENGIELPFSCHSGSCSSCVGKVVEGEVDQ 60

Query: 369 SDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SD  FLDDEQM  G+ L CV YP SN  I+TH+E
Sbjct: 61  SDQIFLDDEQMSKGFALLCVTYPRSNCTIKTHQE 94



>gb:TGO489783_1400176 Toxoplasma gondii partial mRNA for ferredoxin
           (fdx gene).
          Length = 197

 Score = 78.6 bits (192), Expect = 8e-14
 Identities = 38/91 (41%), Positives = 53/91 (58%), Gaps = 1/91 (1%)
 Frame = +3

Query: 201 YKVKLVTPTGDF-EFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDN 377
           +++KL TP G+  E +C +D Y+LD AE  G +LPY            K++ G+VD S+ 
Sbjct: 97  HRIKLQTPDGETKELECAEDEYILDAAEAAGIELPYSCRGGSCSTCAGKLLVGSVDGSEQ 156

Query: 378 SFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            +LDD Q   GYVL C AYP  +  I TH+E
Sbjct: 157 VYLDDAQQKKGYVLLCTAYPKEDCTILTHQE 187



>gb:BA000039_727020 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 108

 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 36/72 (50%), Positives = 47/72 (65%)
 Frame = +3

Query: 255 DVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAY 434
           D Y+LD AE  G  LPY            +++ GTVDQSD+SFL  +++DAG+VL C AY
Sbjct: 30  DEYILDAAEAQGIPLPYSCRAGACVNCAGRIIKGTVDQSDHSFLKPKELDAGFVLLCAAY 89

Query: 435 PTSNVVIETHKE 470
           PTS+ VI TH+E
Sbjct: 90  PTSDCVISTHEE 101



>sp|P46046|FERH_ANAVA Ferredoxin, heterocyst.
          Length = 98

 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 39/94 (41%), Positives = 56/94 (59%), Gaps = 2/94 (2%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQ 368
           A+Y+V+L++   + +   +  ++  +LD AEE G +LP+            KVV G VDQ
Sbjct: 1   ATYQVRLISKKENIDTTIEIDEETTILDGAEENGIELPFSCHSGSCSSCVGKVVEGEVDQ 60

Query: 369 SDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           SD  FLDDEQ+  G+ L CV YP SN  I+TH+E
Sbjct: 61  SDQIFLDDEQVGKGFALLCVTYPRSNCTIKTHQE 94



>pir|C49890|C49890 ferredoxin [2Fe-2S] FdxH - Plectonema boryanum
           (PCC 73110)>gb:PBFDX_157385 P.boryanum fdxH, fdxB genes
           and ORFs 1 and 2.
          Length = 99

 Score = 75.1 bits (183), Expect = 9e-13
 Identities = 37/95 (38%), Positives = 55/95 (57%), Gaps = 2/95 (2%)
 Frame = +3

Query: 192 MASYKVKLVTPTGDFEFDCP--DDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVD 365
           MA+Y+V+L+    + +   P  +D  VL+ AEE   DLP+            KVV G ++
Sbjct: 1   MATYQVRLINKKRNLDITLPVDEDTTVLEAAEEAELDLPFSCHSGACSSCVGKVVEGEIN 60

Query: 366 QSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           Q D +FLD+EQ+  G+VL CV YP ++  I TH+E
Sbjct: 61  QDDQTFLDEEQVAKGFVLLCVTYPRTDCTIRTHQE 95



>sp|P00251|FER2_APHSA Ferredoxin II.>pir|A00255|FEAH2 ferredoxin
           [2Fe-2S] II - Aphanothece sacrum
          Length = 99

 Score = 73.6 bits (179), Expect = 3e-12
 Identities = 40/95 (42%), Positives = 53/95 (55%), Gaps = 3/95 (3%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFE--FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTV-D 365
           A+YKV L+          +  DD  +LD  EE G DLP             K+VSG   +
Sbjct: 1   ATYKVTLINEEEGINAILEVADDQTILDAGEEAGLDLPSSCRAGSCSTCAGKLVSGAAPN 60

Query: 366 QSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           Q D +FLDD+Q+ AG+V+TCVAYPT +  I TH+E
Sbjct: 61  QDDQAFLDDDQLAAGWVMTCVAYPTGDCTIMTHQE 95



>sp|P46035|FER2_PLEBO Ferredoxin II (FdII).
          Length = 98

 Score = 73.2 bits (178), Expect = 4e-12
 Identities = 36/94 (38%), Positives = 54/94 (57%), Gaps = 2/94 (2%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCP--DDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQ 368
           A+Y+V+L+    + +   P  +D  VL+ AEE   DLP+            KVV G ++Q
Sbjct: 1   ATYQVRLINKKRNLDITLPVDEDTTVLEAAEEAELDLPFSCHSGACSSCVGKVVEGEINQ 60

Query: 369 SDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            D +FLD+EQ+  G+VL CV YP ++  I TH+E
Sbjct: 61  DDQTFLDEEQVAKGFVLLCVTYPRTDCTIRTHQE 94



>pir|S49996|S49996 ferredoxin [2Fe-2S] fdxH2 - Anabaena
           variabilis>gb:AVFDXNIFW_583591 A.variabilis fdxB, fdxH2
           and nifW2 genes.
          Length = 99

 Score = 72.0 bits (175), Expect = 8e-12
 Identities = 36/95 (37%), Positives = 53/95 (55%), Gaps = 2/95 (2%)
 Frame = +3

Query: 192 MASYKVKLVTPTGDFEFDCPDD--VYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVD 365
           M +Y+V+L+      +   P D    +LD AE+   +LP+            KVV G VD
Sbjct: 1   MTTYQVRLINKKRAIDITIPVDENTTILDAAEQQDIELPFSCQSGSCSSCVAKVVEGEVD 60

Query: 366 QSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           QS+  FLD+EQM  G+++ CV+YP S+  I TH+E
Sbjct: 61  QSEQVFLDEEQMAKGFIVLCVSYPRSDCTIRTHQE 95



>sp|P46047|FERV_ANAVA Ferredoxin, vegetative.
          Length = 98

 Score = 70.1 bits (170), Expect = 3e-11
 Identities = 35/93 (37%), Positives = 52/93 (55%), Gaps = 2/93 (2%)
 Frame = +3

Query: 198 SYKVKLVTPTGDFEFDCPDD--VYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQS 371
           +Y+V+L+      +   P D    +LD AE+   +LP+            KVV G VDQS
Sbjct: 2   TYQVRLINKKRAIDITIPVDENTTILDAAEQQDIELPFSCQSGSCSSCVAKVVEGEVDQS 61

Query: 372 DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           +  FLD+EQM  G+++ CV+YP S+  I TH+E
Sbjct: 62  EQVFLDEEQMAKGFIVLCVSYPRSDCTIRTHQE 94



>gb:AY571331_1502106 Cyanophage P-SSM2 photosynthetic region.
          Length = 97

 Score = 69.7 bits (169), Expect = 4e-11
 Identities = 35/92 (38%), Positives = 53/92 (57%), Gaps = 1/92 (1%)
 Frame = +3

Query: 198 SYKVKLVTPTGDFEF-DCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           +Y + L +P G  E   C +D Y+L+ AE+ G D+P             KV+ G+V+  +
Sbjct: 2   AYSITLRSPDGAEEVVQCEEDQYILEAAEDAGLDMPSSCRAGACSACLGKVLEGSVNNEE 61

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
            SFLDD+Q++ G+ L CVA P S+ VI T +E
Sbjct: 62  QSFLDDDQLEEGWSLLCVAMPQSDCVILTEQE 93



>pir|S10833|FEYC2 ferredoxin [2Fe-2S] II - Synechococcus sp. (strain
           PCC 6301)>gb:SYATPS_195414 Cyanobacterium Synechococcus
           6301 DNA for ATP synthase subunits.>gb:AP008231_580870
           Synechococcus elongatus PCC 6301 DNA, complete genome.
          Length = 105

 Score = 67.4 bits (163), Expect = 2e-10
 Identities = 36/93 (38%), Positives = 48/93 (51%)
 Frame = +3

Query: 192 MASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQS 371
           MA+Y+V+++       F    D  VLD A+  G DLP             +++SG VDQ 
Sbjct: 1   MATYQVEVIYQGQSQTFTADSDQSVLDSAQAAGVDLPASCLTGVCTTCAARILSGEVDQP 60

Query: 372 DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           D   +  E    GY L CVAYP S++ IETHKE
Sbjct: 61  DAMGVGPEPAKQGYTLLCVAYPRSDLKIETHKE 93



>sp|P08451|FER2_SYNP6 Ferredoxin II.
          Length = 104

 Score = 65.5 bits (158), Expect = 7e-10
 Identities = 35/92 (38%), Positives = 47/92 (51%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSD 374
           A+Y+V+++       F    D  VLD A+  G DLP             +++SG VDQ D
Sbjct: 1   ATYQVEVIYQGQSQTFTADSDQSVLDSAQAAGVDLPASCLTGVCTTCAARILSGEVDQPD 60

Query: 375 NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
              +  E    GY L CVAYP S++ IETHKE
Sbjct: 61  AMGVGPEPAKQGYTLLCVAYPRSDLKIETHKE 92



>gb:AB116657_14064 Aphanothece sacrum gene for ferredoxin II,
           partial cds.
          Length = 84

 Score = 64.7 bits (156), Expect = 1e-09
 Identities = 33/71 (46%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +3

Query: 252 DDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTV-DQSDNSFLDDEQMDAGYVLTCV 428
           DD  +LD  EE G DLP             K+VSG   +Q D +FLDD+Q+ AG+V+TCV
Sbjct: 14  DDQTILDAGEEAGLDLPSSCRAGSCSTCAGKLVSGAAPNQDDQAFLDDDQLAAGWVMTCV 73

Query: 429 AYPTSNVVIET 461
           AYPT +  I T
Sbjct: 74  AYPTGDCTIMT 84



>pir|AF1904|AF1904 ferredoxin [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_681775 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 104

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 33/91 (36%), Positives = 47/91 (51%)
 Frame = +3

Query: 198 SYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDN 377
           +Y V+++          P+D  +L  A+E G DLP             ++++GTVDQSD 
Sbjct: 4   TYTVEILHQGKTHTLQVPEDKTILSVADEQGLDLPSSCHAGVCTTCAGQIITGTVDQSDG 63

Query: 378 SFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
             +  E    GY L CVAYP S++ IET KE
Sbjct: 64  MGVSPELQQQGYALLCVAYPRSDLKIETEKE 94



>gb:AF003700_467308 Cyanothece PCC 8801 NifK (nifK) gene, partial
           cds; and NifE (nifE), NifN (nifN), NifX (nifX), NifW
           (nifW), HesA (hesA), HesB (hesB), and Fdx (fdx) genes,
           complete cds; and unknown genes.
          Length = 114

 Score = 62.8 bits (151), Expect = 5e-09
 Identities = 35/101 (34%), Positives = 52/101 (51%), Gaps = 6/101 (5%)
 Frame = +3

Query: 186 TCMASYKVKLVT------PTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKV 347
           T   +YKV+L+       P  D   + P+D Y+L  AE+ G DLP             ++
Sbjct: 5   TMTTTYKVRLIKGKKNQPPEMDVTLEVPEDEYILSVAEDEGLDLPSSCKSGACSSCVGRI 64

Query: 348 VSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           V GTV+Q D SFLDDE ++ G+VL  +  P   V ++  K+
Sbjct: 65  VEGTVNQEDQSFLDDELIEKGWVLLWLLIPLPIVPLKPTKK 105



>pir|S76421|S76421 ferredoxin [2Fe-2S] - Synechocystis sp. (strain
           PCC 6803)>gb:BA000022_689331 Synechocystis sp. PCC 6803
           DNA, complete genome.
          Length = 103

 Score = 62.8 bits (151), Expect = 5e-09
 Identities = 36/96 (37%), Positives = 50/96 (52%), Gaps = 4/96 (4%)
 Frame = +3

Query: 195 ASYKVKLVTPT--GDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQ 368
           A Y V LV P    D   +  +D  +L+ AE  G DLPY            +++ GTV+ 
Sbjct: 3   AIYSVNLVNPATGSDVTIEVAEDELILEAAENQGLDLPYSCRAASCVACAGRLLEGTVEH 62

Query: 369 SD--NSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           +D  + FL  E++ AG VL C AY TS+  I TH+E
Sbjct: 63  TDKGSDFLKPEELAAGCVLLCAAYATSDCKILTHQE 98



>gb:AP008231_581224 Synechococcus elongatus PCC 6301 DNA, complete
           genome.
          Length = 122

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 31/93 (33%), Positives = 47/93 (50%), Gaps = 2/93 (2%)
 Frame = +3

Query: 198 SYKVKLVTPTGDFEF--DCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQS 371
           +Y V++     D EF    P D Y+L  AEE G +LP+            +V+ G ++Q+
Sbjct: 4   TYTVRIRDRRTDEEFTVQVPPDRYILQTAEEQGYELPFSCRNGACTACAVRVLGGAIEQT 63

Query: 372 DNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           +   L       GY L CV+YP S+V++ET  E
Sbjct: 64  EAMGLSAPLRQRGYALLCVSYPRSDVIVETQDE 96



>gb:BX572093_797075 Prochlorococcus marinus MED4 complete genome;
           segment 4/5.
          Length = 108

 Score = 56.6 bits (135), Expect = 3e-07
 Identities = 28/88 (31%), Positives = 45/88 (51%)
 Frame = +3

Query: 192 MASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQS 371
           M+ Y +K+      + F CP+D  ++  A+  G DLP              V+ G+V+Q 
Sbjct: 1   MSEYNIKVELEKKTYVFLCPEDQDIISAAKANGIDLPSSCCSGVCTSCASMVIDGSVEQE 60

Query: 372 DNSFLDDEQMDAGYVLTCVAYPTSNVVI 455
           D   L+D+  + G+ L CVAYP S++ I
Sbjct: 61  DAMGLNDDLKEKGFALLCVAYPKSDLHI 88



>gb:AP005178_1848869 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OSJNBb0056I06.
          Length = 192

 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 25/41 (60%), Positives = 29/41 (70%)
 Frame = +3

Query: 345 VVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHK 467
           +  G VDQ + S+LDD Q   GYVLTCV+YP SN VI THK
Sbjct: 148 IEDGVVDQPNGSYLDDAQRADGYVLTCVSYPRSNCVIHTHK 188



>gb:PSP579894_161467 Pseudomonas sp. Y2 paa2 gene cluster for
           phenylacetate degradation.
          Length = 358

 Score = 53.9 bits (128), Expect = 2e-06
 Identities = 30/93 (32%), Positives = 47/93 (50%), Gaps = 1/93 (1%)
 Frame = +3

Query: 180 RMTCMASYKVKLVTPTGDFEFDCP-DDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSG 356
           R    A  +V +++      FD P + V VL+    +GA+LP+            KV+ G
Sbjct: 260 RQVDSAVSQVTVISDGRALSFDLPRNSVSVLEAGNAIGAELPWSCKAGVCSTCKCKVIEG 319

Query: 357 TVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVI 455
            V+   N  L+D ++ AGYVL+C +YP S  V+
Sbjct: 320 EVEMDSNHALEDYEVAAGYVLSCQSYPVSERVV 352



>gb:AF029714_470655 Pseudomonas putida transcriptional activator
           homolog, PaaX (paaX), PaaY (paaY), PaaA (paaA), PaaB
           (paaB), PaaC (paaC), PaaE (paaE), PaaF (paaF), PaaG
           (paaG), PaaH (paaH), PaaI (paaI), PaaJ (paaJ), PaaK
           (paaK), PaaL (paaL), PaaM (paaM), PaaN (paaN),
           hypothetical two-components response regulator protein,
           hypothetical protein, hypothetical protein, and
           hypothetical protein genes, complete cds; and unknown
           gene.
          Length = 358

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 27/73 (36%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = +3

Query: 240 FDCPDDVY-VLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYV 416
           FD P +   VLD    +GA+LPY            +V+ G V+   N  L+D ++ AGYV
Sbjct: 280 FDLPRNTQNVLDAGNAIGAELPYSCKAGVCSTCKCRVIEGEVEMDSNHALEDYEVAAGYV 339

Query: 417 LTCVAYPTSNVVI 455
           L+C  YP S+ V+
Sbjct: 340 LSCQTYPVSDKVV 352



>gb:AE016786_332695 Pseudomonas putida KT2440 section 13 of 21 of
           the complete genome.>gb:AE015451_947772 Pseudomonas
           putida KT2440 complete genome.
          Length = 358

 Score = 53.5 bits (127), Expect = 3e-06
 Identities = 27/73 (36%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
 Frame = +3

Query: 240 FDCPDDVY-VLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYV 416
           FD P +   VLD    +GA+LPY            +V+ G V+   N  L+D ++ AGYV
Sbjct: 280 FDLPRNTQNVLDAGNAIGAELPYSCKAGVCSTCKCRVIEGEVEMDSNHALEDYEVAAGYV 339

Query: 417 LTCVAYPTSNVVI 455
           L+C  YP S+ V+
Sbjct: 340 LSCQTYPVSDKVV 352



>gb:AY086239_1571294 Arabidopsis thaliana clone 22861 mRNA, complete
           sequence.
          Length = 154

 Score = 52.8 bits (125), Expect = 5e-06
 Identities = 33/94 (35%), Positives = 48/94 (51%)
 Frame = +3

Query: 177 GRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSG 356
           GR+   A YKV +       E +   D  +L +A + G D+PY            K+V+G
Sbjct: 46  GRIVARA-YKVVVEHDGKTTELEVEPDETILSKALDSGLDVPYDCNLGVCMTCPAKLVTG 104

Query: 357 TVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIE 458
           TVDQS    L D+ ++ GY L C +YPTS+  I+
Sbjct: 105 TVDQS-GGMLSDDVVERGYTLLCASYPTSDCHIK 137



>pir|S75687|S75687 ferredoxin [2Fe-2S] II - Synechocystis sp.
           (strain PCC 6803)>gb:BA000022_689027 Synechocystis sp.
           PCC 6803 DNA, complete genome.
          Length = 122

 Score = 52.8 bits (125), Expect = 5e-06
 Identities = 26/80 (32%), Positives = 40/80 (50%)
 Frame = +3

Query: 231 DFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAG 410
           D+     DD Y+L QAE+ G +LP+            +V+SG + Q +   L  +    G
Sbjct: 17  DYSVIVSDDRYILHQAEDQGFELPFSCRNGACTACAVRVISGQIHQPEAMGLSPDLQRQG 76

Query: 411 YVLTCVAYPTSNVVIETHKE 470
           Y L CV+Y  S++ +ET  E
Sbjct: 77  YALLCVSYAQSDLEVETQDE 96



>pir|B71412|B71412 ferredoxin [2Fe-2S] - Arabidopsis
           thaliana>gb:ATCHRIV40_1545291 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 40.>gb:ATFCA2_1551539
           Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig
           fragment No. 2.>gb:AY058112_1564251 Arabidopsis thaliana
           AT4g14890/dl3485w mRNA, complete
           cds.>gb:AY101536_1577647 Arabidopsis thaliana
           AT4g14890/dl3485w mRNA, complete cds.
          Length = 154

 Score = 52.4 bits (124), Expect = 7e-06
 Identities = 33/94 (35%), Positives = 48/94 (51%)
 Frame = +3

Query: 177 GRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSG 356
           GR+   A YKV +       E +   D  +L +A + G D+PY            K+V+G
Sbjct: 46  GRIIARA-YKVVVEHDGKTTELEVEPDETILSKALDSGLDVPYDCNLGVCMTCPAKLVTG 104

Query: 357 TVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIE 458
           TVDQS    L D+ ++ GY L C +YPTS+  I+
Sbjct: 105 TVDQS-GGMLSDDVVERGYTLLCASYPTSDCHIK 137



>gb:BX572101_799536 Prochlorococcus marinus MIT9313 complete genome;
           segment 7/7.
          Length = 121

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 27/77 (35%), Positives = 37/77 (48%)
 Frame = +3

Query: 240 FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVL 419
           FD PD  Y+L   E  G  LP+            +++SG +DQ+    L  E  D GY L
Sbjct: 20  FDVPDGEYILRSFESRGEQLPFSCRNGCCTTCAVRILSGEMDQTAGIGLSKEMRDKGYGL 79

Query: 420 TCVAYPTSNVVIETHKE 470
            CVA  T ++ +ET  E
Sbjct: 80  LCVARATGDLEVETQDE 96



>gb:AY596297_633485 Haloarcula marismortui ATCC 43049 chromosome I,
           complete sequence.
          Length = 194

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 29/70 (41%), Positives = 35/70 (50%), Gaps = 4/70 (5%)
 Frame = +3

Query: 264 VLDQAEELGADLPYXXXXXXXXXXXXKVVSGT----VDQSDNSFLDDEQMDAGYVLTCVA 431
           +LD  EE G DLPY             +  G     +  S+N  L D+ M+ GY LTCVA
Sbjct: 121 ILDAGEEEGWDLPYACREGQCISCAGHIEDGPATDHIRHSNNDSLMDDDMEEGYCLTCVA 180

Query: 432 YPTSNVVIET 461
           YPTS   IET
Sbjct: 181 YPTSEFTIET 190



>gb:AC087851_1734188 Oryza sativa chromosome 3 BAC OSJNBb0072E24
           genomic sequence, complete sequence.
          Length = 183

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 27/78 (34%), Positives = 37/78 (47%)
 Frame = +3

Query: 237 EFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYV 416
           EF  P D Y+L  AE     LP+            ++ SG + Q +   +  E  D GY 
Sbjct: 75  EFVVPQDQYILHTAEAQDITLPFACRHGCCTSCAVRIKSGQIRQPEALGISAELKDKGYA 134

Query: 417 LTCVAYPTSNVVIETHKE 470
           L CV +PTS+V +ET  E
Sbjct: 135 LLCVGFPTSDVEVETQDE 152



>gb:CR555306_107410 Azoarcus sp. EbN1 complete genome.
          Length = 359

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 27/73 (36%), Positives = 36/73 (49%)
 Frame = +3

Query: 252 DDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVA 431
           +D  +LD A   G DLPY            KV+ G V    N  L+   +DAGY+LTC A
Sbjct: 286 EDTSILDVALAAGMDLPYSCKGGVCCTCRAKVIEGKVRMDKNFTLEQPDIDAGYILTCQA 345

Query: 432 YPTSNVVIETHKE 470
           +P +  V+ T  E
Sbjct: 346 HPLTERVVITFDE 358



>gb:CP000031_84804 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 357

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 24/72 (33%), Positives = 39/72 (54%)
 Frame = +3

Query: 240 FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVL 419
           FD P D+ +LD A +   D P+            +V+ G V+   N  L+D +++ GYVL
Sbjct: 281 FDMPKDLSILDAALQNSLDAPFACKAGVCSTCRCRVLEGEVEMVANHALEDYEVEKGYVL 340

Query: 420 TCVAYPTSNVVI 455
           +C AYP ++ V+
Sbjct: 341 SCQAYPLTDTVV 352



>pir|A86451|A86451 probable ferredoxin, 13117-10969 [imported] -
           Arabidopsis thaliana>gb:AE005172_892094 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC055769_1540208 Arabidopsis thaliana
           chromosome 1 BAC T9G5 genomic sequence, complete
           sequence.>gb:AY080800_1568500 Arabidopsis thaliana
           putative ferredoxin protein (At1g32550) mRNA, complete
           cds.>gb:AY114079_1578490 Arabidopsis thaliana putative
           ferredoxin protein (At1g32550) mRNA, complete cds.
          Length = 181

 Score = 51.2 bits (121), Expect = 1e-05
 Identities = 26/78 (33%), Positives = 37/78 (47%)
 Frame = +3

Query: 237 EFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYV 416
           EF+ P+D Y+L  AE     LP+            +V SG + Q     +  E    GY 
Sbjct: 73  EFEVPEDQYILHSAESQNISLPFACRHGCCTSCAVRVKSGELRQPQALGISAELKSQGYA 132

Query: 417 LTCVAYPTSNVVIETHKE 470
           L CV +PTS++ +ET  E
Sbjct: 133 LLCVGFPTSDLEVETQDE 150



>gb:PSSTYCATA_161557 Pseudomonas sp. Y2 DNA for styrene catabolism
           genes.
          Length = 357

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 1/85 (1%)
 Frame = +3

Query: 204 KVKLVTPTGDFEFDCP-DDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNS 380
           ++ +++   +  F+ P +   +LD     GA+LPY            KVV G V+   N 
Sbjct: 267 QITVISDGRELSFELPRNSQSILDAGNAQGAELPYSCKAGVCSTCKCKVVEGEVEMDSNF 326

Query: 381 FLDDEQMDAGYVLTCVAYPTSNVVI 455
            L+D ++ AGYVL+C  +P S+ V+
Sbjct: 327 ALEDYEVAAGYVLSCQTFPISDKVV 351



>gb:ECPAA_132009 E.coli paa cluster for phenylacetic acid
           degradation.
          Length = 356

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 29/70 (41%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = +3

Query: 252 DDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVA 431
           DD  +LD A   GADLPY            KV+ G V    N  L+ +++ AGYVL+C A
Sbjct: 280 DDESILDAALRQGADLPYACKGGVCATCKCKVLRGKVAMETNYSLEPDELAAGYVLSCQA 339

Query: 432 YP-TSNVVIE 458
            P TS+VV++
Sbjct: 340 LPLTSDVVVD 349



>gb:D90777_122421 E.coli genomic DNA, Kohara clone #266(31.1-31.5
           min.).>gb:D90778_122426 E.coli genomic DNA, Kohara clone
           #267(31.4-31.7 min.).
          Length = 426

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 29/70 (41%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = +3

Query: 252 DDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVA 431
           DD  +LD A   GADLPY            KV+ G V    N  L+ +++ AGYVL+C A
Sbjct: 350 DDESILDAALRQGADLPYACKGGVCATCKCKVLRGKVAMETNYSLEPDELAAGYVLSCQA 409

Query: 432 YP-TSNVVIE 458
            P TS+VV++
Sbjct: 410 LPLTSDVVVD 419



>sp|P76081|PAAE_ECOLI Probable phenylacetic acid degradation NADH
           oxidoreductase paaE (EC 1.-.-.-).>pir|C64890|C64890
           probable electron transfer protein - Escherichia coli
           (strain K-12)>gb:U00096_200462 Escherichia coli K-12
           MG1655 complete genome.
          Length = 356

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 29/70 (41%), Positives = 39/70 (55%), Gaps = 1/70 (1%)
 Frame = +3

Query: 252 DDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVA 431
           DD  +LD A   GADLPY            KV+ G V    N  L+ +++ AGYVL+C A
Sbjct: 280 DDESILDAALRQGADLPYACKGGVCATCKCKVLRGKVAMETNYSLEPDELAAGYVLSCQA 339

Query: 432 YP-TSNVVIE 458
            P TS+VV++
Sbjct: 340 LPLTSDVVVD 349



>gb:AP006618_558560 Nocardia farcinica IFM 10152 DNA, complete
           genome.
          Length = 365

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 24/69 (34%), Positives = 36/69 (52%)
 Frame = +3

Query: 249 PDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCV 428
           P D  +LD AE++ +DLP+            K+  G  D   N  L+D ++  G+VLTC 
Sbjct: 292 PRDRSILDAAEQIRSDLPFACKGGVCGTCRAKITGGEADMRRNYALEDAEVADGFVLTCQ 351

Query: 429 AYPTSNVVI 455
            YP S+ V+
Sbjct: 352 TYPVSDSVV 360



>pir|AH2170|AH2170 ferredoxin [imported] - Nostoc sp. (strain PCC
           7120)>gb:BA000019_683908 Nostoc sp. PCC 7120 DNA,
           complete genome.
          Length = 122

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 26/74 (35%), Positives = 38/74 (51%)
 Frame = +3

Query: 249 PDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCV 428
           P+D Y+L  AE+ G +LP+            +VVSG + Q +   L  E    GY L CV
Sbjct: 23  PEDRYILHTAEQQGVELPFSCRNGACTTCAVRVVSGDIYQPEAVGLSLELRRQGYALLCV 82

Query: 429 AYPTSNVVIETHKE 470
           +Y  S++ +ET  E
Sbjct: 83  SYARSDLEVETQDE 96



>pir|S09338|S09338 ferredoxin [2Fe-2S] II - garden pea (fragment)
          Length = 40

 Score = 49.3 bits (116), Expect = 6e-05
 Identities = 21/37 (56%), Positives = 25/37 (67%)
 Frame = +3

Query: 195 ASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPY 305
           A+Y +KL+TP G  E  C D  Y+LD AEE G DLPY
Sbjct: 1   ATYNIKLITPEGTKEITCSDSEYILDAAEEKGLDLPY 37



>pir|S77325|S77325 ferredoxin [2Fe-2S] I - Synechocystis sp. (strain
           PCC 6803)>gb:BA000022_688207 Synechocystis sp. PCC 6803
           DNA, complete genome.
          Length = 106

 Score = 49.3 bits (116), Expect = 6e-05
 Identities = 26/79 (32%), Positives = 36/79 (45%)
 Frame = +3

Query: 234 FEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGY 413
           +    P+D  VL  A++ G  LP              +  GT +Q+D   +  E    GY
Sbjct: 16  YTISVPEDKTVLQAADDEGIQLPTSCGAGVCTTCAALITEGTAEQADGMGVSAELQAEGY 75

Query: 414 VLTCVAYPTSNVVIETHKE 470
            L CVAYP S++ I T KE
Sbjct: 76  ALLCVAYPRSDLKIITEKE 94



>gb:AY542798_1188323 Zea mays chromosome 1 clone Z477F24 map 1L, ***
           SEQUENCING IN PROGRESS ***, 7 ordered pieces.
          Length = 150

 Score = 48.9 bits (115), Expect = 7e-05
 Identities = 30/91 (32%), Positives = 44/91 (48%)
 Frame = +3

Query: 198 SYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDN 377
           +YKV +         +  +D  +L +A + G D+P+            ++VSGTVDQSD 
Sbjct: 48  AYKVTIEHGGESRVVEVEEDETILSRALDEGLDVPHDCKLGVCMTCPARLVSGTVDQSD- 106

Query: 378 SFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
             L D+ +  GY L C AYP S+  I    E
Sbjct: 107 GMLSDDVVARGYALLCAAYPRSDCTIRVIPE 137



>gb:BA000039_727440 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 130

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 25/83 (30%), Positives = 37/83 (44%)
 Frame = +3

Query: 222 PTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQM 401
           P   +    P D Y+L  AE  G +LP+            +++SG V Q +   L     
Sbjct: 22  PPRTYTITVPSDRYILQHAESQGLELPFSCRNGACTTCAVRILSGHVYQPEAMGLSPALQ 81

Query: 402 DAGYVLTCVAYPTSNVVIETHKE 470
             GY L CV+Y  S++ +ET  E
Sbjct: 82  AQGYALLCVSYARSDLEVETQDE 104



>gb:BA000039_726271 Thermosynechococcus elongatus BP-1 DNA, complete
           genome.
          Length = 108

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 27/91 (29%), Positives = 43/91 (47%)
 Frame = +3

Query: 198 SYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDN 377
           +++V+++     + F+   D  +L  A   G DLP             ++  GTVD  D 
Sbjct: 4   TFRVEILHQGQTYTFEASADKPLLRSATAAGIDLPSSCNAGVCTTCAAQIQEGTVDHGDA 63

Query: 378 SFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
             L  E  + GYVL CVA P S++ + + KE
Sbjct: 64  MGLSPELREKGYVLLCVARPCSDLKLISEKE 94



>gb:AF350436_503943 Sinorhizobium meliloti putative phenylacetic
           acid-catabolism gene cluster, complete sequence.
          Length = 358

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 30/102 (29%), Positives = 51/102 (50%)
 Frame = +3

Query: 165 SGNMGRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXK 344
           +G   R  C A+  V L   T  F F   + + +L+ A E   D P+            K
Sbjct: 260 AGADSRARCEAT--VTLDGATRSFTFP-KEGMSLLEAALENRMDAPFACKAGVCSSCRAK 316

Query: 345 VVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           V+ G V+   N+ L+D +++ GYVLTC +YP S+ ++ ++ +
Sbjct: 317 VLEGEVEMESNNALEDYEVEQGYVLTCQSYPLSDRIVVSYDQ 358



>pir|C96036|C96036 probable ferredoxin reductase electron transfer
           component protein [imported] - Sinorhizobium meliloti
           (strain 1021) magaplasmid pSymB>gb:RME591985_166203
           Sinorhizobium meliloti 1021 complete pSymB.
          Length = 358

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 30/102 (29%), Positives = 51/102 (50%)
 Frame = +3

Query: 165 SGNMGRMTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXK 344
           +G   R  C A+  V L   T  F F   + + +L+ A E   D P+            K
Sbjct: 260 AGADSRARCEAT--VTLDGATRSFTFP-KEGLSLLEAALENRMDAPFACKAGVCSSCRAK 316

Query: 345 VVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           V+ G V+   N+ L+D +++ GYVLTC +YP S+ ++ ++ +
Sbjct: 317 VLEGEVEMESNNALEDYEVEQGYVLTCQSYPLSDRIVVSYDQ 358



>gb:AF176259_485678 Azoarcus evansii regulator protein gene, partial
           cds; and PaaY (paaY), PaaZ (paaZ), PaaG (paaG), PaaH
           (paaH), PaaI (paaI), aerobic phenylacetate-CoA ligase
           (paaK), PaaA (paaA), PaaB (paaB), PaaC (paaC), PaaD
           (paaD), and PaaE (paaE) genes, complete cds.
          Length = 360

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 28/82 (34%), Positives = 40/82 (48%)
 Frame = +3

Query: 225 TGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMD 404
           T + EF   +D  +LD A   G DLPY            K++ G V    N  L+   +D
Sbjct: 279 TREMEFRA-EDPSILDVALRAGMDLPYSCKVGVCCTCRAKLLEGKVRMDKNFTLEQPDVD 337

Query: 405 AGYVLTCVAYPTSNVVIETHKE 470
           AGY+LTC A+P  + V+ +  E
Sbjct: 338 AGYILTCQAHPLIDRVVISFDE 359



>gb:AEV278756_466919 Azoarcus evansii pac gene cluster for aerobic
           phenylacetate catabolism.
          Length = 360

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 27/69 (39%), Positives = 35/69 (50%), Gaps = 1/69 (1%)
 Frame = +3

Query: 252 DDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVA 431
           +D  +LD A   G DLPY            K++ G V    N  L+   +DAGY+LTC A
Sbjct: 287 EDPSILDVALRAGMDLPYSCKVGVCCTCRAKLLDGKVRMDKNFTLEQPDVDAGYILTCQA 346

Query: 432 YP-TSNVVI 455
           +P T  VVI
Sbjct: 347 HPLTERVVI 355



>gb:SCO939131_181141 Streptomyces coelicolor A3(2) complete genome;
           segment 28/29.
          Length = 368

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 24/60 (40%), Positives = 32/60 (53%)
 Frame = +3

Query: 264 VLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTS 443
           VLD A++   DLP+             V  G+VD   N  L+  ++DAGYVLTC +YP S
Sbjct: 300 VLDGAQQTRPDLPFACKGGVCGTCRALVTDGSVDMRRNYALETAEVDAGYVLTCQSYPVS 359



>gb:AF195208_1775827 Pyrus pyrifolia strain Whangkeumbae ferredoxin
           (FD1) mRNA, complete cds.
          Length = 98

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 19/26 (73%), Positives = 24/26 (92%)
 Frame = +3

Query: 393 EQMDAGYVLTCVAYPTSNVVIETHKE 470
           EQ+D G+VLTCVAYP+S+V +ETHKE
Sbjct: 34  EQIDGGFVLTCVAYPSSDVTLETHKE 59



>gb:BX640428_809930 Bordetella parapertussis strain 12822, complete
           genome; segment 6/14.>gb:BX640447_816077 Bordetella
           bronchiseptica strain RB50, complete genome; segment
           11/16.
          Length = 362

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 27/70 (38%), Positives = 38/70 (54%), Gaps = 1/70 (1%)
 Frame = +3

Query: 264 VLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTS 443
           VLD A   G +LPY            KVV G VD   N  L+D ++  G+VL+C +YP S
Sbjct: 292 VLDSALAQGVELPYSCKGGVCSTCRCKVVEGEVDMDANFALEDYEVARGFVLSCQSYPVS 351

Query: 444 N-VVIETHKE 470
           + +VI+  +E
Sbjct: 352 DRLVIDFDQE 361



>gb:BX571966_793800 Burkholderia pseudomallei strain K96243,
           chromosome 2, complete sequence.
          Length = 381

 Score = 47.0 bits (110), Expect = 3e-04
 Identities = 25/74 (33%), Positives = 35/74 (47%)
 Frame = +3

Query: 237 EFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYV 416
           E  C  D +VLD A   G  LP             K+VSG VD   N  +   ++D G V
Sbjct: 307 EIACGADQHVLDAARRAGVRLPASCTQGMCGTCKVKLVSGQVDMKHNGGIRQREIDQGMV 366

Query: 417 LTCVAYPTSNVVIE 458
           L C + P S++V++
Sbjct: 367 LLCCSKPLSDLVVD 380



>gb:CP000031_86396 Silicibacter pomeroyi DSS-3, complete genome.
          Length = 132

 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 23/65 (35%), Positives = 35/65 (53%)
 Frame = +3

Query: 264 VLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTS 443
           +L+Q  + G DLPY            K+ +G VDQ     L++ Q+  GYV+ CVA  TS
Sbjct: 24  LLEQLRDQGVDLPYGCEYGGCITCAAKLTAGEVDQRRQVALNNRQIANGYVILCVARATS 83

Query: 444 NVVIE 458
           ++ +E
Sbjct: 84  DITLE 88



>gb:AL646079_548978 Ralstonia solanacearum GMI1000 megaplasmid,
           complete sequence; segment 4/11.
          Length = 363

 Score = 46.2 bits (108), Expect = 5e-04
 Identities = 26/72 (36%), Positives = 36/72 (50%)
 Frame = +3

Query: 255 DVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAY 434
           D  VLD A   G DLPY            KV+ G V+   N  L+D ++  G+VLTC A 
Sbjct: 291 DGKVLDSALAAGLDLPYACKGGVCCTCRAKVLEGRVEMEKNFTLEDWEIRQGFVLTCQAR 350

Query: 435 PTSNVVIETHKE 470
           P +  V+ ++ E
Sbjct: 351 PLTQRVVVSYDE 362



>gb:BX569690_775399 Synechococcus sp. WH8102 complete genome;
           segment 2/7.
          Length = 109

 Score = 45.8 bits (107), Expect = 6e-04
 Identities = 27/96 (28%), Positives = 42/96 (43%)
 Frame = +3

Query: 183 MTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTV 362
           M+ +A+Y V+         F C  D  VL+ AE  G  LP              +  G V
Sbjct: 1   MSEVATYTVRAEFEGTTHSFSCRADQTVLNAAEAAGVTLPSSCCSGVCTTCAAVISDGQV 60

Query: 363 DQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIETHKE 470
           +Q D   +  E    GY L CVA+P +++ ++  +E
Sbjct: 61  EQPDAMGVKGELQQQGYALLCVAFPRADLTLKAGQE 96



>gb:CP000011_867865 Burkholderia mallei ATCC 23344 chromosome 2,
           complete sequence.
          Length = 381

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 24/74 (32%), Positives = 34/74 (45%)
 Frame = +3

Query: 237 EFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYV 416
           E  C  D +V D A   G  LP             K+VSG VD   N  +   ++D G V
Sbjct: 307 EIACGADQHVFDAARRAGVRLPASCTQGMCGTCKVKLVSGQVDMKHNGGIRQREIDQGMV 366

Query: 417 LTCVAYPTSNVVIE 458
           L C + P S++V++
Sbjct: 367 LLCCSKPLSDLVVD 380



>gb:BA000045_743257 Gloeobacter violaceus PCC 7421 DNA, complete
           genome.
          Length = 122

 Score = 45.4 bits (106), Expect = 8e-04
 Identities = 23/73 (31%), Positives = 35/73 (47%)
 Frame = +3

Query: 252 DDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVA 431
           +D Y+L +AE  G  LP+            +V++G + Q +   L  E    GY L CV+
Sbjct: 24  EDQYILREAEAQGVALPFSCRNGACTTCAARVLTGRLRQPEAMGLSGELQAQGYALLCVS 83

Query: 432 YPTSNVVIETHKE 470
           Y  SN+ +E   E
Sbjct: 84  YAQSNLEVELQNE 96



>gb:AL646076_548433 Ralstonia solanacearum GMI1000 megaplasmid,
           complete sequence; segment 1/11.
          Length = 382

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 25/74 (33%), Positives = 35/74 (47%)
 Frame = +3

Query: 237 EFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYV 416
           E  C    +VLD A + G  LP             K+VSG VD   N  +   ++D G V
Sbjct: 308 EIACGAAQHVLDAARQAGVRLPASCTQGMCGTCKVKLVSGQVDMKHNGGIRQREIDQGMV 367

Query: 417 LTCVAYPTSNVVIE 458
           L C + P S++VI+
Sbjct: 368 LLCCSKPLSDLVID 381



>gb:AE000516_23789 Mycobacterium tuberculosis CDC1551, complete
           genome.
          Length = 672

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 23/71 (32%), Positives = 35/71 (49%)
 Frame = +3

Query: 240 FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVL 419
           FD      +L+ A  L +D PY            K++ G V+   N  L   ++DAGY+L
Sbjct: 596 FDLVPGDSILEGALGLRSDAPYACMGGACGTCRAKLIEGNVEMDHNFALRKAELDAGYIL 655

Query: 420 TCVAYPTSNVV 452
           TC ++PT+  V
Sbjct: 656 TCQSHPTTPFV 666



>pir|D84405|D84405 hypothetical protein Vng2555c [imported] -
           Halobacterium sp. NRC-1>gb:AE005131_63768 Halobacterium
           sp. NRC-1 section 162 of 170 of the complete
           genome.>gb:AE004437_888687 Halobacterium sp. NRC-1
           complete genome.
          Length = 192

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 5/71 (7%)
 Frame = +3

Query: 264 VLDQAEELGADLPYXXXXXXXXXXXXKVVSGT-----VDQSDNSFLDDEQMDAGYVLTCV 428
           +LD   + G DLPY            +V  G      +  S+N  L D +++ GY+LTC 
Sbjct: 118 ILDAGVDEGWDLPYACQQGQCVSCSGRVADGEDAAEYIRHSNNESLGDAEIEEGYMLTCT 177

Query: 429 AYPTSNVVIET 461
           A+PT++  IET
Sbjct: 178 AHPTASFSIET 188



>pir|C70678|C70678 probable electron transfer protein -
           Mycobacterium tuberculosis (strain
           H37RV)>gb:BX248346_760939 Mycobacterium bovis subsp.
           bovis AF2122/97 complete genome; segment
           13/14.>gb:BX842583_821661 Mycobacterium tuberculosis
           H37Rv complete genome; segment 12/13.
          Length = 685

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 23/71 (32%), Positives = 35/71 (49%)
 Frame = +3

Query: 240 FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVL 419
           FD      +L+ A  L +D PY            K++ G V+   N  L   ++DAGY+L
Sbjct: 609 FDLVPGDSILEGALGLRSDAPYACMGGACGTCRAKLIEGNVEMDHNFALRKAELDAGYIL 668

Query: 420 TCVAYPTSNVV 452
           TC ++PT+  V
Sbjct: 669 TCQSHPTTPFV 679



>gb:PLU457087_158730 Photorhabdus luminescens subsp. laumondii
           partial cpmABCDEFGH gene cluster.>gb:BX571859_785045
           Photorhabdus luminescens subsp. laumondii TTO1 complete
           genome; segment 1/17.
          Length = 84

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 25/88 (28%), Positives = 44/88 (50%)
 Frame = +3

Query: 192 MASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQS 371
           M  +K+K+    G+  FD   +  +L  A + G  L Y            K++SG V+  
Sbjct: 1   MDVFKLKI----GNDSFDISSNETILKCAYKNGVKLKYHCASGYCGKCQVKLISGEVNLD 56

Query: 372 DNSFLDDEQMDAGYVLTCVAYPTSNVVI 455
            +  +  +++ +GY+LTC +YP SN+ I
Sbjct: 57  HSGGISRDKISSGYILTCCSYPKSNIEI 84



>gb:BX572092_796524 Prochlorococcus marinus MED4 complete genome;
           segment 3/5.
          Length = 124

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 21/76 (27%), Positives = 37/76 (48%)
 Frame = +3

Query: 234 FEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGY 413
           ++ +  D  Y+L + E+ G  LP+            K++SG +DQ +   +  +  D GY
Sbjct: 18  YQENISDQEYILKEFEKKGLRLPFSCRNGCCTSCAVKIISGKLDQPEAMGVSQDLKDKGY 77

Query: 414 VLTCVAYPTSNVVIET 461
            L CVA    ++ +ET
Sbjct: 78  ALLCVAKVIEDIEVET 93



>gb:BA000040_731155 Bradyrhizobium japonicum USDA 110 DNA, complete
           genome.
          Length = 378

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 23/68 (33%), Positives = 33/68 (48%)
 Frame = +3

Query: 252 DDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVA 431
           +D  +LD A   G DLP+            K+V G      N  L+  ++ AG+VLTC A
Sbjct: 305 EDEAILDAALRAGVDLPFACKGGMCSTCRAKLVEGEAPMDINYSLEPWELKAGFVLTCQA 364

Query: 432 YPTSNVVI 455
            P+S  V+
Sbjct: 365 KPSSERVV 372



>gb:AE017164_395449 Prochlorococcus marinus subsp. marinus str.
           CCMP1375 section 4 of 6 of the complete
           genome.>gb:AE017126_1031118 Prochlorococcus marinus
           subsp. marinus str. CCMP1375 complete genome.
          Length = 120

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 23/76 (30%), Positives = 36/76 (47%)
 Frame = +3

Query: 243 DCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLT 422
           + P+   +L + EE G  LP+            +++SGT+DQ D   L  +  + GY L 
Sbjct: 20  EIPEGESILRKFEEDGEVLPFSCRNGCCTTCAVRILSGTIDQHDGIGLSKQMQENGYGLL 79

Query: 423 CVAYPTSNVVIETHKE 470
           C+A  T    +ET  E
Sbjct: 80  CIAKVTGPADLETQDE 95



>gb:AF517867_1807669 Griffithsia japonica isolate Gj501 ferredoxin
           mRNA, complete cds.
          Length = 109

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 23/88 (26%), Positives = 44/88 (50%)
 Frame = +3

Query: 183 MTCMASYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTV 362
           M+ + +Y +++      ++    +D  +L+  EE G ++ +            K+++G +
Sbjct: 1   MSDVRTYTIEIDMHGTKYDIPVKEDCTLLEGIEEFGLEVLHSCRAGVCVTCAAKILAGEI 60

Query: 363 DQSDNSFLDDEQMDAGYVLTCVAYPTSN 446
           D    S  DD + + GYVLTC AYP S+
Sbjct: 61  DPGFASITDDLK-EEGYVLTCSAYPRSD 87



>gb:ECU17224_133246 Erwinia carotovora CarR (carR), CarA (carA),
           CarB (carB), CarC (carC), CarD (carD), CarE (carE), CarF
           (carF), CarG (carG), CarH (carH), KduI (kduI), KdgT
           (kdgT), and RexZ (rexZ) genes, complete cds.
          Length = 92

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 22/73 (30%), Positives = 34/73 (46%)
 Frame = +3

Query: 240 FDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVL 419
           F   +D  VL  A E G +LPY            ++ SG V+   +  +  + +  GY+L
Sbjct: 15  FPVSEDESVLSSAYEAGVELPYRCASGYCGVCKVRLTSGNVNMDHSGGISRKDIADGYIL 74

Query: 420 TCVAYPTSNVVIE 458
            C + P SN+ IE
Sbjct: 75  PCCSVPLSNLEIE 87



>gb:AC135600_1742738 Oryza sativa chromosome 3 BAC OSJNBb0047K21
           genomic sequence, complete sequence.
          Length = 147

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 23/69 (33%), Positives = 35/69 (50%)
 Frame = +3

Query: 264 VLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTS 443
           +L +A + G D+P+            ++V+G VDQSD   L D+ +  GY L C +YP S
Sbjct: 67  ILSRALDEGIDVPHDCKLGVCMTCPARLVAGEVDQSD-GMLSDDVVAQGYALLCASYPRS 125

Query: 444 NVVIETHKE 470
           +  I    E
Sbjct: 126 DCTIRVIPE 134



>gb:BX572605_803377 Rhodopseudomonas palustris CGA009 complete
           genome; segment 13/16.
          Length = 362

 Score = 41.6 bits (96), Expect = 0.011
 Identities = 22/64 (34%), Positives = 32/64 (50%)
 Frame = +3

Query: 264 VLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTS 443
           +LD A   G DLP+            K+V G      N  L+  ++ AG+VLTC A PT+
Sbjct: 293 ILDAALRAGVDLPFACKGGMCSTCRAKLVEGEAKMDLNYSLEPWELAAGFVLTCQAKPTT 352

Query: 444 NVVI 455
           + V+
Sbjct: 353 DRVV 356



>gb:AB193033_17437 Corynebacterium glutamicum DNA, strain specific
           island 6, strain: R.
          Length = 384

 Score = 40.4 bits (93), Expect = 0.026
 Identities = 33/123 (26%), Positives = 50/123 (40%)
 Frame = +3

Query: 84  FLSGKPAAAGGSLRAISNFRPAQLGLKSGNMGRMTCMASYKVKLVTPTGDFEFDCPDDVY 263
           F +G P +A G        RP     K  N+       S + +L   +G  E        
Sbjct: 267 FSTGDPKSAPGGNAG----RPVIADPKGKNI-------SIQFQLDGLSGTIESPVSAKET 315

Query: 264 VLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTS 443
           VL+ A     D+P+            KVV G  +  +N  L+ +++ AGYVLTC   PT 
Sbjct: 316 VLNAALRARPDVPFACAGGVCGTCRAKVVEGDYEMDENYALEPDEVAAGYVLTCQTRPTG 375

Query: 444 NVV 452
           + +
Sbjct: 376 DCI 378



>gb:CR555306_108657 Azoarcus sp. EbN1 complete genome.
          Length = 358

 Score = 40.0 bits (92), Expect = 0.033
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 1/70 (1%)
 Frame = +3

Query: 264 VLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYP-T 440
           VLD     G ++PY            KV+ G VD   N  L+D ++  G+ L+C +YP T
Sbjct: 288 VLDAGLGQGIEMPYSCKGGVCSTCRCKVIDGEVDHDTNFALEDYEIARGFRLSCQSYPVT 347

Query: 441 SNVVIETHKE 470
             +V++  +E
Sbjct: 348 DKLVLDFDQE 357



>gb:BA000035_715456 Corynebacterium efficiens YS-314 DNA, complete
           genome.
          Length = 383

 Score = 39.7 bits (91), Expect = 0.044
 Identities = 18/64 (28%), Positives = 32/64 (50%)
 Frame = +3

Query: 264 VLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTS 443
           VL+ A     D+P+            KV+ G  +  +N  L+ ++++AGYVLTC   P  
Sbjct: 315 VLNAALRARPDVPFACAGGVCGTCRAKVIEGEYEMEENYALEPDEVEAGYVLTCQTRPKG 374

Query: 444 NVVI 455
           + ++
Sbjct: 375 DTLV 378



>gb:BX640446_815856 Bordetella bronchiseptica strain RB50, complete
           genome; segment 10/16.
          Length = 348

 Score = 39.3 bits (90), Expect = 0.057
 Identities = 25/68 (36%), Positives = 31/68 (45%), Gaps = 2/68 (2%)
 Frame = +3

Query: 264 VLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDN--SFLDDEQMDAGYVLTCVAYP 437
           VLD A   G  LPY            KVV+G VD        L  E +  GY L C A P
Sbjct: 22  VLDAALAAGIVLPYSCRTGACSTCKGKVVAGEVDAGPYPAQILSPEDLAQGYTLFCQAKP 81

Query: 438 TSNVVIET 461
            S++V+E+
Sbjct: 82  QSDLVVES 89



>gb:BX640428_810152 Bordetella parapertussis strain 12822, complete
           genome; segment 6/14.
          Length = 365

 Score = 39.3 bits (90), Expect = 0.057
 Identities = 25/68 (36%), Positives = 31/68 (45%), Gaps = 2/68 (2%)
 Frame = +3

Query: 264 VLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDN--SFLDDEQMDAGYVLTCVAYP 437
           VLD A   G  LPY            KVV+G VD        L  E +  GY L C A P
Sbjct: 39  VLDAALAAGIVLPYSCRTGACSTCKGKVVAGEVDAGPYPAQILSPEDLAQGYTLFCQAKP 98

Query: 438 TSNVVIET 461
            S++V+E+
Sbjct: 99  QSDLVVES 106



>gb:BX640416_806231 Bordetella pertussis strain Tohama I, complete
           genome; segment 6/12.
          Length = 348

 Score = 39.3 bits (90), Expect = 0.057
 Identities = 25/68 (36%), Positives = 31/68 (45%), Gaps = 2/68 (2%)
 Frame = +3

Query: 264 VLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDN--SFLDDEQMDAGYVLTCVAYP 437
           VLD A   G  LPY            KVV+G VD        L  E +  GY L C A P
Sbjct: 22  VLDAALAAGIVLPYSCRTGACSTCKGKVVAGEVDAGPYPAQILSPEDLAQGYTLFCQAKP 81

Query: 438 TSNVVIET 461
            S++V+E+
Sbjct: 82  QSDLVVES 89



>gb:CP000010_866729 Burkholderia mallei ATCC 23344 chromosome 1,
           complete sequence.
          Length = 362

 Score = 38.5 bits (88), Expect = 0.097
 Identities = 20/69 (28%), Positives = 32/69 (46%)
 Frame = +3

Query: 264 VLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTS 443
           +LD     G  LPY            KV+ G V    N  L+ +++  G+VLTC  +P S
Sbjct: 293 LLDVGLRAGLALPYACKGGVCCTCRAKVLEGEVRMEKNYTLEPQEIADGFVLTCQCHPVS 352

Query: 444 NVVIETHKE 470
             ++ ++ E
Sbjct: 353 EKIVVSYDE 361



>gb:BX571965_793033 Burkholderia pseudomallei strain K96243,
           chromosome 1, complete sequence.
          Length = 362

 Score = 38.5 bits (88), Expect = 0.097
 Identities = 20/69 (28%), Positives = 32/69 (46%)
 Frame = +3

Query: 264 VLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTS 443
           +LD     G  LPY            KV+ G V    N  L+ +++  G+VLTC  +P S
Sbjct: 293 LLDVGLRAGLALPYACKGGVCCTCRAKVLEGEVRMEKNYTLEPQEIADGFVLTCQCHPVS 352

Query: 444 NVVIETHKE 470
             ++ ++ E
Sbjct: 353 EKIVVSYDE 361



>gb:BX569692_776176 Synechococcus sp. WH8102 complete genome;
           segment 4/7.
          Length = 122

 Score = 38.1 bits (87), Expect = 0.13
 Identities = 23/76 (30%), Positives = 30/76 (39%)
 Frame = +3

Query: 243 DCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLT 422
           D P+  Y+L   E  G  LP+            +V  G +DQ +   L  E    GY L 
Sbjct: 21  DVPEGEYILQSFERQGDPLPFSCRNGCCTSCAVRVKQGQLDQREAMGLSHELRQQGYGLL 80

Query: 423 CVAYPTSNVVIETHKE 470
           CVA     +  ET  E
Sbjct: 81  CVARAIGPLEAETQDE 96



>gb:BA000012_669895 Mesorhizobium loti MAFF303099 DNA, complete
           genome.
          Length = 365

 Score = 38.1 bits (87), Expect = 0.13
 Identities = 22/72 (30%), Positives = 32/72 (44%)
 Frame = +3

Query: 243 DCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLT 422
           +C     VL  A   G  +P             K VSG V+ S N  + D ++D G++L 
Sbjct: 293 ECVAGQTVLQTARASGVRIPAACEFGLCGTCKVKKVSGAVEMSHNGGILDHEIDDGFILA 352

Query: 423 CVAYPTSNVVIE 458
           C + P S + IE
Sbjct: 353 CCSKPLSALEIE 364



>gb:AF461768_513555 Yersinia pseudotuberculosis serogroup IA
           O-antigen gene cluster, complete sequence.
          Length = 329

 Score = 37.0 bits (84), Expect = 0.28
 Identities = 17/67 (25%), Positives = 34/67 (50%)
 Frame = +3

Query: 264 VLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTS 443
           +LD A +    + Y             ++SG VD ++N+FL +E +  G +LTC +   S
Sbjct: 22  ILDAALDSNIHIEYSCKDGTCGSCKAILISGEVDSAENTFLTEEDVAKGAILTCCSKAKS 81

Query: 444 NVVIETH 464
           ++ ++ +
Sbjct: 82  DIELDVN 88



>gb:YPS251712_211823 Yersinia pseudotuberculosis serotype O:1b hemH
           gene (partial) and O-antigen gene cluster for ddhD gene,
           ddhA gene, ddhB gene, ddhC gene, prt gene, wbyH gene,
           wzx gene, wbyI gene, wbyJ gene, wzy gene, wbyK gene, gmd
           gene, fcl gene, manC gene, wbyL gene, manB gene and wzz
           gene.>gb:AF461769_513573 Yersinia pseudotuberculosis
           serogroup IVB O-antigen gene cluster, complete
           sequence.>gb:BX936398_835643 Yersinia pseudotuberculosis
           IP32953 genome, complete sequence.
          Length = 329

 Score = 37.0 bits (84), Expect = 0.28
 Identities = 17/67 (25%), Positives = 34/67 (50%)
 Frame = +3

Query: 264 VLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTS 443
           +LD A +    + Y             ++SG VD ++N+FL +E +  G +LTC +   S
Sbjct: 22  ILDAALDSNIHIEYSCKDGTCGSCKAILISGEVDSAENTFLTEEDVAKGAILTCCSKAKS 81

Query: 444 NVVIETH 464
           ++ ++ +
Sbjct: 82  DIELDVN 88



>pir|A36952|A36952 CDP-6-deoxy-Delta(3,4)-glucoseen reductase (EC
           1.3.1.-) - Yersinia pseudotuberculosis>pir|AE0378|AE0378
           cdp-6-deoxy-delta-3,4-glucoseen reductase (EC 1.17.1.-)
           [imported] - Yersinia pestis (strain
           CO92)>gb:S72887_168984 asc operon: asc0.0=ascarylose
           biosynthesis gene...asc6.0=ascarylose biosynthesis gene
           [Yersinia pseudotuberculosis, serogroup VA, Genomic, 8
           genes, 6615 nt].>gb:YEPASCAF_211199 Yersinia
           pseudotuberculosis ORF, 3' end: ascA-ascF genes,
           complete cds's; ORF6.0, 5' end.>gb:YEPASCD_211206
           Yersinia pseudotuberculosis CDP-6-deoxy-3,4-glucoseen
           reductase (ascD) gene fragment.>gb:YPE251713_211628
           Yersinia pestis strain EV76 hemH gene (partial) and
           O-antigen gene cluster for ddhD gene, ddhA gene, ddhB
           pseudogene, ddhC gene, prt gene, wbyH gene, wzx gene,
           wbyI pseudogene, wbyJ gene, wzy pseudogene, wbyK gene,
           gmd pseudogene, fcl pseudogene, manC gene, wbyL gene,
           manB gene, wzz gene and gsk gene
           (partial).>gb:AE013710_299390 Yersinia pestis KIM
           section 110 of 415 of the complete
           genome.>gb:AE017130_386656 Yersinia pestis biovar
           Medievalis str. 91001 section 4 of 16 of the complete
           genome.>gb:AF461770_513592 Yersinia pseudotuberculosis
           serogroup IIA O-antigen gene cluster, complete
           sequence.>gb:AJ414155_524882 Yersinia pestis strain CO92
           complete genome; segment 15/20.>gb:AE009952_929573
           Yersinia pestis KIM complete genome.>gb:AE017042_1143222
           Yersinia pestis biovar Medievalis str. 91001 complete
           genome.>gb:AX768252_1474735 Sequence 33 from Patent
           WO03044047.
          Length = 329

 Score = 37.0 bits (84), Expect = 0.28
 Identities = 17/67 (25%), Positives = 34/67 (50%)
 Frame = +3

Query: 264 VLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTS 443
           +LD A +    + Y             ++SG VD ++N+FL +E +  G +LTC +   S
Sbjct: 22  ILDAALDSNIHIEYSCKDGTCGSCKAILISGEVDSAENTFLTEEDVAKGAILTCCSKAKS 81

Query: 444 NVVIETH 464
           ++ ++ +
Sbjct: 82  DIELDVN 88


>sp|P37911|ASCD_YERPE
           CDP-6-deoxy-L-threo-D-glycero-4-hexulose-3-dehydrase
           reductase (CDP-6- deoxy-delta-3,4-glucoseen reductase)
           (EC 1.17.1.-) (E3).
          Length = 328

 Score = 37.0 bits (84), Expect = 0.28
 Identities = 17/67 (25%), Positives = 34/67 (50%)
 Frame = +3

Query: 264 VLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTS 443
           +LD A +    + Y             ++SG VD ++N+FL +E +  G +LTC +   S
Sbjct: 21  ILDAALDSNIHIEYSCKDGTCGSCKAILISGEVDSAENTFLTEEDVAKGAILTCCSKAKS 80

Query: 444 NVVIETH 464
           ++ ++ +
Sbjct: 81  DIELDVN 87



>gb:SME591785_184889 Sinorhizobium meliloti 1021 complete
           chromosome; segment 4/12.
          Length = 364

 Score = 36.6 bits (83), Expect = 0.37
 Identities = 14/37 (37%), Positives = 26/37 (70%)
 Frame = +3

Query: 348 VSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTSNVVIE 458
           ++G V+ + N  + D++++ GY+L C + PTS+V IE
Sbjct: 327 IAGDVEMNHNGGILDDEIEEGYILACCSRPTSDVQIE 363



>gb:AE017238_413843 Mycobacterium avium subsp. paratuberculosis str.
           k10, section 12 of 16 of the complete
           genome.>gb:AE016958_1057247 Mycobacterium avium subsp.
           paratuberculosis str. k10, complete genome.
          Length = 273

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 20/63 (31%), Positives = 28/63 (44%)
 Frame = +3

Query: 264 VLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDNSFLDDEQMDAGYVLTCVAYPTS 443
           +L  A   G   P             ++  G+    +N  LD E++D G+VLTC A PTS
Sbjct: 206 LLQTARMAGLRAPSSCEIGSCGTCMARLTQGSARMINNDALDPEEVDDGWVLTCQALPTS 265

Query: 444 NVV 452
             V
Sbjct: 266 PTV 268



>gb:PSEPHEAA_160857 Pseudomonas putida phenol hydroxylase gene
           cluster (A1, A2, A3, A4, A5, A6), complete cds.
          Length = 353

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 30/89 (33%), Positives = 40/89 (44%), Gaps = 2/89 (2%)
 Frame = +3

Query: 198 SYKVKLVTPTGDFEFDCPDDVYVLDQAEELGADLPYXXXXXXXXXXXXKVVSGTVDQSDN 377
           SY V  + PTG+   +  D   +L  A   G  LP+            +VV G VD  + 
Sbjct: 2   SYNVT-IEPTGEV-IEVEDGQTILQAALRQGVWLPFACGHGTCATCKVQVVEGEVDIGEA 59

Query: 378 S--FLDDEQMDAGYVLTCVAYPTSNVVIE 458
           S   L D + D   VL C A P S++VIE
Sbjct: 60  SPFALMDIERDERKVLACCAIPLSDLVIE 88


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 547,391,567
Number of Sequences: 1806583
Number of extensions: 10868326
Number of successful extensions: 44585
Number of sequences better than 10.0: 302
Number of HSP's better than 10.0 without gapping: 40926
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 44251
length of database: 581,917,975
effective HSP length: 119
effective length of database: 366,934,598
effective search space used: 34124917614
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)