BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig4467
         (248 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AB005243_1509533 Arabidopsis thaliana genomic DNA, chromosome...    45   6e-04   
gb:AY084941_1570023 Arabidopsis thaliana clone 122449 mRNA, comp...    43   0.002   
gb:AY058177_1564313 Arabidopsis thaliana At2g24280/F27D4.19 mRNA...    38   0.054   
pir|G84634|G84634 probable prolylcarboxypeptidase [imported] - A...    38   0.054   Arabidopsis thaliana [mouse-ear cress]
gb:AY075655_1567794 Arabidopsis thaliana AT5g65760/MPA24_11 mRNA...    31   8.7     
gb:AB010075_1510989 Arabidopsis thaliana genomic DNA, chromosome...    31   8.7     
pir|T44808|T44808 mycosubtilin synthetase mycC [imported] - Baci...    31   8.7     Bacillus subtilis
pir|T05893|T05893 lysosomal Pro-X carboxypeptidase homolog F6H11...    31   8.7     Arabidopsis thaliana [mouse-ear cress]


>gb:AB005243_1509533 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MRN17.
          Length = 502

 Score = 44.7 bits (104), Expect = 6e-04
 Identities = 23/43 (53%), Positives = 29/43 (67%)
 Frame = +2

Query: 119 NEPDGFSAASTKTTYNNQVYDTKYFTQILDHFTFTPQSYQTFQ 247
           NEPDG +    ++  N ++Y   YF Q LDHFTFTP+SY TFQ
Sbjct: 40  NEPDGSTQKVDES--NLKMY---YFNQTLDHFTFTPESYMTFQ 77



>gb:AY084941_1570023 Arabidopsis thaliana clone 122449 mRNA,
           complete sequence.
          Length = 502

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 24/45 (53%), Positives = 26/45 (57%), Gaps = 2/45 (4%)
 Frame = +2

Query: 119 NEPDGFSAASTKTTYNNQVYDTK--YFTQILDHFTFTPQSYQTFQ 247
           NEPDG       +T      D K  YF Q LDHFTFTP+SY TFQ
Sbjct: 40  NEPDG-------STQKVDESDLKMYYFNQTLDHFTFTPESYMTFQ 77



>gb:AY058177_1564313 Arabidopsis thaliana At2g24280/F27D4.19 mRNA,
           complete cds.>gb:AY142011_1582848 Arabidopsis thaliana
           At2g24280/F27D4.19 mRNA, complete cds.
          Length = 494

 Score = 38.1 bits (87), Expect = 0.054
 Identities = 14/23 (60%), Positives = 19/23 (82%)
 Frame = +2

Query: 176 YDTKYFTQILDHFTFTPQSYQTF 244
           ++T+YF Q LDHF+FTP SY+ F
Sbjct: 46  FETRYFPQNLDHFSFTPDSYKVF 68



>pir|G84634|G84634 probable prolylcarboxypeptidase [imported] -
           Arabidopsis thaliana>gb:AC005967_1533283 Arabidopsis
           thaliana chromosome 2 clone F27D4 map CIC06C07, complete
           sequence.
          Length = 476

 Score = 38.1 bits (87), Expect = 0.054
 Identities = 14/23 (60%), Positives = 19/23 (82%)
 Frame = +2

Query: 176 YDTKYFTQILDHFTFTPQSYQTF 244
           ++T+YF Q LDHF+FTP SY+ F
Sbjct: 46  FETRYFPQNLDHFSFTPDSYKVF 68



>gb:AY075655_1567794 Arabidopsis thaliana AT5g65760/MPA24_11 mRNA,
           complete cds.
          Length = 491

 Score = 30.8 bits (68), Expect = 8.7
 Identities = 20/72 (27%), Positives = 29/72 (40%), Gaps = 5/72 (6%)
 Frame = +2

Query: 20  MNSRILLLLLFSYFAISFAKXXXXXXXXXXXIINEPDGFSAASTKTTY-----NNQVYDT 184
           M S   LLL+F++F + F                    F     +        N   Y+T
Sbjct: 1   MASHFCLLLIFTFFTLVFPSNGSSLSSSKLLPRFPRYTFQNREARIQQFRGDRNEYRYET 60

Query: 185 KYFTQILDHFTF 220
           K+F+Q LDHF+F
Sbjct: 61  KFFSQQLDHFSF 72



>gb:AB010075_1510989 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MPA24.
          Length = 529

 Score = 30.8 bits (68), Expect = 8.7
 Identities = 20/72 (27%), Positives = 29/72 (40%), Gaps = 5/72 (6%)
 Frame = +2

Query: 20  MNSRILLLLLFSYFAISFAKXXXXXXXXXXXIINEPDGFSAASTKTTY-----NNQVYDT 184
           M S   LLL+F++F + F                    F     +        N   Y+T
Sbjct: 1   MASHFCLLLIFTFFTLVFPSNGSSLSSSKLLPRFPRYTFQNREARIQQFRGDRNEYRYET 60

Query: 185 KYFTQILDHFTF 220
           K+F+Q LDHF+F
Sbjct: 61  KFFSQQLDHFSF 72



>pir|T44808|T44808 mycosubtilin synthetase mycC [imported] -
           Bacillus subtilis>gb:AF184956_486466 Bacillus subtilis
           mycosubtilin operon, complete sequence.
          Length = 2609

 Score = 30.8 bits (68), Expect = 8.7
 Identities = 11/24 (45%), Positives = 15/24 (62%)
 Frame = +2

Query: 140 AASTKTTYNNQVYDTKYFTQILDH 211
           A   K TYN Q YD +Y  Q+++H
Sbjct: 194 AIHLKVTYNEQAYDRQYMMQVIEH 217



>pir|T05893|T05893 lysosomal Pro-X carboxypeptidase homolog
           F6H11.120 - Arabidopsis thaliana>gb:ATF6H11_1550855
           Arabidopsis thaliana DNA chromosome 5, BAC clone F6H11
           (ESSAII project).
          Length = 499

 Score = 30.8 bits (68), Expect = 8.7
 Identities = 20/72 (27%), Positives = 29/72 (40%), Gaps = 5/72 (6%)
 Frame = +2

Query: 20  MNSRILLLLLFSYFAISFAKXXXXXXXXXXXIINEPDGFSAASTKTTY-----NNQVYDT 184
           M S   LLL+F++F + F                    F     +        N   Y+T
Sbjct: 1   MASHFCLLLIFTFFTLVFPSNGSSLSSSKLLPRFPRYTFQNREARIQQFRGDRNEYRYET 60

Query: 185 KYFTQILDHFTF 220
           K+F+Q LDHF+F
Sbjct: 61  KFFSQQLDHFSF 72


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 225,277,354
Number of Sequences: 1806583
Number of extensions: 3538240
Number of successful extensions: 7309
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 7160
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7306
length of database: 581,917,975
effective HSP length: 52
effective length of database: 487,975,659
effective search space used: 14639269770
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)