BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig4474
         (650 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

pir|T47663|T47663 hypothetical protein T26I12.120 - Arabidopsis ...    50   3e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AP003231_1825770 Oryza sativa (japonica cultivar-group) genom...    44   0.003   
gb:AC108876_1738627 Oryza sativa (japonica cultivar-group) chrom...    43   0.004   
gb:BT005835_1638757 Arabidopsis thaliana At5g02580 gene, complet...    42   0.009   
gb:AB025615_1516390 Arabidopsis thaliana genomic DNA, chromosome...    41   0.020   
gb:AY085642_1570710 Arabidopsis thaliana clone 16476 mRNA, compl...    40   0.026   
pir|T47962|T47962 hypothetical protein F15G16.90 - Arabidopsis t...    38   0.13    Arabidopsis thaliana [mouse-ear cress]
gb:AC006526_1534329 Arabidopsis thaliana chromosome 2 clone F11C...    38   0.17    
gb:AC151815_1745164 Solanum demissum chromosome 5 clone PGEC472P...    37   0.22    
gb:AP005474_1852535 Oryza sativa (japonica cultivar-group) genom...    35   1.1     
gb:ATF21E1_1549574 Arabidopsis thaliana DNA chromosome 5, BAC cl...    35   1.1     
gb:AF289593_1150660 Homo sapiens clone pp7683 unknown mRNA.            35   1.1     
gb:BT015375_1642203 Arabidopsis thaliana At5g04090 mRNA, complet...    34   2.5     
gb:AY054259_1563079 Arabidopsis thaliana AT3g10250/F14P13_15 mRN...    34   2.5     
gb:ATF8F6_1551191 Arabidopsis thaliana DNA chromosome 5, BAC clo...    34   2.5     
gb:ATAC009400_1542965 Arabidopsis thaliana chromosome III BAC F1...    34   2.5     
pir|T48436|T48436 hypothetical protein F8F6.300 - Arabidopsis th...    34   2.5     Arabidopsis thaliana [mouse-ear cress]
gb:AE014185_937896 Plasmodium falciparum 3D7 chromosome 10 compl...    33   3.2     
gb:AX647833_1472544 Sequence 2025 from Patent EP1270724.               33   4.2     
gb:AX647511_1472383 Sequence 1703 from Patent EP1270724.               32   7.2     
gb:AK128694_1917343 Homo sapiens cDNA FLJ46861 fis, clone UTERU3...    32   9.3     
gb:AE014296_1134348 Drosophila melanogaster chromosome 3L, compl...    32   9.3     
gb:CP000003_860161 Streptococcus pyogenes MGAS10394, complete ge...    32   9.3     
gb:AE014139_303649 Streptococcus pyogenes MGAS315, section 4 of ...    32   9.3     
gb:AE006491_219446 Streptococcus pyogenes M1 GAS, section 20 of ...    32   9.3     


>pir|T47663|T47663 hypothetical protein T26I12.120 - Arabidopsis
           thaliana>gb:ATT26I12_1555481 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T26I12.>gb:AY080704_1568426
           Arabidopsis thaliana unknown protein (At3g55240) mRNA,
           complete cds.>gb:BT000964_1635219 Arabidopsis thaliana
           clone C105221 unknown protein (At3g55240) mRNA, complete
           cds.
          Length = 95

 Score = 50.1 bits (118), Expect = 3e-05
 Identities = 19/43 (44%), Positives = 31/43 (72%)
 Frame = +2

Query: 206 SCTQLVLQVQSLIERCLLLHMDREQCIKALARHARIRPLVTLT 334
           S    +  VQ +IE+CL+ HM +E+C++AL++HA I P++T T
Sbjct: 5   SSASYIHMVQHMIEKCLIFHMSKEECVEALSKHANITPVITST 47



>gb:AP003231_1825770 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0031D11.
          Length = 102

 Score = 43.5 bits (101), Expect = 0.003
 Identities = 16/35 (45%), Positives = 28/35 (80%)
 Frame = +2

Query: 230 VQSLIERCLLLHMDREQCIKALARHARIRPLVTLT 334
           VQ LIE+C+  +M++E+C++ L +HA I+P++T T
Sbjct: 21  VQHLIEKCICYNMNKEECMETLEKHANIKPVITST 55



>gb:AC108876_1738627 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1525_A02, complete
           sequence.>gb:AC117265_1739410 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OJ1281_H05, complete
           sequence.
          Length = 102

 Score = 43.1 bits (100), Expect = 0.004
 Identities = 17/43 (39%), Positives = 29/43 (67%)
 Frame = +2

Query: 206 SCTQLVLQVQSLIERCLLLHMDREQCIKALARHARIRPLVTLT 334
           S    +  V  LIE+C+  ++++E+C++AL +HA I P+VT T
Sbjct: 6   SSASYIRMVHHLIEKCICFNLNKEECMEALEKHANINPVVTST 48



>gb:BT005835_1638757 Arabidopsis thaliana At5g02580 gene, complete
           cds.
          Length = 91

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 16/35 (45%), Positives = 26/35 (74%)
 Frame = +2

Query: 230 VQSLIERCLLLHMDREQCIKALARHARIRPLVTLT 334
           V  LIE C++ +M +E+C+ AL +HA I+P++T T
Sbjct: 15  VHHLIEECIVFNMGKEECMDALFKHANIKPIITST 49



>gb:AB025615_1516390 Arabidopsis thaliana genomic DNA, chromosome 3,
           TAC clone:K5K13.
          Length = 88

 Score = 40.8 bits (94), Expect = 0.020
 Identities = 16/35 (45%), Positives = 26/35 (74%)
 Frame = +2

Query: 230 VQSLIERCLLLHMDREQCIKALARHARIRPLVTLT 334
           VQ +IE CL  +M +E+C++AL+ +A I P++T T
Sbjct: 13  VQHMIETCLTFNMSKEECMEALSENANINPIITST 47



>gb:AY085642_1570710 Arabidopsis thaliana clone 16476 mRNA, complete
           sequence.
          Length = 91

 Score = 40.4 bits (93), Expect = 0.026
 Identities = 15/35 (42%), Positives = 25/35 (71%)
 Frame = +2

Query: 230 VQSLIERCLLLHMDREQCIKALARHARIRPLVTLT 334
           V  LIE C++ +M +E+C+ AL +H  I+P++T T
Sbjct: 15  VHHLIEECIVFNMGKEECMDALFKHTNIKPIITST 49



>pir|T47962|T47962 hypothetical protein F15G16.90 - Arabidopsis
           thaliana>gb:ATF15G16_1548696 Arabidopsis thaliana DNA
           chromosome 3, BAC clone F15G16.
          Length = 198

 Score = 38.1 bits (87), Expect = 0.13
 Identities = 17/30 (56%), Positives = 23/30 (76%)
 Frame = +2

Query: 230 VQSLIERCLLLHMDREQCIKALARHARIRP 319
           VQ+LIERCL L+M+R++ +K L   ARI P
Sbjct: 53  VQNLIERCLQLYMNRDEVVKTLLTRARIDP 82



>gb:AC006526_1534329 Arabidopsis thaliana chromosome 2 clone F11C10
           map CIC02E07, complete sequence.>gb:AY052357_1562728
           Arabidopsis thaliana At2g46420/F11C10.11 mRNA, complete
           cds.>gb:BT002631_1636234 Arabidopsis thaliana
           At2g46420/F11C10.11 gene, complete cds.
          Length = 363

 Score = 37.7 bits (86), Expect = 0.17
 Identities = 17/30 (56%), Positives = 22/30 (73%)
 Frame = +2

Query: 230 VQSLIERCLLLHMDREQCIKALARHARIRP 319
           VQ+LIERCL L+M R++ +K L   ARI P
Sbjct: 55  VQNLIERCLQLYMSRDEVVKTLLTRARIDP 84



>gb:AC151815_1745164 Solanum demissum chromosome 5 clone PGEC472P22
           map MAP_LOC, complete sequence.
          Length = 371

 Score = 37.4 bits (85), Expect = 0.22
 Identities = 16/30 (53%), Positives = 23/30 (76%)
 Frame = +2

Query: 230 VQSLIERCLLLHMDREQCIKALARHARIRP 319
           VQ+LIERCL L+M++++ +K L   ARI P
Sbjct: 61  VQNLIERCLQLYMNKDEVVKTLLNRARIDP 90



>gb:AP005474_1852535 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OSJNBa0081C13.>gb:AP005647_1855399 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBa0026E05.
          Length = 323

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 15/33 (45%), Positives = 25/33 (75%)
 Frame = +2

Query: 230 VQSLIERCLLLHMDREQCIKALARHARIRPLVT 328
           VQ+LIERCL L+M++++ ++ L+  A+I P  T
Sbjct: 18  VQNLIERCLQLYMNQKEVVETLSFQAKIEPSFT 50



>gb:ATF21E1_1549574 Arabidopsis thaliana DNA chromosome 5, BAC clone
           F21E1 (ESSA project).
          Length = 300

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 15/33 (45%), Positives = 24/33 (72%)
 Frame = +2

Query: 221 VLQVQSLIERCLLLHMDREQCIKALARHARIRP 319
           V +VQ+LIERCL L+M++++ +  L   A+I P
Sbjct: 23  VRRVQNLIERCLQLYMNQKEVVDTLLEQAKIEP 55



>gb:AF289593_1150660 Homo sapiens clone pp7683 unknown mRNA.
          Length = 135

 Score = 35.0 bits (79), Expect = 1.1
 Identities = 23/65 (35%), Positives = 32/65 (49%)
 Frame = +3

Query: 306 PESAHSSRSPVRYTNMKYIYTHTLRTTYIFI*LLARIVFYCNIIVFPIIYTHAYIKSKVI 485
           P+  HS    +RY +   IYTHT   TYI+         Y +I V+  IYTH YI + + 
Sbjct: 84  PQEGHS----LRYID---IYTHTHTHTYIYT--------YIHIYVYTHIYTHTYIHTHIC 128

Query: 486 LCKRI 500
           +   I
Sbjct: 129 IYTHI 133



>gb:BT015375_1642203 Arabidopsis thaliana At5g04090 mRNA, complete
           cds.>gb:BT015671_1642289 Arabidopsis thaliana At5g04090
           gene, complete cds.
          Length = 305

 Score = 33.9 bits (76), Expect = 2.5
 Identities = 14/30 (46%), Positives = 22/30 (73%)
 Frame = +2

Query: 230 VQSLIERCLLLHMDREQCIKALARHARIRP 319
           VQ+LIERCL L+M++++ +  L   A+I P
Sbjct: 17  VQNLIERCLQLYMNQKEVVDTLLEQAKIEP 46



>gb:AY054259_1563079 Arabidopsis thaliana AT3g10250/F14P13_15 mRNA,
           complete cds.>gb:AY079118_1568179 Arabidopsis thaliana
           AT3g10250/F14P13_15 mRNA, complete
           cds.>gb:AY084385_1569475 Arabidopsis thaliana clone
           106330 mRNA, complete sequence.
          Length = 324

 Score = 33.9 bits (76), Expect = 2.5
 Identities = 14/30 (46%), Positives = 22/30 (73%)
 Frame = +2

Query: 230 VQSLIERCLLLHMDREQCIKALARHARIRP 319
           VQ+LIERCL L+M++++ +  L   A+I P
Sbjct: 17  VQNLIERCLQLYMNQKEVVDTLLEQAKIEP 46



>gb:ATF8F6_1551191 Arabidopsis thaliana DNA chromosome 5, BAC clone
           F8F6 (ESSA project).
          Length = 275

 Score = 33.9 bits (76), Expect = 2.5
 Identities = 14/30 (46%), Positives = 22/30 (73%)
 Frame = +2

Query: 230 VQSLIERCLLLHMDREQCIKALARHARIRP 319
           VQ+LIERCL L+M++++ +  L   A+I P
Sbjct: 1   VQNLIERCLQLYMNQKEVVDTLLEQAKIEP 30



>gb:ATAC009400_1542965 Arabidopsis thaliana chromosome III BAC
           F14P13 genomic sequence, complete sequence.
          Length = 327

 Score = 33.9 bits (76), Expect = 2.5
 Identities = 14/30 (46%), Positives = 22/30 (73%)
 Frame = +2

Query: 230 VQSLIERCLLLHMDREQCIKALARHARIRP 319
           VQ+LIERCL L+M++++ +  L   A+I P
Sbjct: 17  VQNLIERCLQLYMNQKEVVDTLLEQAKIEP 46



>pir|T48436|T48436 hypothetical protein F8F6.300 - Arabidopsis
           thaliana  (fragment)
          Length = 275

 Score = 33.9 bits (76), Expect = 2.5
 Identities = 14/30 (46%), Positives = 22/30 (73%)
 Frame = +2

Query: 230 VQSLIERCLLLHMDREQCIKALARHARIRP 319
           VQ+LIERCL L+M++++ +  L   A+I P
Sbjct: 1   VQNLIERCLQLYMNQKEVVDTLLEQAKIEP 30



>gb:AE014185_937896 Plasmodium falciparum 3D7 chromosome 10 complete
            sequence.>gb:AE014834_1228630 Plasmodium falciparum 3D7
            chromosome 10 section 6 of 7 of the complete sequence.
          Length = 2070

 Score = 33.5 bits (75), Expect = 3.2
 Identities = 29/115 (25%), Positives = 48/115 (41%), Gaps = 4/115 (3%)
 Frame = +3

Query: 261  FIWTENNALKLSLGTPESAHSSRSPVRYTNMKYIYTHTLRTTYIFI*L----LARIVFYC 428
            FI  +N    ++     S H +     +TN KYI T +    Y FI      + R++ YC
Sbjct: 836  FINNKNKEKDINENINVSTHKNIKTNTHTN-KYINTPSNEEAYFFISTEVIKIFRLLLYC 894

Query: 429  NIIVFPIIYTHAYIKSKVILCKRILKTKMKTFVVWRELQKENKGFFHQYLTQVSL 593
            NI V  + Y H  I              +   VV+++ + E    +  +L+Q+ L
Sbjct: 895  NIYVESVDYFHDII------------NYVNNLVVYKKKKNEECHVYKMFLSQIYL 937



>gb:AX647833_1472544 Sequence 2025 from Patent EP1270724.
          Length = 529

 Score = 33.1 bits (74), Expect = 4.2
 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 1/43 (2%)
 Frame = +3

Query: 342 YTNMK-YIYTHTLRTTYIFI*LLARIVFYCNIIVFPIIYTHAY 467
           YT+M+ YIYTH    TYI+         Y +I V+  IYTH Y
Sbjct: 302 YTHMRIYIYTHIYTYTYIYT--------YIHIYVYIHIYTHIY 336



 Score = 32.7 bits (73), Expect = 5.5
 Identities = 17/45 (37%), Positives = 28/45 (62%), Gaps = 2/45 (4%)
 Frame = +3

Query: 342 YTNMKYIYTH--TLRTTYIFI*LLARIVFYCNIIVFPIIYTHAYI 470
           +T+M Y+YTH  T   TY++I +   I  Y +I ++  +YT+ YI
Sbjct: 134 HTHM-YVYTHIYTHVYTYMYIHMQTHICIYTHICIYTHVYTYMYI 177



>gb:AX647511_1472383 Sequence 1703 from Patent EP1270724.
          Length = 338

 Score = 32.3 bits (72), Expect = 7.2
 Identities = 21/74 (28%), Positives = 33/74 (44%), Gaps = 1/74 (1%)
 Frame = +2

Query: 251 CLLLHMDREQCIKALARHARIRPLVTLTGTVHKYEIYIHPHTTYNIYIYIAAR*NCVLLQ 430
           C+ +H     C+ A   H     + TL    H Y  Y++ HT Y + +Y   R       
Sbjct: 230 CVYIHTIYTMCVCAYYIHT----IYTLCVYTH-YTHYVYTHTIYTLCVYTHYR------- 277

Query: 431 HYSISHHLYT-CIH 469
           HY  +H +YT C++
Sbjct: 278 HYVCTHTIYTLCVY 291



>gb:AK128694_1917343 Homo sapiens cDNA FLJ46861 fis, clone
           UTERU3011092.
          Length = 291

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 25/94 (26%), Positives = 40/94 (42%), Gaps = 7/94 (7%)
 Frame = +2

Query: 209 CTQLVLQVQSLIERCLLLHMDREQCIKALARHARIRPLVTLTGTVHKYEIYIHPHTTYNI 388
           CT +   V S    C+ +++           HA     + +   +H Y +YIH H    I
Sbjct: 62  CTHMHTYVYSYTRICIHMYVHI---------HAYAYICIFIYTHMHTY-MYIHMHAYAYI 111

Query: 389 YIYIAAR*NCVLLQHYSISH-------HLYTCIH 469
           Y+Y   R  C+ +  +  +H       H+YTCIH
Sbjct: 112 YVYSYTR-ICIHICIFICTHMHTYMCIHMYTCIH 144



>gb:AE014296_1134348 Drosophila melanogaster chromosome 3L, complete
           sequence.>gb:AE003474_1211647 Drosophila melanogaster
           chromosome 3L, section 8 of 83 of the complete sequence.
          Length = 382

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 12/37 (32%), Positives = 19/37 (51%)
 Frame = +3

Query: 249 GVCSFIWTENNALKLSLGTPESAHSSRSPVRYTNMKY 359
           G C   W  +   K  L TP+ AHS   P+++T  ++
Sbjct: 10  GFCLVGWARSQGTKYGLWTPDRAHSDSQPIQWTGGQF 46



>gb:CP000003_860161 Streptococcus pyogenes MGAS10394, complete
           genome.
          Length = 427

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = +3

Query: 411 RIVFYCNIIVFPIIYTHAYIKS-KVILCKRILKTKMKTFVVWRELQKENKGFFHQYLTQV 587
           +++  C + V PI Y  +YI S  + L + I + KMK +V W      +  FF  +L  V
Sbjct: 115 KLLELCYLFVLPIFYLFSYIFSIDLSLIRFISEDKMKKWVFWMNTAMFSYYFFAHFLVTV 174



>gb:AE014139_303649 Streptococcus pyogenes MGAS315, section 4 of 37
           of the complete genome.>gb:AE014074_926828 Streptococcus
           pyogenes MGAS315, complete genome.
          Length = 192

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = +3

Query: 411 RIVFYCNIIVFPIIYTHAYIKS-KVILCKRILKTKMKTFVVWRELQKENKGFFHQYLTQV 587
           +++  C + V PI Y  +YI S  + L + I + KMK +V W      +  FF  +L  V
Sbjct: 115 KLLELCYLFVLPIFYLFSYIFSIDLSLIRFISEDKMKKWVFWMNTAMFSYYFFAHFLVTV 174



>gb:AE006491_219446 Streptococcus pyogenes M1 GAS, section 20 of 167
           of the complete genome.>gb:AE004092_1105292
           Streptococcus pyogenes M1 GAS, complete genome.
          Length = 427

 Score = 32.0 bits (71), Expect = 9.3
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = +3

Query: 411 RIVFYCNIIVFPIIYTHAYIKS-KVILCKRILKTKMKTFVVWRELQKENKGFFHQYLTQV 587
           +++  C + V PI Y  +YI S  + L + I + KMK +V W      +  FF  +L  V
Sbjct: 115 KLLELCYLFVLPIFYLFSYIFSIDLSLIRFISEDKMKKWVFWMNTAMFSYYFFAHFLVTV 174


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 633,703,302
Number of Sequences: 1806583
Number of extensions: 12807568
Number of successful extensions: 26085
Number of sequences better than 10.0: 25
Number of HSP's better than 10.0 without gapping: 24872
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 25946
length of database: 581,917,975
effective HSP length: 120
effective length of database: 365,128,015
effective search space used: 35052289440
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)