BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig4450
         (1416 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:STU488941_1723089 Solanum tuberosum mRNA for putative mitocho...   525   e-148   
gb:STU488945_1723093 Solanum tuberosum mRNA for putative mitocho...   522   e-147   
gb:AY725474_1624501 Lycopersicon esculentum mitochondrial malate...   521   e-146   
gb:AF180335_1774805 Glycine max malate dehydrogenase (Mdh1) gene...   519   e-146   
gb:STU488942_1723090 Solanum tuberosum mRNA for putative mitocho...   519   e-146   
sp|Q9ZP06|MDHM_ARATH|MDHM_ARATH Malate dehydrogenase, mitochondrial precurs...   508   e-142   Arabidopsis thaliana [mouse-ear cress]
gb:AY087304_1572337 Arabidopsis thaliana clone 33917 mRNA, compl...   507   e-142   
sp|P17783|MDHM_CITLA|MDHM_CITLA Malate dehydrogenase, mitochondrial precurs...   504   e-141   Citrullus lanatus [wild melon]
gb:AY045592_1561183 Arabidopsis thaliana AT3g15020/K15M2_16 mRNA...   500   e-140   
pir|T09286|T09286 malate dehydrogenase (EC 1.1.1.37) precursor -...   500   e-140   Medicago sativa [alfalfa]
gb:AE005173_893227 Arabidopsis thaliana chromosome 1, bottom arm...   499   e-140   
sp|P83373|MDHM_FRAAN|MDHM_FRAAN Malate dehydrogenase, mitochondrial precurs...   499   e-140   Fragaria x ananassa
sp|Q43744|MDHM_BRANA|MDHM_BRANA Malate dehydrogenase, mitochondrial precurs...   489   e-137   Brassica napus [oilseed rape]
sp|P46487|MDHM_EUCGU|MDHM_EUCGU Malate dehydrogenase, mitochondrial precurs...   485   e-135   Eucalyptus gunnii
gb:AF444195_1800407 Oryza sativa malate dehydrogenase (MDH) mRNA...   481   e-134   
gb:AF195869_1775930 Vitis vinifera malate dehydrogenase (MDH) mR...   481   e-134   
gb:AC098832_1736892 Oryza sativa (japonica cultivar-group) chrom...   477   e-133   
gb:STU488944_1723092 Solanum tuberosum mRNA for putative mitocho...   456   e-127   
sp|Q42686|MDHM_CHLRE|MDHM_CHLRE Malate dehydrogenase, mitochondrial precurs...   395   e-108   Chlamydomonas reinhardtii
gb:AF068687_1765646 Glycine max malate dehydrogenase (Mdh-2) gen...   388   e-106   
pir|T06326|T06326 malate dehydrogenase (EC 1.1.1.37) Mdh-2, mito...   388   e-106   Glycine max [soybeans]
sp|Q42972|MDHG_ORYSA|MDHG_ORYSA Malate dehydrogenase, glyoxysomal precursor...   386   e-106   Oryza sativa [red rice]
sp|O82399|MDHI_ARATH|MDHI_ARATH Probable malate dehydrogenase, glyoxysomal ...   382   e-104   Arabidopsis thaliana [mouse-ear cress]
gb:AC092781_1735751 Oryza sativa chromosome 3 BAC OSJNBb0094O03 ...   379   e-104   
sp|P19446|MDHG_CITLA|MDHG_CITLA Malate dehydrogenase, glyoxysomal precursor...   377   e-103   Citrullus lanatus [wild melon]
pir|T09263|T09263 malate dehydrogenase (EC 1.1.1.37) precursor, ...   374   e-102   Medicago sativa [alfalfa]
sp|P46488|MDHG_CUCSA|MDHG_CUCSA Malate dehydrogenase, glyoxysomal precursor...   374   e-102   Cucumis sativus [cucumbers]
gb:CQ834923_1454118 Sequence 2 from Patent WO2004058956.              371   e-101   
gb:AY166633_1586190 Pisum sativum putative malate dehydrogenase ...   370   e-101   
gb:AY725476_1624503 Lycopersicon esculentum glyoxisomal malate d...   369   e-101   
sp|Q9ZP05|MDHG_ARATH|MDHG_ARATH Malate dehydrogenase, glyoxysomal precursor...   366   e-100   Arabidopsis thaliana [mouse-ear cress]
gb:AY057682_1564095 Arabidopsis thaliana AT5g09660/F17I14_150 mR...   366   e-100   
gb:SOYGMDH_1716014 Glycine max glyoxysomal malate dehydrogenase ...   364   3e-99   
sp|P37228|MDHG_SOYBN|MDHG_SOYBN Malate dehydrogenase, glyoxysomal precursor...   364   3e-99   Glycine max [soybeans]
sp|Q9XFW3|MDHH_BRANA|MDHH_BRANA Malate dehydrogenase 2, glyoxysomal precurs...   363   6e-99   Brassica napus [oilseed rape]
gb:AE014297_1140144 Drosophila melanogaster chromosome 3R, compl...   362   1e-98   
sp|Q43743|MDHG_BRANA|MDHG_BRANA Malate dehydrogenase 1, glyoxysomal precurs...   362   1e-98   Brassica napus [oilseed rape]
pir|T51862|T51862 malate dehydrogenase (EC 1.1.1.37), chloroplas...   351   2e-95   Arabidopsis thaliana [mouse-ear cress]
pir|T45712|T45712 NAD-dependent malate dehydrogenase, chloroplas...   350   3e-95   Arabidopsis thaliana [mouse-ear cress]
gb:AP004666_1842949 Oryza sativa (japonica cultivar-group) genom...   350   5e-95   
gb:AP003252_1826338 Oryza sativa (japonica cultivar-group) genom...   347   3e-94   
gb:NTA6974_1691436 Nicotiana tabacum mRNA for NAD-malate dehydro...   345   1e-93   
gb:AY842260_2546905 Xenopus tropicalis mitochondrial malate dehy...   345   2e-93   
gb:AY681347_2543732 Xenopus laevis mitochondrial malate dehydrog...   345   2e-93   
gb:AY282738_1315748 Branchiostoma belcheri tsingtaunese mitochon...   344   2e-93   
gb:AF218064_1252056 Nucella lapillus malate dehydrogenase precur...   343   4e-93   
gb:MUSMDH_2128891 Mouse mitochondrial malate dehydrogenase (mMDH...   343   6e-93   
sp|P08249|MDHM_MOUSE|MDHM_MOUSE Malate dehydrogenase, mitochondrial precurs...   342   8e-93   Mus musculus [mouse]
gb:BC063165_2105185 Rattus norvegicus malate dehydrogenase, mito...   342   1e-92   
pir|S01350|DEMSMM malate dehydrogenase (EC 1.1.1.37) precursor, ...   341   2e-92   
gb:AY681346_2543731 Xenopus laevis mitochondrial malate dehydrog...   341   2e-92   
sp|P04636|MDHM_RAT|MDHM_RAT Malate dehydrogenase, mitochondrial precursor...   340   3e-92   Rattus norvegicus [brown rat]
gb:BC053272_2550663 Danio rerio zgc:64133, mRNA (cDNA clone MGC:...   340   4e-92   
gb:CR536548_1993841 Homo sapiens full open reading frame cDNA cl...   339   9e-92   
gb:CR925943_1185480 Pongo pygmaeus mRNA; cDNA DKFZp470E0311 (fro...   339   9e-92   
pir|T09294|T09294 malate dehydrogenase (EC 1.1.1.37) precursor -...   339   9e-92   Medicago sativa [alfalfa]
sp|P40926|MDHM_HUMAN|MDHM_HUMAN Malate dehydrogenase, mitochondrial precurs...   338   1e-91   Homo sapiens [man]
sp|P00346|MDHM_PIG|MDHM_PIG Malate dehydrogenase, mitochondrial precursor...   338   2e-91   Sus scrofa [pigs]
pir|T06386|T06386 probable malate dehydrogenase (EC 1.1.1.37) - ...   337   5e-91   Pisum sativum [garden pea]
gb:AF390561_2491269 Sphyraena idiastes malate dehydrogenase (mMD...   336   8e-91   
pir|T06325|T06325 malate dehydrogenase (EC 1.1.1.37), nodule-enh...   335   1e-90   Glycine max [soybeans]
pir|A00355|DEPGMM malate dehydrogenase (EC 1.1.1.37), mitochondr...   333   7e-90   
gb:AC005077_1874824 Homo sapiens BAC clone CTA-228D17 from 7, co...   332   1e-89   
pir|T08177|T08177 malate dehydrogenase (EC 1.1.1.37), sodium ace...   332   1e-89   Chlamydomonas reinhardtii
gb:AP004260_1839305 Oryza sativa (japonica cultivar-group) genom...   330   3e-89   
gb:AJ621238_1283340 Echinococcus granulosus mRNA for malate dehy...   327   3e-88   
gb:AF280052_1258555 Nucella lapillus mitochondrial malate dehydr...   326   8e-88   
sp|O02640|MDHM_CAEEL|MDHM_CAEEL Probable malate dehydrogenase, mitochondria...   323   5e-87   Caenorhabditis elegans [roundworm]
pir|T08015|T08015 probable malate dehydrogenase (EC 1.1.1.37) pr...   322   9e-87   Brassica napus [oilseed rape]
gb:AE017347_1757992 Cryptococcus neoformans var. neoformans JEC2...   322   1e-86   
gb:PSP16748_1702276 Piromyces sp. E2 mRNA for malate dehydrogenase.   320   5e-86   
gb:CR382130_1662991 Yarrowia lipolytica chromosome D of strain C...   308   2e-82   
gb:CR382134_1667079 Debaryomyces hansenii chromosome B of strain...   306   5e-82   
gb:AF084828_1767075 Malassezia furfur major allergenic protein M...   305   2e-81   
gb:AY826858_1629164 Isochrysis galbana clone ISMD1 malate dehydr...   302   1e-80   
sp|Q9CN86|MDH_PASMU|MDH_PASMU Malate dehydrogenase (EC 1.1.1.37).>gb:AE006...   301   2e-80   Pasteurella multocida
gb:PIGMDH_1443191 Pig mitochondrial malate dehydrogenase (mMDH) ...   299   8e-80   
gb:AF027739_1234356 Trypanosoma brucei malate dehydrogenase (mMD...   299   8e-80   
gb:AJ863165_1814972 Orpinomyces sp. OUS1 partial mdh1 gene for p...   298   2e-79   
sp|Q7MYW9|MDH_PHOLL|MDH_PHOLL Malate dehydrogenase (EC 1.1.1.37).>gb:BX571...   298   2e-79   Photorhabdus laumondii subsp. laumondii
gb:CR382126_1659500 Kluyveromyces lactis strain NRRL Y-1140 chro...   297   3e-79   
sp|Q87SU7|MDH_VIBPA|MDH_VIBPA Malate dehydrogenase (EC 1.1.1.37).>gb:BA000...   296   5e-79   
gb:AF487682_1804300 Talaromyces emersonii malate dehydrogenase (...   296   9e-79   
gb:AF439996_1800036 Talaromyces emersonii malate dehydrogenase (...   294   3e-78   
gb:CR380958_1653298 Candida glabrata strain CBS138 chromosome L ...   294   3e-78   
gb:AY288068_1594815 Paracoccidioides brasiliensis malate dehydro...   293   6e-78   
gb:AE017340_456237 Idiomarina loihiensis L2TR, complete genome.       292   1e-77   
gb:AY773261_645871 Actinobacillus succinogenes plasmid pKNJ NAD(...   291   2e-77   
gb:AF117876_480383 Vibrio cholerae isolate M551 malate dehydroge...   291   3e-77   
sp|P44427|MDH_HAEIN|MDH_HAEIN Malate dehydrogenase (EC 1.1.1.37).>pir|C641...   290   4e-77   Haemophilus influenzae
gb:AF117859_480366 Vibrio cholerae isolate M557 malate dehydroge...   290   5e-77   
gb:AE016817_1747536 Ashbya gossypii (= Eremothecium gossypii) AT...   289   9e-77   
gb:AB185127_16703 Moritella sp. 38C1 mdh gene for malate dehydro...   289   9e-77   
pir|T41286|T41286 malate dehydrogenase precursor, mitochondrial ...   289   9e-77   Schizosaccharomyces pombe
gb:AB187217_16866 Moritella yayanosii mdh gene for malate dehydr...   288   1e-76   
sp|P17505|MDHM_YEAST|MDHM_YEAST Malate dehydrogenase, mitochondrial precurs...   288   2e-76   Saccharomyces cerevisiae [brewer's yeast]
gb:AY557914_1614141 Saccharomyces cerevisiae clone FLH004209.01X...   288   2e-76   
gb:AF117866_480373 Vibrio cholerae isolate M535 malate dehydroge...   288   2e-76   
gb:AB185121_16697 Moritella sp. 36B1 mdh gene for malate dehydro...   288   2e-76   
pir|G82324|G82324 malate dehydrogenase VC0432 [imported] - Vibri...   288   2e-76   Vibrio cholerae
sp|Q9KUT3|MDH_VIBCH|MDH_VIBCH Malate dehydrogenase (EC 1.1.1.37).>gb:VCH57...   288   2e-76   
sp|Q7X3X5|MDH_MORS2|MDH_MORS2 Malate dehydrogenase (EC 1.1.1.37).>gb:AB097...   287   4e-76   Moritella sp.
gb:AE016767_327969 Escherichia coli CFT073 section 13 of 18 of t...   286   6e-76   
sp|Q8DEC2|MDH_VIBVU|MDH_VIBVU Malate dehydrogenase (EC 1.1.1.37).>gb:AE016...   286   6e-76   Vibrio vulnificus
sp|Q83Q04|MDH_SHIFL|MDH_SHIFL Malate dehydrogenase (EC 1.1.1.37).>gb:AE005...   286   6e-76   Shigella flexneri
sp|P82177|MDH_SHEON|MDH_SHEON Malate dehydrogenase (EC 1.1.1.37).>gb:AE015...   286   6e-76   Shewanella oneidensis
sp|P48364|MDH_MORS5|MDH_MORS5 Malate dehydrogenase (EC 1.1.1.37).>gb:VIBMD...   286   6e-76   Moritella sp.
sp|P61891|MDH_ECO57|MDH_ECO57 Malate dehydrogenase (EC 1.1.1.37).>sp|P6189...   286   6e-76   Escherichia coli O157:H7
gb:AY309494_1597888 Triticum aestivum glyoxysomal malate dehydro...   286   7e-76   
gb:AF293125_496599 Escherichia coli isolate M1379_F4A malate deh...   286   7e-76   
gb:AB185126_16702 Moritella sp. 56A1 mdh gene for malate dehydro...   286   7e-76   
gb:AF293131_496611 Escherichia coli isolate M1347_B7 malate dehy...   286   9e-76   
gb:AF117862_480369 Vibrio cholerae isolate M548 malate dehydroge...   286   9e-76   
gb:AB187218_16867 Moritella japonica mdh gene for malate dehydro...   286   9e-76   
gb:AB185124_16700 Shewanella sp. 33F1 mdh gene for malate dehydr...   286   9e-76   
gb:AB185122_16698 Moritella sp. 36C1 mdh gene for malate dehydro...   286   9e-76   
gb:AF293155_496659 Escherichia coli isolate M1354_D7 malate dehy...   285   1e-75   
gb:AF293114_496577 Escherichia coli isolate M1362_F1A malate deh...   285   1e-75   
gb:AF293106_496562 Escherichia coli isolate M1378_D8 malate dehy...   285   1e-75   
sp|Q7MP97|MDH_VIBVY|MDH_VIBVY Malate dehydrogenase (EC 1.1.1.37).>gb:BA000...   285   1e-75   Vibrio vulnificus
gb:AF293129_496607 Escherichia coli isolate M1368_B9 malate dehy...   285   2e-75   
gb:AB185118_16694 Moritella sp. 16F1 mdh gene for malate dehydro...   285   2e-75   
gb:AB185116_16692 Moritella sp. 47A1 mdh gene for malate dehydro...   285   2e-75   
sp|P61892|MDH_YERPE|MDH_YERPE Malate dehydrogenase (EC 1.1.1.37).>sp|P6189...   284   3e-75   Yersinia pestis
gb:AF293157_496663 Escherichia coli isolate ECOR37 malate dehydr...   284   4e-75   
gb:AF293105_496561 Escherichia coli isolate M1350_B13 malate deh...   284   4e-75   
gb:ECMDH1_126604 E. coli mdh gene for malate dehydrogenase.           284   4e-75   
gb:AB187216_16865 Moritella marina mdh gene for malate dehydroge...   284   4e-75   
sp|Q7WS85|MDH_SALPA|MDH_SALPA Malate dehydrogenase (EC 1.1.1.37).>sp|Q8Z3E...   284   4e-75   Salmonella enterica subsp. enterica serovar Paratyphi A
sp|P25077|MDH_SALTY|MDH_SALTY Malate dehydrogenase (EC 1.1.1.37).>gb:CP000...   283   5e-75   Salmonella enterica subsp. enterica serovar Typhimurium
gb:AF293130_496609 Escherichia coli isolate M1381_D2 malate dehy...   282   1e-74   
gb:AB185120_16696 Shewanella sp. T4609 mdh gene for malate dehyd...   282   1e-74   
gb:ECOMDHA_129391 E. coli mdh gene encoding malate dehydrogenase...   282   1e-74   
gb:AE016827_342895 Mannheimia succiniciproducens MBEL55E, comple...   281   2e-74   
gb:AB185117_16693 Moritella sp. 47B1 mdh gene for malate dehydro...   281   2e-74   
gb:AF293156_496661 Escherichia coli isolate M1372_D1 malate dehy...   280   4e-74   
gb:CP000020_870452 Vibrio fischeri ES114 chromosome I, complete ...   280   5e-74   
pir|S16143|DEEBM malate dehydrogenase (EC 1.1.1.37) - Salmonella...   279   9e-74   
gb:AY320470_609243 Salmonella paratyphi strain ZJ-74 malate dehy...   279   1e-73   
sp|P37226|MDH_PHOPR|MDH_PHOPR Malate dehydrogenase (EC 1.1.1.37).>gb:CR378...   277   4e-73   
gb:AY089402_1297058 Drosophila melanogaster AT22817 full insert ...   276   6e-73   
gb:AY075238_1296086 Drosophila melanogaster AT19883 full length ...   276   6e-73   
gb:AE014296_1136088 Drosophila melanogaster chromosome 3L, compl...   276   7e-73   
gb:AE014296_1136087 Drosophila melanogaster chromosome 3L, compl...   276   7e-73   
gb:PHRMALATE_158448 Photobacterium SS9 malate dehydrogenase (mdh...   275   2e-72   
gb:BX950851_839436 Erwinia carotovora subsp. atroseptica SCRI104...   275   2e-72   
gb:AE017347_1757951 Cryptococcus neoformans var. neoformans JEC2...   270   4e-71   
sp|Q59838|MDH_SALMU|MDH_SALMU Malate dehydrogenase (EC 1.1.1.37) (Fragment...   269   9e-71   Salmonella enterica subsp. enterica serovar Muenchen
gb:CR382131_1664044 Yarrowia lipolytica chromosome E of strain C...   269   1e-70   
gb:AF091759_478529 Escherichia coli isolate RL012A malate dehydr...   268   3e-70   
gb:AF004202_467390 Escherichia coli malate dehydrogenase (mdh) g...   268   3e-70   
gb:AF004200_467388 Escherichia coli malate dehydrogenase (mdh) g...   268   3e-70   
gb:AF091771_478541 Escherichia coli isolate RT083 malate dehydro...   267   3e-70   
gb:AF091758_478528 Escherichia coli isolate MB001D malate dehydr...   267   5e-70   
gb:SEU04784_182287 Salmonella enterica isolate S3041 malate dehy...   267   5e-70   
gb:AF091770_478540 Escherichia coli isolate RT082 malate dehydro...   266   6e-70   
gb:AF004199_467387 Escherichia coli malate dehydrogenase (mdh) g...   266   6e-70   
gb:AF004197_467385 Escherichia coli malate dehydrogenase (mdh) g...   266   6e-70   
gb:SEU04786_182288 Salmonella enterica isolate S3053 malate dehy...   266   6e-70   
gb:SEU04777_182280 Salmonella enterica isolate S3025 malate dehy...   266   6e-70   
gb:AF230579_490583 Escherichia coli 2314 malate dehydrogenase (m...   266   8e-70   
gb:AF004201_467389 Escherichia coli malate dehydrogenase (mdh) g...   266   8e-70   
gb:AF004181_467369 Escherichia coli malate dehydrogenase (mdh) g...   266   8e-70   
gb:AF004170_467358 Escherichia coli malate dehydrogenase (mdh) g...   266   8e-70   
gb:SEU04782_182285 Salmonella enterica isolate S3051 malate dehy...   266   8e-70   
gb:SEU04780_182283 Salmonella enterica isolate S2980 malate dehy...   266   8e-70   
gb:SEU04769_182273 Salmonella enterica isolate S2985 malate dehy...   266   8e-70   
gb:SEU04764_182268 Salmonella enterica Typhi malate dehydrogenas...   266   8e-70   
gb:AF091775_478545 Escherichia coli isolate RT272 malate dehydro...   266   1e-69   
gb:SEU04773_182276 Salmonella enterica isolate S3013 malate dehy...   266   1e-69   
gb:SEU04763_182267 Salmonella enterica Newport malate dehydrogen...   266   1e-69   
gb:SEU04761_182265 Salmonella enterica Gallinarium malate dehydr...   266   1e-69   
gb:ECU04757_132999 Escherichia coli isolate E830587 malate dehyd...   266   1e-69   
gb:ECU04756_132998 Escherichia coli isolate E2666-74 malate dehy...   266   1e-69   
gb:ECU04746_132988 Escherichia coli isolate EC38 malate dehydrog...   266   1e-69   
gb:ECU04745_132987 Escherichia coli isolate EC35 malate dehydrog...   266   1e-69   
gb:ECU04742_132984 Escherichia coli isolate EC10 malate dehydrog...   266   1e-69   
gb:AF071029_476000 Escherichia coli isolate 5624-50 malate dehyd...   265   1e-69   
gb:SEU04772_182275 Salmonella enterica isolate S2991 malate dehy...   265   1e-69   
gb:CR382134_1667059 Debaryomyces hansenii chromosome B of strain...   265   2e-69   
gb:AF004198_467386 Escherichia coli malate dehydrogenase (mdh) g...   265   2e-69   
gb:AF004178_467366 Escherichia coli malate dehydrogenase (mdh) g...   265   2e-69   
gb:AF230656_490666 Escherichia sp. Souza-57 malate dehydrogenase...   265   2e-69   
gb:AF230655_490665 Enterobacter cloacae malate dehydrogenase (md...   265   2e-69   
gb:AF230592_490596 Escherichia coli 1930 malate dehydrogenase (m...   264   3e-69   
gb:AF230574_490578 Escherichia coli 55 malate dehydrogenase (mdh...   264   3e-69   
gb:SEU04766_182270 Salmonella enterica Typhimurium isolate S1164...   264   3e-69   
gb:AF267605_494011 Escherichia coli strain 5905 malate dehydroge...   264   4e-69   
gb:AF004185_467373 Escherichia coli malate dehydrogenase (mdh) g...   264   4e-69   
gb:ECU04750_132992 Escherichia coli isolate EC49 malate dehydrog...   264   4e-69   
gb:ECU04749_132991 Escherichia coli isolate EC47 malate dehydrog...   264   4e-69   
gb:SEU04779_182282 Salmonella enterica isolate S2978 malate dehy...   263   5e-69   
gb:AF230657_490667 Escherichia sp. Souza-207 malate dehydrogenas...   263   7e-69   
gb:AF267618_494024 Escherichia coli strain 536 malate dehydrogen...   262   1e-68   
gb:AY268631_604384 Salmonella enterica strain SARB35 malate dehy...   262   1e-68   
sp|Q7VP41|MDH_HAEDU|MDH_HAEDU Malate dehydrogenase (EC 1.1.1.37).>gb:AE017...   262   1e-68   [Haemophilus] ducreyi
gb:AY268636_604389 Salmonella enterica strain SARB02 malate dehy...   261   3e-68   
gb:AF267607_494013 Escherichia coli strain DEC8b malate dehydrog...   261   3e-68   
gb:AF267599_494005 Escherichia coli strain E2348/69 malate dehyd...   261   3e-68   
gb:AF230658_490668 Escherichia sp. Souza-273 malate dehydrogenas...   261   3e-68   
gb:ECO287808_127276 Escherichia coli partial mdh gene for malatd...   261   3e-68   
gb:AF267606_494012 Escherichia coli strain DEC5d malate dehydrog...   260   4e-68   
gb:ECO287795_127263 Escherichia coli partial mdh gene for malatd...   260   4e-68   
gb:AE016817_1747636 Ashbya gossypii (= Eremothecium gossypii) AT...   259   9e-68   
gb:AY268662_604415 Salmonella enterica strain SARB43 malate dehy...   259   9e-68   
gb:AY268678_604431 Salmonella enterica strain SARB63 malate dehy...   259   1e-67   
gb:AY268635_604388 Salmonella enterica strain SARB58 malate dehy...   259   1e-67   
gb:AF267616_494022 Escherichia coli strain G5506 malate dehydrog...   259   1e-67   
gb:AF267613_494019 Escherichia coli strain 90-1787 malate dehydr...   259   1e-67   
gb:AF267609_494015 Escherichia coli strain DEC9f malate dehydrog...   259   1e-67   
gb:AY268680_604433 Salmonella enterica strain SARB61 malate dehy...   258   2e-67   
gb:AY268676_604429 Salmonella enterica strain SARB38 malate dehy...   258   2e-67   
gb:AY268655_604408 Salmonella enterica strain SARB21 malate dehy...   258   2e-67   
gb:AY268620_604373 Salmonella enterica strain SARB08 malate dehy...   258   2e-67   
gb:AF267602_494008 Escherichia coli strain 93-111 malate dehydro...   258   2e-67   
gb:AF267604_494010 Escherichia coli strain DEC3f malate dehydrog...   258   2e-67   
gb:AF267617_494023 Escherichia coli strain 921-B4 malate dehydro...   258   3e-67   
gb:AY268628_604381 Salmonella enterica strain SARB69 malate dehy...   257   4e-67   
gb:AY826857_1629163 Heterocapsa triquetra clone HTMD1 malate deh...   256   8e-67   
gb:AY268687_604440 Salmonella enterica strain SARB54 malate dehy...   255   1e-66   
gb:AF208608_488506 Pantoea cedenensis strain 34 malate dehydroge...   255   1e-66   
gb:AF208609_488507 Pantoea cedenensis strain 35 malate dehydroge...   255   2e-66   
gb:AF208607_488505 Pantoea endophytica strain 3 malate dehydroge...   254   3e-66   
gb:AF208615_488512 Pantoea endophytica strain 47 malate dehydrog...   252   2e-65   
gb:AF208599_488497 Pantoea endophytica strain 1 malate dehydroge...   251   3e-65   
gb:AF208604_488502 Pantoea endophytica strain 19 malate dehydrog...   251   3e-65   
gb:AY839664_647250 Pasteurella trehalosi strain PH246 malate deh...   250   6e-65   
gb:AF208612_488510 Pantoea endophytica strain 45 malate dehydrog...   250   6e-65   
gb:AF208602_488500 Pantoea endophytica strain 17 malate dehydrog...   250   6e-65   
gb:AF208611_488509 Pantoea toletana strain 37 malate dehydrogena...   248   2e-64   
gb:AF208603_488501 Pantoea endophytica strain 18 malate dehydrog...   248   2e-64   
gb:AF208600_488498 Pantoea endophytica strain 11 malate dehydrog...   248   2e-64   
gb:AF208620_488516 Pantoea agglomerans strain ATCC27155 malate d...   247   5e-64   
gb:AF208605_488503 Pantoea agglomerans strain 22 malate dehydrog...   247   5e-64   
gb:AF208619_488515 Erwinia herbicola strain NCPPB 2971 malate de...   246   6e-64   
gb:AF208601_488499 Pantoea endophytica strain 16 malate dehydrog...   246   6e-64   
gb:AF208613_488511 Pantoea endophytica strain 46 malate dehydrog...   246   1e-63   
gb:AF208617_488513 Pantoea endophytica strain 8 malate dehydroge...   245   1e-63   
gb:AF208606_488504 Pantoea agglomerans strain 28 malate dehydrog...   244   3e-63   
gb:AF208610_488508 Pantoea oleae strain 36 malate dehydrogenase ...   241   3e-62   
gb:CR382138_1671085 Debaryomyces hansenii chromosome F of strain...   241   3e-62   
gb:AY839663_647249 Mannheimia glucosida strain PH344 malate dehy...   236   7e-61   
sp|P61896|MDH_KLEVA|MDH_KLEVA Malate dehydrogenase (EC 1.1.1.37) (Fragment...   235   1e-60   Klebsiella variicola
gb:AY839662_647248 Mannheimia haemolytica strain PH196 malate de...   233   6e-60   
gb:AY839657_647243 Mannheimia haemolytica strain PH2 malate dehy...   233   6e-60   
gb:AY839660_647246 Mannheimia haemolytica strain PH588 malate de...   233   7e-60   
gb:AF208618_488514 Pantoea oleae strain 66 malate dehydrogenase ...   233   7e-60   
sp|P61894|MDH_KLEOX|MDH_KLEOX Malate dehydrogenase (EC 1.1.1.37) (Fragment...   232   2e-59   Klebsiella oxytoca
gb:AY367379_613449 Klebsiella variicola strain F2R9 Mdh gene, pa...   231   3e-59   
gb:AY367377_613447 Klebsiella variicola strain 6A2 Mdh gene, par...   231   3e-59   
sp|Q9L8F6|MDH_VIBMI|MDH_VIBMI Malate dehydrogenase (EC 1.1.1.37) (Fragment...   231   3e-59   Vibrio mimicus
gb:AF238330_491558 Vibrio cholerae strain 151 Mdh (mdh) gene, pa...   227   4e-58   
gb:AF238329_491557 Vibrio cholerae strain 569B Mdh (mdh) gene, p...   226   1e-57   
gb:AF051893_1236722 Trypanosoma cruzi putative malate dehydrogen...   225   2e-57   
sp|P61895|MDH_KLETE|MDH_KLETE Malate dehydrogenase (EC 1.1.1.37) (Fragment...   225   2e-57   Raoultella terrigena
gb:CR380958_1653368 Candida glabrata strain CBS138 chromosome L ...   224   3e-57   
gb:AF079110_1239493 Trypanosoma brucei glycosomal malate dehydro...   224   4e-57   
pir|S67614|DEBYMP malate dehydrogenase (EC 1.1.1.37), peroxisoma...   224   4e-57   
sp|P32419|MDHP_YEAST|MDHP_YEAST Malate dehydrogenase, peroxisomal (EC 1.1.1...   224   4e-57   Saccharomyces cerevisiae [brewer's yeast]
gb:AY800091_646269 Vibrio mimicus strain PT48 malate dehydrogena...   223   6e-57   
gb:AY800079_646258 Vibrio cholerae strain 2740-80 malate dehydro...   223   6e-57   
gb:AY800095_646273 Vibrio mimicus strain 531-90 malate dehydroge...   223   8e-57   
gb:YSCMDH3A_1729873 Saccharomyces cerevisiae malate dehydrogenas...   222   2e-56   
gb:AF284097_1258765 Phytomonas sp. isolate Ech1 malate dehydroge...   222   2e-56   
gb:AY800089_646267 Vibrio cholerae strain SG10 malate dehydrogen...   222   2e-56   
gb:AK002305_1151109 Mus musculus adult male kidney cDNA, RIKEN f...   221   2e-56   
gb:AY698641_642245 Shigella flexneri strain 2794-71 malate dehyd...   220   5e-56   
gb:AY698637_642241 Escherichia coli strain 5898-71 malate dehydr...   219   8e-56   
gb:CAR275317_1645202 Cicer arietinum partial mRNA for malate deh...   219   1e-55   
gb:AY698739_642343 Shigella boydii strain K-649 malate dehydroge...   218   2e-55   
gb:AY698695_642299 Shigella boydii strain C-425 malate dehydroge...   218   2e-55   
gb:AY698653_642257 Shigella dysenteriae strain 3470-56 malate de...   218   2e-55   
gb:AY698646_642250 Shigella boydii strain 3594-74 malate dehydro...   218   2e-55   
gb:AY698638_642242 Escherichia coli strain 929-78 malate dehydro...   218   2e-55   
gb:AY698688_642292 Shigella flexneri strain K-315 malate dehydro...   218   3e-55   
gb:AY698642_642246 Shigella boydii strain 291-75 malate dehydrog...   218   3e-55   
gb:AY698639_642243 Shigella flexneri strain 1170-74 malate dehyd...   218   3e-55   
gb:AY698636_642240 Escherichia coli strain 202-72 malate dehydro...   218   3e-55   
gb:AY698647_642251 Shigella boydii strain 3615-53 malate dehydro...   217   4e-55   
gb:AY698678_642282 Shigella flexneri strain 1043-82 malate dehyd...   217   5e-55   
gb:AY698672_642276 Escherichia coli strain LT-91 malate dehydrog...   217   5e-55   
gb:AY698670_642274 Escherichia coli strain LT-68 malate dehydrog...   217   5e-55   
gb:AY698658_642262 Shigella flexneri strain 2747-71 malate dehyd...   217   5e-55   
gb:AF238336_491564 Vibrio mimicus strain PT5 Mdh (mdh) gene, par...   217   5e-55   
gb:AY800081_646260 Vibrio cholerae strain 151 malate dehydrogena...   216   7e-55   
gb:AY698666_642270 Escherichia coli strain LT-15 malate dehydrog...   216   7e-55   
gb:AY138130_1303058 Plicopurpura patula mitochondrial malate deh...   216   1e-54   
gb:AY698655_642259 Shigella dysenteriae strain 1007-74 malate de...   215   2e-54   
gb:AY698696_642300 Shigella dysenteriae strain K-906 (A1) malate...   214   3e-54   
gb:AY698635_642239 Escherichia coli strain 1885-77 malate dehydr...   214   3e-54   
gb:AY696937_641325 Shigella boydii strain 1610-55 malate dehydro...   214   3e-54   
gb:AY698656_642260 Shigella dysenteriae strain 155-74 malate deh...   214   3e-54   
gb:AF238335_491563 Vibrio mimicus strain 523-80 Mdh (mdh) gene, ...   214   3e-54   
gb:AY698682_642286 Escherichia coli strain MT#80 malate dehydrog...   214   5e-54   
gb:CR382126_1659110 Kluyveromyces lactis strain NRRL Y-1140 chro...   213   8e-54   
gb:AY138126_1303054 Sepia officinalis mitochondrial malate dehyd...   213   8e-54   
gb:LMFL4520_1388065 Leishmania major Friedlin chromosome 19 cosm...   213   1e-53   
gb:AY138127_1303055 Littorina littorea mitochondrial malate dehy...   213   1e-53   
gb:AY698736_642340 Shigella boydii strain K-539 malate dehydroge...   212   1e-53   
gb:AY698684_642288 Shigella flexneri strain K-212 malate dehydro...   212   1e-53   
gb:AY698660_642264 Shigella dysenteriae strain 5514-56 malate de...   212   1e-53   
gb:AY698712_642316 Shigella flexneri strain K-671 malate dehydro...   211   2e-53   
gb:AY698665_642269 Escherichia coli strain 395-2 malate dehydrog...   211   2e-53   
gb:AY698661_642265 Escherichia coli strain 277-84 malate dehydro...   211   2e-53   
gb:AY698645_642249 Shigella boydii strain 3408-67 malate dehydro...   211   2e-53   
gb:AY696947_641335 Shigella boydii strain 3553-77 malate dehydro...   211   2e-53   
gb:AY138129_1303057 Calyptraea chinensis mitochondrial malate de...   211   3e-53   
gb:AY698689_642293 Shigella flexneri strain K-272 malate dehydro...   211   4e-53   
gb:AY696958_641346 Escherichia albertii strain 12502 malate dehy...   211   4e-53   
gb:AY698685_642289 Shigella flexneri strain K-482 malate dehydro...   210   5e-53   
gb:AY696954_641342 Shigella boydii strain 3552-77 malate dehydro...   210   7e-53   
gb:AY696945_641333 Shigella boydii strain 2046-51 malate dehydro...   210   7e-53   
gb:AJ875445_534338 Escherichia coli partial arcA gene for negati...   209   1e-52   
gb:AY138125_1303053 Nucella freycineti mitochondrial malate dehy...   209   1e-52   
gb:AY698677_642281 Shigella flexneri strain 1485-50 malate dehyd...   209   1e-52   
gb:AY698657_642261 Shigella flexneri strain 2702-71 malate dehyd...   209   1e-52   
gb:AY696944_641332 Shigella boydii strain K-1 malate dehydrogena...   209   1e-52   
gb:AY696936_641324 Escherichia albertii strain 9194 malate dehyd...   209   1e-52   
gb:AY698698_642302 Shigella dysenteriae strain 215 (A10) malate ...   208   2e-52   
gb:AY698674_642278 Escherichia coli strain LT-99 malate dehydrog...   207   3e-52   
gb:AY138131_1303059 Monodonta lineata mitochondrial malate dehyd...   207   4e-52   
gb:AC008239_1204157 Leishmania major strain Friedlin clone L9003...   207   4e-52   
gb:AY698701_642305 Shigella dysenteriae strain VA-116 (N) malate...   207   4e-52   
gb:AY698693_642297 Shigella boydii strain K-2085 malate dehydrog...   207   4e-52   
gb:AY698709_642313 Shigella dysenteriae strain K-718 malate dehy...   207   6e-52   
gb:AY698690_642294 Shigella flexneri strain K-147 malate dehydro...   207   6e-52   
gb:AY698667_642271 Escherichia coli strain LT-26 malate dehydrog...   206   9e-52   
gb:AY138128_1303056 Buccinum undatum mitochondrial malate dehydr...   206   1e-51   
gb:AY696938_641326 Shigella boydii strain 3556-77 malate dehydro...   205   2e-51   
gb:AY698706_642310 Shigella dysenteriae strain K-1464 malate deh...   204   4e-51   
gb:AF284096_1258764 Phytomonas sp. isolate Ech1 2-hydroxyacid de...   204   5e-51   
gb:AY698703_642307 Shigella dysenteriae strain K-490 (A1) malate...   203   8e-51   
gb:AY698743_642347 Shigella sonnei strain K-368 malate dehydroge...   202   1e-50   
gb:AY698717_642321 Shigella flexneri strain K-404 malate dehydro...   201   2e-50   
gb:AY698634_642238 Escherichia coli strain DEC6A malate dehydrog...   201   2e-50   
gb:AY696957_641345 Escherichia albertii strain 10790 malate dehy...   201   2e-50   
gb:AY696943_641331 Shigella boydii strain K-694 malate dehydroge...   201   2e-50   
gb:AY696942_641330 Shigella boydii strain 3557-77 malate dehydro...   201   2e-50   
gb:AY698705_642309 Shigella dysenteriae strain K-1505 malate deh...   200   5e-50   
gb:AY698694_642298 Shigella flexneri strain SA100 malate dehydro...   200   5e-50   
gb:AY698691_642295 Shigella flexneri strain K-820 malate dehydro...   200   5e-50   
gb:AY698687_642291 Shigella flexneri strain K-66 malate dehydrog...   200   5e-50   
gb:AY696941_641329 Shigella boydii strain 5216-70 malate dehydro...   200   5e-50   
gb:AY698686_642290 Shigella flexneri strain K-265 malate dehydro...   200   7e-50   
gb:AY696956_641344 Escherichia albertii strain 10457 malate dehy...   200   7e-50   
gb:AY696955_641343 Escherichia albertii strain 19982 malate dehy...   200   7e-50   
gb:AY696939_641327 Shigella boydii strain 3052-94 malate dehydro...   200   7e-50   
gb:AY698707_642311 Shigella dysenteriae strain K-1453 malate deh...   198   2e-49   
gb:AE016817_1747220 Ashbya gossypii (= Eremothecium gossypii) AT...   197   3e-49   
gb:AY698699_642303 Shigella dysenteriae strain 49 (B1) malate de...   197   6e-49   
gb:AY698697_642301 Shigella dysenteriae strain K-3050 (A9) malat...   197   6e-49   
gb:CR380951_1650008 Candida glabrata strain CBS138 chromosome E ...   191   3e-47   
gb:YSCMDH2_1729872 S.cerevisiae malate dehydrogenase cytosolic i...   188   3e-46   
gb:AJ629673_528400 Escherichia coli partial mdh gene for malate ...   188   3e-46   
pir|S63444|DEBYMC malate dehydrogenase (EC 1.1.1.37), cytosolic ...   188   3e-46   
sp|P22133|MDHC_YEAST|MDHC_YEAST Malate dehydrogenase, cytoplasmic (EC 1.1.1...   188   3e-46   
gb:AJ629681_528408 Escherichia coli partial mdh gene for malate ...   187   6e-46   
gb:AY627167_637863 Escherichia coli isolate ECOR17 malate dehydr...   186   1e-45   
gb:AY627169_637867 Escherichia coli isolate ECOR26 malate dehydr...   184   3e-45   
gb:CR382125_1657551 Kluyveromyces lactis strain NRRL Y-1140 chro...   181   4e-44   
gb:AY832977_647012 Escherichia coli isolate 079 malate dehydroge...   181   4e-44   
sp|P37227|MDHM_SCHMA|MDHM_SCHMA Malate dehydrogenase, mitochondrial (EC 1.1...   180   6e-44   
gb:AY832979_647014 Escherichia coli isolate 145 malate dehydroge...   177   4e-43   
gb:AY832974_647009 Escherichia coli isolate 044 malate dehydroge...   176   8e-43   
gb:AF343308_503100 Vibrio cholerae O139 strain CO391 malate dehy...   176   1e-42   
gb:AF343280_503072 Vibrio cholerae O139 strain SG24 malate dehyd...   176   1e-42   
gb:AY832978_647013 Escherichia coli isolate 095 malate dehydroge...   175   2e-42   
gb:AY832975_647010 Escherichia coli isolate 156 malate dehydroge...   175   2e-42   
gb:AF540659_520506 Vibrio cholerae isolate GD9512 malate dehydro...   172   2e-41   
gb:AY832981_647016 Escherichia coli isolate 170 malate dehydroge...   170   6e-41   
gb:AY388577_615702 Escherichia coli strain 2P9 malate dehydrogen...   170   6e-41   
gb:AY464250_620893 Escherichia coli strain ECOR26 malate dehydro...   169   1e-40   
gb:AY832976_647011 Escherichia coli isolate 002 malate dehydroge...   168   3e-40   
gb:AY832980_647015 Escherichia coli isolate 166 malate dehydroge...   167   6e-40   
sp|P61897|MDH_PECCC|MDH_PECCC Malate dehydrogenase (EC 1.1.1.37) (Fragment...   163   7e-39   
gb:AY428968_617135 Pectobacterium carotovorum subsp. carotovorum...   161   3e-38   
gb:AY428972_617139 Pectobacterium carotovorum subsp. carotovorum...   160   6e-38   
gb:AY428971_617138 Pectobacterium carotovorum subsp. carotovorum...   159   1e-37   
gb:AY686538_640220 Escherichia fergusonii malate dehydrogenase (...   159   1e-37   
gb:AY428973_617140 Pectobacterium carotovorum subsp. carotovorum...   157   7e-37   
sp|P80535|MDH_KLEPN|MDH_KLEPN Malate dehydrogenase (EC 1.1.1.37) (Fragments).   154   4e-36   
gb:AY245392_601769 Haemophilus influenzae strain 794 malate dehy...   152   1e-35   
gb:AY428982_617149 Pectobacterium carotovorum subsp. carotovorum...   151   4e-35   
gb:AF233351_1416527 Ovis aries malate dehdrogenase mRNA, partial...   150   5e-35   
gb:AF536041_520184 Haemophilus influenzae isolate 1231 malate de...   150   5e-35   
gb:AF322753_500354 Haemophilus influenzae isolate e6181 malate d...   150   6e-35   
gb:AY728480_644185 Haemophilus influenzae strain 03-022 malate d...   150   8e-35   
gb:AF536048_520191 Haemophilus influenzae isolate 432 malate deh...   150   8e-35   
gb:AF322755_500356 Haemophilus influenzae isolate f6252 malate d...   150   8e-35   
gb:AF322746_500347 Haemophilus influenzae isolate c7424 malate d...   150   8e-35   
gb:AF322742_500343 Haemophilus influenzae isolate a1042 malate d...   150   8e-35   
gb:AY738773_644717 Haemophilus influenzae strain 04-1527 malate ...   149   1e-34   
gb:AF322740_500341 Haemophilus influenzae isolate 375 malate deh...   149   1e-34   
gb:AF322741_500342 Haemophilus influenzae isolate a7205 malate d...   149   1e-34   
gb:AF322763_500364 Haemophilus influenzae isolate c6132 malate d...   148   2e-34   
gb:AY738766_644710 Haemophilus influenzae strain 04-1190 malate ...   148   3e-34   
gb:AF322757_500358 Haemophilus influenzae isolate 1124 malate de...   148   3e-34   
gb:AY428981_617148 Pectobacterium carotovorum subsp. carotovorum...   147   7e-34   
gb:AY428988_617155 Pectobacterium carotovorum subsp. carotovorum...   142   1e-32   
gb:AY428985_617152 Pectobacterium carotovorum subsp. carotovorum...   142   1e-32   
gb:AJ635393_529098 Klebsiella pneumoniae partial mdh gene for ma...   140   6e-32   
gb:AJ635373_529078 Klebsiella pneumoniae partial mdh gene for ma...   140   6e-32   
gb:AJ635372_529077 Klebsiella pneumoniae partial mdh gene for ma...   140   6e-32   
gb:AY428989_617156 Pectobacterium carotovorum subsp. carotovorum...   139   2e-31   
gb:AY428987_617154 Pectobacterium carotovorum subsp. carotovorum...   139   2e-31   
gb:AY428986_617153 Pectobacterium carotovorum subsp. carotovorum...   139   2e-31   
gb:AJ635390_529095 Klebsiella pneumoniae partial mdh gene for ma...   137   5e-31   
gb:AJ635391_529096 Klebsiella pneumoniae partial mdh gene for ma...   135   2e-30   
gb:AY428979_617146 Pectobacterium carotovorum subsp. carotovorum...   132   2e-29   
gb:AY428990_617157 Pectobacterium carotovorum subsp. carotovorum...   130   9e-29   
gb:AY428983_617150 Pectobacterium carotovorum subsp. carotovorum...   129   1e-28   
gb:AY428974_617141 Pectobacterium carotovorum subsp. carotovorum...   129   1e-28   
gb:AF068688_1765647 Glycine max clone d1 malate dehydrogenase (M...   127   6e-28   
pir|T06327|T06327 malate dehydrogenase (EC 1.1.1.37), mitochondr...   127   6e-28   
gb:AY428980_617147 Pectobacterium carotovorum subsp. carotovorum...   122   2e-26   
gb:AY334274_1320532 Cryptosporidium parvum malate dehydrogenase ...   115   2e-24   
gb:AY428975_617142 Pectobacterium carotovorum subsp. carotovorum...   115   2e-24   
gb:AY428984_617151 Pectobacterium carotovorum subsp. carotovorum...   115   2e-24   
gb:AF527542_1808396 Medicago sativa glyoxysomal malate dehydroge...   113   8e-24   
gb:AF540660_520507 Vibrio cholerae isolate GD98200 malate dehydr...   113   1e-23   
gb:AY428977_617144 Pectobacterium carotovorum subsp. carotovorum...   112   2e-23   
gb:AY428978_617145 Pectobacterium carotovorum subsp. carotovorum...   111   3e-23   
gb:AY428976_617143 Pectobacterium carotovorum subsp. carotovorum...   111   4e-23   
gb:AF540658_520505 Vibrio cholerae isolate GD98224 malate dehydr...   110   5e-23   
gb:AF540657_520504 Vibrio cholerae isolate GD64313 malate dehydr...   110   9e-23   
gb:AY428970_617137 Pectobacterium carotovorum subsp. carotovorum...   109   2e-22   
pir|AD3269|AD3269 malate dehydrogenase (EC 1.1.1.37) [imported] ...   107   6e-22   
gb:AY650028_1344031 Toxoplasma gondii strain RH malate dehydroge...   106   1e-21   
gb:AE014291_309333 Brucella suis 1330 chromosome I, complete seq...   106   1e-21   
sp|P80458|MDH_RHOPA|MDH_RHOPA Malate dehydrogenase (EC 1.1.1.37).>gb:BX572...   106   1e-21   
gb:AF513321_518013 Francisella tularensis subsp. novicida isolat...   105   3e-21   
gb:CP000030_83510 Anaplasma marginale str. St. Maries, complete ...   105   3e-21   
gb:BA000011_665563 Thermoplasma volcanium GSS1 DNA, complete gen...   103   9e-21   
gb:AY871918_2150082 Synthetic construct hypothetical protein (FT...   102   1e-20   
gb:AF513315_518007 Francisella tularensis subsp. holarctica isol...   102   1e-20   
gb:AF513300_517992 Francisella tularensis subsp. tularensis isol...   102   1e-20   
gb:AE017180_399762 Geobacter sulfurreducens PCA, complete genome.     101   4e-20   
sp|Q9HJL5|MDH_THEAC|MDH_THEAC Malate dehydrogenase (EC 1.1.1.37).>gb:TACID...   100   1e-19   
gb:BX897699_828235 Bartonella henselae strain Houston-1, complet...   100   1e-19   
sp|P80040|MDH_CHLAU|MDH_CHLAU Malate dehydrogenase (EC 1.1.1.37).>gb:CAMDH...    99   2e-19   
gb:BA000040_728716 Bradyrhizobium japonicum USDA 110 DNA, comple...    99   2e-19   
gb:BA000028_696553 Oceanobacillus iheyensis HTE831 DNA, complete...    99   2e-19   
gb:AP006840_569732 Symbiobacterium thermophilum DNA, complete ge...    99   2e-19   
sp|Q9EYJ6|MDH_RHIME|MDH_RHIME Malate dehydrogenase (EC 1.1.1.37).>gb:SME59...    99   3e-19   
gb:AE017261_420011 Picrophilus torridus DSM 9790, complete genome.     98   4e-19   
gb:AE016942_363277 Bacteroides thetaiotaomicron VPI-5482, sectio...    98   5e-19   
sp|Q92IA0|MDH_RICCN|MDH_RICCN Malate dehydrogenase (EC 1.1.1.37).>pir|H977...    98   5e-19   
gb:CP000001_854932 Bacillus cereus ZK, complete genome.                97   6e-19   
gb:AE017039_384768 Bacillus anthracis str. Ames section 16 of 18...    97   6e-19   
gb:CR925677_117678 Ehrlichia ruminantium str. Gardel, complete g...    97   6e-19   
gb:CR767821_116764 Ehrlichia ruminantium strain Welgevonden, com...    97   6e-19   
gb:BX897700_829543 Bartonella quintana str. Toulouse, complete g...    97   8e-19   
gb:AE017013_379455 Bacillus cereus ATCC 14579 section 16 of 18 o...    97   8e-19   
gb:AY181040_595350 Methylobacterium extorquens malate dehydrogen...    97   1e-18   
gb:AE017321_441877 Wolbachia endosymbiont strain TRS of Brugia m...    97   1e-18   
pir|G97675|G97675 malate dehydrogenase [imported] - Agrobacteriu...    97   1e-18   
gb:AP006841_574497 Bacteroides fragilis YCH46 DNA, complete genome.    96   1e-18   
gb:AE013433_292296 Methanosarcina mazei strain Goe1, section 215...    96   2e-18   
pir|AF2900|AF2900 malate dehydrogenase mdh [imported] - Agrobact...    96   2e-18   
sp|O33525|MDH_RHILV|MDH_RHILV Malate dehydrogenase (EC 1.1.1.37).>gb:RLAJ2...    96   2e-18   
gb:AE017260_418827 Wolbachia endosymbiont of Drosophila melanoga...    96   2e-18   
gb:AE017197_402349 Rickettsia typhi str. Wilmington complete gen...    96   2e-18   
gb:BA000012_669283 Mesorhizobium loti MAFF303099 DNA, complete g...    94   7e-18   
sp|Q9ZDF3|MDH_RICPR|MDH_RICPR Malate dehydrogenase (EC 1.1.1.37).>pir|A716...    94   7e-18   
gb:AE010743_266194 Methanosarcina acetivorans str. C2A, section ...    94   9e-18   
gb:AE017148_391324 Helicobacter hepaticus ATCC 51449 section 5 o...    92   2e-17   
gb:CTMDHG_119564 C.tepidum mdh gene.                                   92   2e-17   
sp|P80039|MDH_CHLTE|MDH_CHLTE Malate dehydrogenase (EC 1.1.1.37).>gb:AE012...    92   2e-17   
sp|Q9K849|MDH_BACHD|MDH_BACHD Malate dehydrogenase (EC 1.1.1.37).>pir|F840...    92   2e-17   
pir|E87702|E87702 malate dehydrogenase [imported] - Caulobacter ...    92   3e-17   
pir|I40383|I40383 malate dehydrogenase (EC 1.1.1.37) citH - Baci...    91   6e-17   
sp|P49814|MDH_BACSU|MDH_BACSU Malate dehydrogenase (EC 1.1.1.37) (Vegetati...    91   6e-17   
gb:AJ633546_528994 Myxococcus xanthus mdh gene for malate dehydr...    90   1e-16   
gb:CP000031_84410 Silicibacter pomeroyi DSS-3, complete genome.        90   1e-16   
pir|S75735|S75735 probable malate dehydrogenase (EC 1.1.1.37) - ...    90   1e-16   
gb:AE016745_322111 Staphylococcus epidermidis ATCC 12228, sectio...    89   2e-16   
gb:CP000029_80971 Staphylococcus epidermidis RP62A, complete gen...    89   2e-16   
sp|Q9X4K8|MDH_BACTC|MDH_BACTC Malate dehydrogenase (EC 1.1.1.37).>gb:AF114...    89   3e-16   
sp|Q59202|MDH_BACIS|MDH_BACIS Malate dehydrogenase (EC 1.1.1.37).>pir|S612...    89   3e-16   
sp|O67655|MDH_AQUAE|MDH_AQUAE Malate dehydrogenase (EC 1.1.1.37).>pir|E704...    89   3e-16   
gb:AE009872_256769 Pyrobaculum aerophilum strain IM2 section 127...    88   4e-16   
gb:AP006627_565032 Bacillus clausii KSM-K16 DNA, complete genome.      87   6e-16   
gb:AE017333_448887 Bacillus licheniformis DSM 13, complete genom...    87   8e-16   
gb:CP000027_79456 Dehalococcoides ethenogenes 195, complete genome.    87   8e-16   
sp|P80038|MDH_CHLVI|MDH_CHLVI Malate dehydrogenase (EC 1.1.1.37).>gb:CVMDH...    87   8e-16   
gb:BX294146_769289 Pirellula sp. strain 1 complete genome; segme...    86   2e-15   
gb:AF274310_1257830 Cryptosporidium parvum lactate dehydrogenase...    86   2e-15   
gb:BA000043_739311 Geobacillus kaustophilus HTA426 DNA, complete...    86   2e-15   
gb:BX571659_778417 Wolinella succinogenes, complete genome; segm...    84   5e-15   
sp|P93052|LDH_BOTBR|LDH_BOTBR L-lactate dehydrogenase (EC 1.1.1.27) (LDH)....    83   2e-14   
gb:AY324107_1319614 Plasmodium falciparum D6 malate dehydrogenas...    82   2e-14   
sp|P16115|LDH_THEMA|LDH_THEMA L-lactate dehydrogenase (EC 1.1.1.27) (L-LDH...    80   8e-14   
gb:AF068689_1765648 Glycine max clone a2 malate dehydrogenase (M...    78   4e-13   
gb:AE016776_330093 Pseudomonas putida KT2440 section 3 of 21 of ...    78   4e-13   
pir|T06328|T06328 malate dehydrogenase (EC 1.1.1.37) a2, mitocho...    78   4e-13   
sp|Q27797|LDH_TOXGO|LDH_TOXGO L-lactate dehydrogenase (EC 1.1.1.27) (LDH)....    78   5e-13   
gb:BA000045_742617 Gloeobacter violaceus PCC 7421 DNA, complete ...    77   7e-13   
pir|AC2346|AC2346 malate dehydrogenase [imported] - Nostoc sp. (...    77   7e-13   
gb:AY143389_1303430 Eimeria tenella lactate dehydrogenase (LDH) ...    77   9e-13   
gb:AY143388_1303429 Eimeria acervulina lactate dehydrogenase (LD...    74   1e-11   


>gb:STU488941_1723089 Solanum tuberosum mRNA for putative
            mitochondrial NAD-dependent malate dehydrogenase (mMDH
            gene), clone cSTB46C3.
          Length = 346

 Score =  525 bits (1352), Expect = e-148
 Identities = 273/346 (78%), Positives = 297/346 (85%), Gaps = 1/346 (0%)
 Frame = +2

Query: 125  MRSSMLRSLLKNSVSDG-SRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVS 301
            MR+SML+S+++ S + G S V+RRGFASGSAPERKVA+LGAAGGIGQPLSLLMKLNPLVS
Sbjct: 1    MRTSMLKSIVRRSSTAGESYVSRRGFASGSAPERKVAVLGAAGGIGQPLSLLMKLNPLVS 60

Query: 302  HLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRD 481
             LSL+DIAGTPGVAADVSHINTRSEVVGF+G+E LGKALEGAD+VIIPAGVPRKPGMTRD
Sbjct: 61   SLSLYDIAGTPGVAADVSHINTRSEVVGFAGEEQLGKALEGADIVIIPAGVPRKPGMTRD 120

Query: 482  DLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTT 661
            DLFNINAGIVKSL  AIAKYCP+ALVNMISNPVNSTVPIAAEVFKKAGTYDEK+LFGVT 
Sbjct: 121  DLFNINAGIVKSLCTAIAKYCPNALVNMISNPVNSTVPIAAEVFKKAGTYDEKKLFGVTM 180

Query: 662  LDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQ 841
            LDVVRAKTFY               +GGHAGITILPLFSQATP+ANL+++ IV LTKRTQ
Sbjct: 181  LDVVRAKTFYAGKAKVNVAEVNLPVVGGHAGITILPLFSQATPKANLSNEEIVALTKRTQ 240

Query: 842  DGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASK 1021
            DGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVEC+FVQS VTELPFFASK
Sbjct: 241  DGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECAFVQSNVTELPFFASK 300

Query: 1022 VRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXXXXXXXXGIQFANQN 1159
            VRLGKNGVEEVLGLG L ++                  GI+FA +N
Sbjct: 301  VRLGKNGVEEVLGLGPLNEYEKQGLEALKPELLSSIEKGIKFAKEN 346



>gb:STU488945_1723093 Solanum tuberosum mRNA for putative
            mitochondrial NAD-dependent malate dehydrogenase (mMDH
            gene), clone cSTA42B8.
          Length = 346

 Score =  522 bits (1345), Expect = e-147
 Identities = 272/346 (78%), Positives = 296/346 (85%), Gaps = 1/346 (0%)
 Frame = +2

Query: 125  MRSSMLRSLLKNSVSDG-SRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVS 301
            MR+SML+S+++ S + G S V+RRGFASGSAPERKVA+LGAAGGIGQPLSL MKLNPLVS
Sbjct: 1    MRTSMLKSIVRRSSTAGASYVSRRGFASGSAPERKVAVLGAAGGIGQPLSLPMKLNPLVS 60

Query: 302  HLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRD 481
             LSL+DIAGTPGVAADVSHINTRSEVVGF+G+E LGKALEGAD+VIIPAGVPRKPGMTRD
Sbjct: 61   SLSLYDIAGTPGVAADVSHINTRSEVVGFAGEEQLGKALEGADIVIIPAGVPRKPGMTRD 120

Query: 482  DLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTT 661
            DLFNINAGIVKSL  AIAKYCP+ALVNMISNPVNSTVPIAAEVFKKAGTYDEK+LFGVT 
Sbjct: 121  DLFNINAGIVKSLCTAIAKYCPNALVNMISNPVNSTVPIAAEVFKKAGTYDEKKLFGVTM 180

Query: 662  LDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQ 841
            LDVVRAKTFY               +GGHAGITILPLFSQATP+ANL+++ IV LTKRTQ
Sbjct: 181  LDVVRAKTFYAGKAKVNVAEVNLPVVGGHAGITILPLFSQATPKANLSNEEIVALTKRTQ 240

Query: 842  DGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASK 1021
            DGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVEC+FVQS VTELPFFASK
Sbjct: 241  DGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECAFVQSNVTELPFFASK 300

Query: 1022 VRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXXXXXXXXGIQFANQN 1159
            VRLGKNGVEEVLGLG L ++                  GI+FA +N
Sbjct: 301  VRLGKNGVEEVLGLGPLNEYEKQGLEALKPELLSSIEKGIKFAKEN 346



>gb:AY725474_1624501 Lycopersicon esculentum mitochondrial malate
            dehydrogenase (mMDH) mRNA, complete cds; nuclear gene for
            mitochondrial product.
          Length = 346

 Score =  521 bits (1342), Expect = e-146
 Identities = 271/346 (78%), Positives = 295/346 (85%), Gaps = 1/346 (0%)
 Frame = +2

Query: 125  MRSSMLRSLLKNSVSDG-SRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVS 301
            MR+SML+S+++ S + G S V+RRGFASGSAPERKVA+LGAAGGIGQPLSLLMKLNPLVS
Sbjct: 1    MRTSMLKSIVRRSSTAGASYVSRRGFASGSAPERKVAVLGAAGGIGQPLSLLMKLNPLVS 60

Query: 302  HLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRD 481
             LSL+DIAGTPGVAADVSHINTRSEV GF+G+E LG+ALEGADVVIIPAGVPRKPGMTRD
Sbjct: 61   SLSLYDIAGTPGVAADVSHINTRSEVAGFAGEEQLGQALEGADVVIIPAGVPRKPGMTRD 120

Query: 482  DLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTT 661
            DLFNINAGIVKSL  AIAKYCP+ALVNMISNPVNSTVPIAAEVFKKAGTYDEK+LFGVT 
Sbjct: 121  DLFNINAGIVKSLCTAIAKYCPNALVNMISNPVNSTVPIAAEVFKKAGTYDEKKLFGVTM 180

Query: 662  LDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQ 841
            LDVVRAKTFY               +GGHAGITILPLFSQATP+ANL+++ IV LTKRTQ
Sbjct: 181  LDVVRAKTFYAGKAKVNVAEVNLPVVGGHAGITILPLFSQATPKANLSYEEIVALTKRTQ 240

Query: 842  DGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASK 1021
            DGGTEVVEAKAGKGS TLS+AYAGAIFADACLKGLNGVPDVVEC+FVQS VTELPFFASK
Sbjct: 241  DGGTEVVEAKAGKGSXTLSIAYAGAIFADACLKGLNGVPDVVECAFVQSNVTELPFFASK 300

Query: 1022 VRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXXXXXXXXGIQFANQN 1159
            VRLGKNGVEEVLGLG L D+                  GI+FA +N
Sbjct: 301  VRLGKNGVEEVLGLGPLNDYEKQGLEALKPELLSSIEKGIKFAKEN 346



>gb:AF180335_1774805 Glycine max malate dehydrogenase (Mdh1) gene,
            complete cds; nuclear gene for mitochondrial product.
          Length = 345

 Score =  519 bits (1337), Expect = e-146
 Identities = 272/344 (79%), Positives = 286/344 (83%)
 Frame = +2

Query: 125  MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH 304
            M+ SMLRSL   +    S + RRG+AS   PERKVA+LGAAGGIGQPLSLLMKLNPLVS 
Sbjct: 2    MKPSMLRSLHSAATRGASHLFRRGYASEPVPERKVAVLGAAGGIGQPLSLLMKLNPLVSS 61

Query: 305  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD 484
            LSL+DIAGTPGVAAD+SHINTRSEVVG+ GDE LGKALEGADVVIIPAGVPRKPGMTRDD
Sbjct: 62   LSLYDIAGTPGVAADISHINTRSEVVGYQGDEELGKALEGADVVIIPAGVPRKPGMTRDD 121

Query: 485  LFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTL 664
            LFNINAGIVK+L  AIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTL
Sbjct: 122  LFNINAGIVKTLCTAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTL 181

Query: 665  DVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQD 844
            DVVRAKTFY               +GGHAGITILPLFSQATP+ANL  DVI  LTKRTQD
Sbjct: 182  DVVRAKTFYAGKANVPVAGVNVPVVGGHAGITILPLFSQATPKANLDDDVIKALTKRTQD 241

Query: 845  GGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKV 1024
            GGTEVVEAKAGKGSATLSMAYAGA+FADACLKGLNGVPDVVECSFVQSTVTELPFFASKV
Sbjct: 242  GGTEVVEAKAGKGSATLSMAYAGALFADACLKGLNGVPDVVECSFVQSTVTELPFFASKV 301

Query: 1025 RLGKNGVEEVLGLGSLTDFXXXXXXXXXXXXXXXXXXGIQFANQ 1156
            RLG  GVEEVLGLG L+DF                  GI+FANQ
Sbjct: 302  RLGTVGVEEVLGLGHLSDFEQQGLESLKPELKSSIEKGIKFANQ 345



>gb:STU488942_1723090 Solanum tuberosum mRNA for putative
            mitochondrial NAD-dependent malate dehydrogenase (mMDH
            gene), clone cSTA35K15.>gb:STU488943_1723091 Solanum
            tuberosum mRNA for putative mitochondrial NAD-dependent
            malate dehydrogenase (mMDH gene), clone cSTA35K16.
          Length = 342

 Score =  519 bits (1337), Expect = e-146
 Identities = 270/342 (78%), Positives = 293/342 (85%), Gaps = 1/342 (0%)
 Frame = +2

Query: 137  MLRSLLKNSVSDG-SRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL 313
            ML+S+++ S + G S V+RRGFASGSAPERKVA+LGAAGGIGQPLSLLMKLNPLVS LSL
Sbjct: 1    MLKSIVRRSSTAGASYVSRRGFASGSAPERKVAVLGAAGGIGQPLSLLMKLNPLVSSLSL 60

Query: 314  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN 493
            +DIAGTPGVAADVSHINTRSEVVGF+G+E LGKALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct: 61   YDIAGTPGVAADVSHINTRSEVVGFAGEEQLGKALEGADIVIIPAGVPRKPGMTRDDLFN 120

Query: 494  INAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVV 673
            INAGIVKSL  AIAKYCP+ALVNMISNPVNSTVPIAAEVFKKAGTYDEK+LFGVT LDVV
Sbjct: 121  INAGIVKSLCTAIAKYCPNALVNMISNPVNSTVPIAAEVFKKAGTYDEKKLFGVTMLDVV 180

Query: 674  RAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGT 853
            RAKTFY               +GGHAGITILPLFSQATP+ANL+++ IV LTKRTQDGGT
Sbjct: 181  RAKTFYAGKAKVNVAEVNLPVVGGHAGITILPLFSQATPKANLSNEEIVALTKRTQDGGT 240

Query: 854  EVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLG 1033
            EVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVEC+FVQS VTELPFFASKVRLG
Sbjct: 241  EVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECAFVQSNVTELPFFASKVRLG 300

Query: 1034 KNGVEEVLGLGSLTDFXXXXXXXXXXXXXXXXXXGIQFANQN 1159
            KNGVEEVLGLG L ++                  GI+FA +N
Sbjct: 301  KNGVEEVLGLGPLNEYEKQGLEALKPELLSSIEKGIKFAKEN 342



>sp|Q9ZP06|MDHM_ARATH Malate dehydrogenase, mitochondrial precursor
            (EC 1.1.1.37) (mNAD- MDH).>pir|T51311|T51311 malate
            dehydrogenase (EC 1.1.1.37) precursor, NAD-dependent,
            mitochondrial [validated] - Arabidopsis
            thaliana>gb:ATH131205_1551978 Arabidopsis thaliana mRNA
            for mitochondrial NAD-dependent malate
            dehydrogenase.>gb:AY062580_1565236 Arabidopsis thaliana
            similar to mitochondrial NAD-dependent malate
            dehydrogenase (At1g53240; F12M16.14) mRNA, complete
            cds.>gb:AY128783_1580863 Arabidopsis thaliana similar to
            mitochondrial NAD-dependent malate dehydrogenase
            (At1g53240) mRNA, complete cds.>gb:AF324670_1786382
            Arabidopsis thaliana At1g53240 (At1g53240/F12M16_14)
            mRNA, complete cds.>gb:AF339684_1787728 Arabidopsis
            thaliana putative mitochondrial NAD-dependent malate
            dehydrogenase (At1g53240) mRNA, complete cds.
          Length = 341

 Score =  508 bits (1308), Expect = e-142
 Identities = 260/341 (76%), Positives = 285/341 (83%), Gaps = 1/341 (0%)
 Frame = +2

Query: 137  MLRSLL-KNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL 313
            M RS+L ++S S    V RR F+SGS PERKVAILGAAGGIGQPL+LLMKLNPLVS LSL
Sbjct: 1    MFRSMLVRSSASAKQAVIRRSFSSGSVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSL 60

Query: 314  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN 493
            +DIA TPGVAADV HINTRSEVVG+ GD+NL KALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct: 61   YDIANTPGVAADVGHINTRSEVVGYMGDDNLAKALEGADLVIIPAGVPRKPGMTRDDLFN 120

Query: 494  INAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVV 673
            INAGIVK+L  AIAKYCPHAL+NMISNPVNSTVPIAAE+FKKAG YDEK+LFGVTTLDVV
Sbjct: 121  INAGIVKNLCTAIAKYCPHALINMISNPVNSTVPIAAEIFKKAGMYDEKKLFGVTTLDVV 180

Query: 674  RAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGT 853
            RA+TFY               IGGHAG+TILPLFSQATPQANL+ D++  LTKRTQDGGT
Sbjct: 181  RARTFYAGKANVPVAEVNVPVIGGHAGVTILPLFSQATPQANLSSDILTALTKRTQDGGT 240

Query: 854  EVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLG 1033
            EVVEAKAGKGSATLSMAYAGA+FADACLKGLNGVPDV+ECS+VQST+TELPFFASKVRLG
Sbjct: 241  EVVEAKAGKGSATLSMAYAGALFADACLKGLNGVPDVIECSYVQSTITELPFFASKVRLG 300

Query: 1034 KNGVEEVLGLGSLTDFXXXXXXXXXXXXXXXXXXGIQFANQ 1156
            KNGVEEVL LG L+DF                  G++FANQ
Sbjct: 301  KNGVEEVLDLGPLSDFEKEGLEALKPELKSSIEKGVKFANQ 341



>gb:AY087304_1572337 Arabidopsis thaliana clone 33917 mRNA, complete
            sequence.
          Length = 341

 Score =  507 bits (1305), Expect = e-142
 Identities = 259/341 (75%), Positives = 284/341 (83%), Gaps = 1/341 (0%)
 Frame = +2

Query: 137  MLRSLLKNSVSDGSRVA-RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL 313
            M RS+L  S +   + A RR F+SGS PERKVAILGAAGGIGQPL+LLMKLNPLVS LSL
Sbjct: 1    MFRSMLVRSSASAKQAAIRRSFSSGSVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSL 60

Query: 314  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN 493
            +DIA TPGVAADV HINTRSEVVG+ GD+NL KALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct: 61   YDIANTPGVAADVGHINTRSEVVGYMGDDNLAKALEGADLVIIPAGVPRKPGMTRDDLFN 120

Query: 494  INAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVV 673
            INAGIVK+L  AIAKYCPHAL+NMISNPVNSTVPIAAE+FKKAG YDEK+LFGVTTLDVV
Sbjct: 121  INAGIVKNLCTAIAKYCPHALINMISNPVNSTVPIAAEIFKKAGMYDEKKLFGVTTLDVV 180

Query: 674  RAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGT 853
            RA+TFY               IGGHAG+TILPLFSQATPQANL+ D++  LTKRTQDGGT
Sbjct: 181  RARTFYAGKANVPVAEVNVPVIGGHAGVTILPLFSQATPQANLSSDILTALTKRTQDGGT 240

Query: 854  EVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLG 1033
            EVVEAKAGKGSATLSMAYAGA+FADACLKGLNGVPDV+ECS+VQST+TELPFFASKVRLG
Sbjct: 241  EVVEAKAGKGSATLSMAYAGALFADACLKGLNGVPDVIECSYVQSTITELPFFASKVRLG 300

Query: 1034 KNGVEEVLGLGSLTDFXXXXXXXXXXXXXXXXXXGIQFANQ 1156
            KNGVEEVL LG L+DF                  G++FANQ
Sbjct: 301  KNGVEEVLDLGPLSDFEKEGLEALKPELKSSIEKGVKFANQ 341



>sp|P17783|MDHM_CITLA Malate dehydrogenase, mitochondrial precursor
            (EC 1.1.1.37).>pir|S10162|DEPUMW malate dehydrogenase (EC
            1.1.1.37) precursor, mitochondrial -
            watermelon>gb:CVMD_1674396 Water melon mMDH mRNA for
            mitochondrial malate dehydrogenase (EC 1.1.1.37).
          Length = 347

 Score =  504 bits (1299), Expect = e-141
 Identities = 263/347 (75%), Positives = 287/347 (82%), Gaps = 2/347 (0%)
 Frame = +2

Query: 125  MRSSMLRSLLK--NSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLV 298
            M++S+LRS+    +  S  +R+  R FA+ S PERKVA+LGAAGGIGQPL+LLMKLNPLV
Sbjct: 1    MKASILRSVRSAVSRSSSSNRLLSRSFATESVPERKVAVLGAAGGIGQPLALLMKLNPLV 60

Query: 299  SHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTR 478
            S L+L+DIAGTPGVAADV H+NTRSEV G+ G+E LGKALEG+DVVIIPAGVPRKPGMTR
Sbjct: 61   SKLALYDIAGTPGVAADVGHVNTRSEVTGYVGEEQLGKALEGSDVVIIPAGVPRKPGMTR 120

Query: 479  DDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVT 658
            DDLFNINAGIVKSL  AIAKYCP+AL+NMISNPVNSTVPIAAEVFKKAGTYDEK+LFGVT
Sbjct: 121  DDLFNINAGIVKSLCTAIAKYCPNALINMISNPVNSTVPIAAEVFKKAGTYDEKKLFGVT 180

Query: 659  TLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRT 838
            TLDVVRAKTFY               IGGHAGITILPLFSQATP+ANL+ D IV LTKRT
Sbjct: 181  TLDVVRAKTFYAGKANVPVAEVNVPVIGGHAGITILPLFSQATPRANLSDDTIVALTKRT 240

Query: 839  QDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFAS 1018
            QDGGTEVVEAKAGKGSATLSMAYAGA+FADACLKGLNGVPDVVECSFVQSTVTELPFFAS
Sbjct: 241  QDGGTEVVEAKAGKGSATLSMAYAGALFADACLKGLNGVPDVVECSFVQSTVTELPFFAS 300

Query: 1019 KVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXXXXXXXXGIQFANQN 1159
            KV+LGKNGVE VL LG L+DF                  GIQFAN N
Sbjct: 301  KVKLGKNGVESVLDLGPLSDFEKEGLEKLKPELKASIEKGIQFANAN 347



>gb:AY045592_1561183 Arabidopsis thaliana AT3g15020/K15M2_16 mRNA,
            complete cds.>gb:AY093788_1575440 Arabidopsis thaliana
            AT3g15020/K15M2_16 mRNA, complete
            cds.>gb:AP000370_1819767 Arabidopsis thaliana genomic
            DNA, chromosome 3, TAC clone:K15M2.
          Length = 341

 Score =  500 bits (1288), Expect = e-140
 Identities = 260/341 (76%), Positives = 284/341 (83%), Gaps = 1/341 (0%)
 Frame = +2

Query: 137  MLRSLLKNSVSDGSR-VARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL 313
            M RS++  S S   + + RRGFAS S P+RKV ILGAAGGIGQPLSLLMKLNPLVS LSL
Sbjct: 1    MFRSMIVRSASPVKQGLLRRGFASESVPDRKVVILGAAGGIGQPLSLLMKLNPLVSSLSL 60

Query: 314  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN 493
            +DIA TPGVAADV HINTRS+V G+ GD++LGKALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct: 61   YDIANTPGVAADVGHINTRSQVSGYMGDDDLGKALEGADLVIIPAGVPRKPGMTRDDLFN 120

Query: 494  INAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVV 673
            INAGIVK+LS AIAKYCP ALVNMISNPVNSTVPIAAE+FKKAGTYDEK+LFGVTTLDVV
Sbjct: 121  INAGIVKNLSIAIAKYCPQALVNMISNPVNSTVPIAAEIFKKAGTYDEKKLFGVTTLDVV 180

Query: 674  RAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGT 853
            RA+TFY               +GGHAGITILPLFSQA+PQANL+ D+I  LTKRTQDGGT
Sbjct: 181  RARTFYAGKSDVNVAEVNVPVVGGHAGITILPLFSQASPQANLSDDLIRALTKRTQDGGT 240

Query: 854  EVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLG 1033
            EVVEAKAGKGSATLSMAYAGA+FADACLKGLNGVP+VVECSFVQST+TELPFFASKVRLG
Sbjct: 241  EVVEAKAGKGSATLSMAYAGALFADACLKGLNGVPNVVECSFVQSTITELPFFASKVRLG 300

Query: 1034 KNGVEEVLGLGSLTDFXXXXXXXXXXXXXXXXXXGIQFANQ 1156
            KNGVEEVL LG L+DF                  GI+FANQ
Sbjct: 301  KNGVEEVLDLGPLSDFEKEGLEALKAELKSSIEKGIKFANQ 341



>pir|T09286|T09286 malate dehydrogenase (EC 1.1.1.37) precursor -
            alfalfa>gb:AF020271_1761622 Medicago sativa mitochondrial
            malate dehydrogenase precursor (mmdh) mRNA, nuclear gene
            encoding mitochondrial protein, complete cds.
          Length = 343

 Score =  500 bits (1287), Expect = e-140
 Identities = 264/345 (76%), Positives = 289/345 (83%), Gaps = 1/345 (0%)
 Frame = +2

Query: 125  MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH 304
            MR S+LRS+ K++VS    + RRG+A+   PERKVAILGAAGGIGQPLSLLMKLNPLVS 
Sbjct: 2    MRPSILRSV-KSAVSRS--ITRRGYATEPVPERKVAILGAAGGIGQPLSLLMKLNPLVST 58

Query: 305  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD 484
            LSL+DIAGTPGVAADVSHIN+RS+V G++G++ LGKALEGADVVIIPAGVPRKPGMTRDD
Sbjct: 59   LSLYDIAGTPGVAADVSHINSRSQVTGYAGEDELGKALEGADVVIIPAGVPRKPGMTRDD 118

Query: 485  LFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTL 664
            LFNINAGIVKSL+ AI+KYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTL
Sbjct: 119  LFNINAGIVKSLATAISKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTL 178

Query: 665  DVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQD 844
            DVVRAKTFY               IGGHAG+TILPLFSQA+PQANL  DVI  LT RTQD
Sbjct: 179  DVVRAKTFYAGKANVPVAEVNVPVIGGHAGVTILPLFSQASPQANLDDDVIKALTARTQD 238

Query: 845  GGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQST-VTELPFFASK 1021
            GGTEVV AKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECS+VQS  + ELPFFASK
Sbjct: 239  GGTEVVTAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSYVQSNLIAELPFFASK 298

Query: 1022 VRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXXXXXXXXGIQFANQ 1156
            VR+GKNGVEE+LGLGSL+DF                  GI+FA+Q
Sbjct: 299  VRIGKNGVEEILGLGSLSDFEKQGLENLKSELKSSIEKGIKFASQ 343



>gb:AE005173_893227 Arabidopsis thaliana chromosome 1, bottom arm
            complete sequence.>gb:AC008007_1536408 Genomic sequence
            for Arabidopsis thaliana BAC F12M16 from chromosome I,
            complete sequence.
          Length = 352

 Score =  499 bits (1286), Expect = e-140
 Identities = 260/352 (73%), Positives = 285/352 (80%), Gaps = 12/352 (3%)
 Frame = +2

Query: 137  MLRSLL-KNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL 313
            M RS+L ++S S    V RR F+SGS PERKVAILGAAGGIGQPL+LLMKLNPLVS LSL
Sbjct: 1    MFRSMLVRSSASAKQAVIRRSFSSGSVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSL 60

Query: 314  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN 493
            +DIA TPGVAADV HINTRSEVVG+ GD+NL KALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct: 61   YDIANTPGVAADVGHINTRSEVVGYMGDDNLAKALEGADLVIIPAGVPRKPGMTRDDLFN 120

Query: 494  INAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVV 673
            INAGIVK+L  AIAKYCPHAL+NMISNPVNSTVPIAAE+FKKAG YDEK+LFGVTTLDVV
Sbjct: 121  INAGIVKNLCTAIAKYCPHALINMISNPVNSTVPIAAEIFKKAGMYDEKKLFGVTTLDVV 180

Query: 674  RAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQ-----------ATPQANLAHDVIV 820
            RA+TFY               IGGHAG+TILPLFSQ           ATPQANL+ D++ 
Sbjct: 181  RARTFYAGKANVPVAEVNVPVIGGHAGVTILPLFSQVSSHFLSTQTVATPQANLSSDILT 240

Query: 821  GLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTE 1000
             LTKRTQDGGTEVVEAKAGKGSATLSMAYAGA+FADACLKGLNGVPDV+ECS+VQST+TE
Sbjct: 241  ALTKRTQDGGTEVVEAKAGKGSATLSMAYAGALFADACLKGLNGVPDVIECSYVQSTITE 300

Query: 1001 LPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXXXXXXXXGIQFANQ 1156
            LPFFASKVRLGKNGVEEVL LG L+DF                  G++FANQ
Sbjct: 301  LPFFASKVRLGKNGVEEVLDLGPLSDFEKEGLEALKPELKSSIEKGVKFANQ 352



>sp|P83373|MDHM_FRAAN Malate dehydrogenase, mitochondrial precursor
            (EC 1.1.1.37).
          Length = 339

 Score =  499 bits (1285), Expect = e-140
 Identities = 260/345 (75%), Positives = 289/345 (83%)
 Frame = +2

Query: 125  MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH 304
            MR SM  SL+++     SRVARRG++S S P+RKVA+LGAAGGIGQPL+LLMKLNPLVS 
Sbjct: 1    MRPSM--SLIRSV----SRVARRGYSSESVPQRKVAVLGAAGGIGQPLALLMKLNPLVSQ 54

Query: 305  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD 484
            LSL+DIAGTPGVAADVSHINTRSEV G++G+E LG+ALEG DVVIIPAGVPRKPGMTRDD
Sbjct: 55   LSLYDIAGTPGVAADVSHINTRSEVKGYAGEEQLGEALEGCDVVIIPAGVPRKPGMTRDD 114

Query: 485  LFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTL 664
            LFNINAGIV+SL+AAIAKYCPHA++NMISNPVNSTVPIA+EV KKAG YDEK+LFGVTTL
Sbjct: 115  LFNINAGIVRSLTAAIAKYCPHAIINMISNPVNSTVPIASEVLKKAGVYDEKKLFGVTTL 174

Query: 665  DVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQD 844
            DVVRAKTFY               +GGHAGITILPLFSQATP+ANL+ D I  LTKRTQD
Sbjct: 175  DVVRAKTFYAGKAGVPVAEVNVPVVGGHAGITILPLFSQATPKANLSDDYIKALTKRTQD 234

Query: 845  GGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKV 1024
            GGTEVVEAKAGKGSATLSMAYAGA+FADACL GLNGVPDVVECS+VQS++TELPFFASKV
Sbjct: 235  GGTEVVEAKAGKGSATLSMAYAGALFADACLXGLNGVPDVVECSYVQSSITELPFFASKV 294

Query: 1025 RLGKNGVEEVLGLGSLTDFXXXXXXXXXXXXXXXXXXGIQFANQN 1159
            RLGKNGVEEVL LG L+DF                  GI+FANQ+
Sbjct: 295  RLGKNGVEEVLDLGPLSDFEKEGLKQLKPELKSSIEKGIKFANQS 339



>sp|Q43744|MDHM_BRANA Malate dehydrogenase, mitochondrial precursor
            (EC 1.1.1.37).>pir|S57958|S57958 malate dehydrogenase (EC
            1.1.1.37) - rape>gb:BNMDHGENE_1633583 B.napus mRNA for
            mitochondrial malate dehydrogenase.
          Length = 341

 Score =  489 bits (1258), Expect = e-137
 Identities = 255/341 (74%), Positives = 279/341 (81%), Gaps = 1/341 (0%)
 Frame = +2

Query: 137  MLRS-LLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSL 313
            M RS L+++S S    + RR F+SGS PERKVAILGAAGGIGQPL+LLMKLNPLVS LSL
Sbjct: 1    MFRSALVRSSASAKQSLLRRSFSSGSVPERKVAILGAAGGIGQPLALLMKLNPLVSSLSL 60

Query: 314  FDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFN 493
            +DIA TPGVAADV HINTRS+VVG+ GD+NL KALEGAD+VIIPAGVPRKPGMTRDDLFN
Sbjct: 61   YDIANTPGVAADVGHINTRSQVVGYMGDDNLAKALEGADLVIIPAGVPRKPGMTRDDLFN 120

Query: 494  INAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVV 673
            INAGIVK+L +AIAKYCPHALVNMISNPVNSTVPIAAE+FKKAG YDEK+LFGVTTLDVV
Sbjct: 121  INAGIVKNLWSAIAKYCPHALVNMISNPVNSTVPIAAEIFKKAGMYDEKKLFGVTTLDVV 180

Query: 674  RAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGT 853
            R KT Y               I GHAG+TILPLFSQATPQA L+ D +   TKRTQDGGT
Sbjct: 181  RVKTSYAGKANVPVAEVNVPAIVGHAGVTILPLFSQATPQAILSGDALTVTTKRTQDGGT 240

Query: 854  EVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLG 1033
            EV EAKAGKGSATLSMAYAGA+FADACLKGLNGVPDVVECS+VQST+TELPFFASKVRLG
Sbjct: 241  EVEEAKAGKGSATLSMAYAGALFADACLKGLNGVPDVVECSYVQSTITELPFFASKVRLG 300

Query: 1034 KNGVEEVLGLGSLTDFXXXXXXXXXXXXXXXXXXGIQFANQ 1156
            KNGVEEVL LG L+DF                  G++FANQ
Sbjct: 301  KNGVEEVLDLGPLSDFEKEGLEALRPGIKSTIEKGVKFANQ 341



>sp|P46487|MDHM_EUCGU Malate dehydrogenase, mitochondrial precursor
            (EC 1.1.1.37).>pir|S44167|S44167 malate dehydrogenase (EC
            1.1.1.37), mitochondrial - cider tree>gb:EGMMDH_1676443
            E.gunnii mRNA for mitochondrial malate dehydrogenase.
          Length = 347

 Score =  485 bits (1248), Expect = e-135
 Identities = 255/347 (73%), Positives = 283/347 (81%), Gaps = 3/347 (0%)
 Frame = +2

Query: 125  MRSSMLRSLLKNSVSDGSR--VARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLV 298
            MR+SMLR +   S S   R  + RR + S S PERKVA+LGAAGGIGQPL+LLMKLNPLV
Sbjct: 1    MRASMLRLIRSRSSSAAPRPHLLRRAYGSESVPERKVAVLGAAGGIGQPLALLMKLNPLV 60

Query: 299  SHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTR 478
            S L+L+DIAGTPGVAADV HINTRSEV G+ G+E LG+ALEG+DVVIIPAGVPRKPGMTR
Sbjct: 61   SQLALYDIAGTPGVAADVGHINTRSEVAGYVGEEQLGQALEGSDVVIIPAGVPRKPGMTR 120

Query: 479  DDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVT 658
            DDLFNINAGIVKSL  AIAKYCP+A+VNMISNPVNSTVPIAAE+FKKAGTY+EK+L GVT
Sbjct: 121  DDLFNINAGIVKSLCTAIAKYCPNAVVNMISNPVNSTVPIAAEIFKKAGTYNEKKLLGVT 180

Query: 659  TLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRT 838
            TLDVVRAKTFY               +GGHAGITILPLFSQA P+ANLA + I  LTKRT
Sbjct: 181  TLDVVRAKTFYAGKAKVPVEEVNVPVVGGHAGITILPLFSQAVPKANLADEDIKALTKRT 240

Query: 839  QDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQST-VTELPFFA 1015
            QDGGTEVVEAKAGKGSATLSMAYAGA+FADACLKGLNGVPDVVECSFVQS+ +TELPFFA
Sbjct: 241  QDGGTEVVEAKAGKGSATLSMAYAGALFADACLKGLNGVPDVVECSFVQSSIITELPFFA 300

Query: 1016 SKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXXXXXXXXGIQFANQ 1156
            SKV+LGKNGVEEVL LG ++D+                  GI+FANQ
Sbjct: 301  SKVKLGKNGVEEVLELGPMSDYEKQGLEILIPELKASIEKGIKFANQ 347



>gb:AF444195_1800407 Oryza sativa malate dehydrogenase (MDH) mRNA,
            complete cds; nuclear gene for mitochondrial
            product.>gb:AP003053_1824507 Oryza sativa (japonica
            cultivar-group) genomic DNA, chromosome 1, PAC
            clone:P0047B08.>gb:AP003340_1828291 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 1, BAC
            clone:OJ1316_H05.
          Length = 340

 Score =  481 bits (1239), Expect = e-134
 Identities = 257/340 (75%), Positives = 278/340 (81%), Gaps = 2/340 (0%)
 Frame = +2

Query: 140  LRSLLKNSVSDGSRVARRGFASGSA-PERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLF 316
            +R  L  S S   R  RRG++S S  PERKVAILGAAGGIGQPLSLLMKLNPLVS LSL+
Sbjct: 1    MRPSLMRSASQVLR-RRRGYSSASGQPERKVAILGAAGGIGQPLSLLMKLNPLVSSLSLY 59

Query: 317  DIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNI 496
            DIAGTPGVAADVSHIN  ++V GF GD+ LG+ALEG+D+VIIPAGVPRKPGMTRDDLFNI
Sbjct: 60   DIAGTPGVAADVSHINAPAQVKGFMGDDQLGEALEGSDIVIIPAGVPRKPGMTRDDLFNI 119

Query: 497  NAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVR 676
            NAGIVK+L  AIAKYCP+ALVNMISNPVNSTVPIAAEVFKKAGTYDEK+LFGVTTLDVVR
Sbjct: 120  NAGIVKNLCTAIAKYCPNALVNMISNPVNSTVPIAAEVFKKAGTYDEKKLFGVTTLDVVR 179

Query: 677  AKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQAN-LAHDVIVGLTKRTQDGGT 853
            AKTFY               +GGHAGITILPLFSQATP  N L+ + I  LTKRTQDGGT
Sbjct: 180  AKTFYAGKANVPVTDVNVPVVGGHAGITILPLFSQATPATNALSDEDIKALTKRTQDGGT 239

Query: 854  EVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLG 1033
            EVVEAKAGKGSATLSMAYAGA+FA+ACLKGLNGVPDVVECSFVQSTVTELPFFASKV+LG
Sbjct: 240  EVVEAKAGKGSATLSMAYAGAVFANACLKGLNGVPDVVECSFVQSTVTELPFFASKVKLG 299

Query: 1034 KNGVEEVLGLGSLTDFXXXXXXXXXXXXXXXXXXGIQFAN 1153
            KNGVEEVLGLG L+DF                  GI+FAN
Sbjct: 300  KNGVEEVLGLGQLSDFEKEGLENLKGELKASIEKGIKFAN 339



>gb:AF195869_1775930 Vitis vinifera malate dehydrogenase (MDH) mRNA,
            complete cds; nuclear gene for mitochondrial product.
          Length = 352

 Score =  481 bits (1237), Expect = e-134
 Identities = 256/352 (72%), Positives = 285/352 (80%), Gaps = 7/352 (1%)
 Frame = +2

Query: 125  MRSSMLRSLLK-----NSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLN 289
            M++S+ RS        +S S  S + RR +   S PERKVA+LGAAGGIGQPL+LLMKLN
Sbjct: 1    MKASLFRSAETALRRVSSPSASSHLLRRSYCVESKPERKVAVLGAAGGIGQPLALLMKLN 60

Query: 290  PLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPG 469
            PLVS LSL+DIAGTPGVAADVSHINTRS+V G+ GD+ LG+ALEGAD+VIIPAGVPRKPG
Sbjct: 61   PLVSSLSLYDIAGTPGVAADVSHINTRSQVAGYMGDDQLGQALEGADLVIIPAGVPRKPG 120

Query: 470  MTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLF 649
            MTRDDLFNINAGIVKSL  AIAKYCP+ALVNMISNPVNSTVPIAAEVFKKAGTYDEK+LF
Sbjct: 121  MTRDDLFNINAGIVKSLCTAIAKYCPNALVNMISNPVNSTVPIAAEVFKKAGTYDEKKLF 180

Query: 650  GVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQA-NLAHDVIVGL 826
            GVTTLDVVRAKTFY               +GGHAGITILPLFSQATP++ NL+ + IV L
Sbjct: 181  GVTTLDVVRAKTFYAGKAKVPVAEANVPVVGGHAGITILPLFSQATPKSNNLSDEDIVAL 240

Query: 827  TKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQST-VTEL 1003
            TKRTQDGGTEVVEAKAGKGSATLSMAYAGA+FADACLK LNGVPDVVECSFVQST V +L
Sbjct: 241  TKRTQDGGTEVVEAKAGKGSATLSMAYAGAVFADACLKVLNGVPDVVECSFVQSTIVPDL 300

Query: 1004 PFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXXXXXXXXGIQFANQN 1159
            P+FASKV+LGKNGVEEVLGLG L+D+                  GI+FA Q+
Sbjct: 301  PYFASKVKLGKNGVEEVLGLGPLSDYEKQGLESLKHELKASIEKGIKFATQS 352



>gb:AC098832_1736892 Oryza sativa (japonica cultivar-group) chromosome
            5 clone OJ1268_B08, complete
            sequence.>gb:AC104284_1737513 Oryza sativa (japonica
            cultivar-group) chromosome 5 clone OJ1735_C10, complete
            sequence.
          Length = 340

 Score =  477 bits (1227), Expect = e-133
 Identities = 256/347 (73%), Positives = 281/347 (80%), Gaps = 2/347 (0%)
 Frame = +2

Query: 125  MRSSMLRSLLKNSVSDGSRVARRGFASGSAP-ERKVAILGAAGGIGQPLSLLMKLNPLVS 301
            MR S+LR   +        + RR ++S +A  ERKVAILGAAGGIGQPL+LLMKLNPLVS
Sbjct: 1    MRPSLLRYAAQ-------ALRRRDYSSAAAAAERKVAILGAAGGIGQPLALLMKLNPLVS 53

Query: 302  HLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRD 481
             LSL+DIAGTPGVAADVSHIN+ + V GF G+E LG+ALEG+DVVIIPAGVPRKPGMTRD
Sbjct: 54   SLSLYDIAGTPGVAADVSHINSPALVKGFVGEEQLGEALEGSDVVIIPAGVPRKPGMTRD 113

Query: 482  DLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTT 661
            DLFNINAGIVK L  AI+KYCP+ALVNMISNPVNSTVPIAAEVFKKAGTYDEK+LFGVTT
Sbjct: 114  DLFNINAGIVKGLCTAISKYCPNALVNMISNPVNSTVPIAAEVFKKAGTYDEKKLFGVTT 173

Query: 662  LDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQAN-LAHDVIVGLTKRT 838
            LDVVRAKTFY               +GGHAGITILPLFSQATP +N L+H+ I  LTKRT
Sbjct: 174  LDVVRAKTFYAGKANVPVTEVNVPVVGGHAGITILPLFSQATPASNALSHEDIKALTKRT 233

Query: 839  QDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFAS 1018
            QDGGTEVVEAKAGKGSATLSMAYAGA+FADACLKGLNGVPDVVECSFVQSTVTELPFFAS
Sbjct: 234  QDGGTEVVEAKAGKGSATLSMAYAGAVFADACLKGLNGVPDVVECSFVQSTVTELPFFAS 293

Query: 1019 KVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXXXXXXXXGIQFANQN 1159
            KVRLGKNGVEEVLGLG L++F                  GI+FA+ N
Sbjct: 294  KVRLGKNGVEEVLGLGQLSEFEKEGLENLKGELKSSIEKGIKFAHAN 340



>gb:STU488944_1723092 Solanum tuberosum mRNA for putative
            mitochondrial NAD-dependent malate dehydrogenase (mMDH
            gene), clone cSTB36K15.
          Length = 344

 Score =  456 bits (1173), Expect = e-127
 Identities = 246/346 (71%), Positives = 274/346 (79%), Gaps = 3/346 (0%)
 Frame = +2

Query: 125  MRSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSH 304
            MR+SMLR+L + + + G+R   RGFAS SAP+RKVAILGAAGGIGQPLSLLMKLNPLVS 
Sbjct: 1    MRTSMLRTLARRTSTAGTR---RGFASESAPDRKVAILGAAGGIGQPLSLLMKLNPLVSR 57

Query: 305  LSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD 484
            L+L+DIAGTPGVAADVSHINTRSE++G++G+E LGKALEGADVVIIPAGVPRKPGMTRDD
Sbjct: 58   LALYDIAGTPGVAADVSHINTRSEILGYAGEEQLGKALEGADVVIIPAGVPRKPGMTRDD 117

Query: 485  LFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTL 664
            LFNINAGIVKSL  AIAKYCPHALVN+ISNPVNSTVPIA+EVFKKAGTYDEKRLFGVTTL
Sbjct: 118  LFNINAGIVKSLCTAIAKYCPHALVNVISNPVNSTVPIASEVFKKAGTYDEKRLFGVTTL 177

Query: 665  DVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQD 844
            DVVRAKTFY               +GGHAG+TILPLFSQATP ANL+ + I  LTKRTQD
Sbjct: 178  DVVRAKTFYAGKAKVNVADVIVPVVGGHAGVTILPLFSQATPSANLSSEEIEALTKRTQD 237

Query: 845  GGTEVVEAKAGKGSATLSMAYAGAIFADACLK-GLNGVPD-VVECSFVQSTVTELPF-FA 1015
            GGTEVVEAKAGKGSATLSMAYAGAIFAD  L+  LNGVP  +  C      VTE      
Sbjct: 238  GGTEVVEAKAGKGSATLSMAYAGAIFADCLLEWDLNGVPGCLYSCHSYSQLVTEPAISLH 297

Query: 1016 SKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXXXXXXXXGIQFAN 1153
             ++R GKNGVEEVLGLG+L+D+                  GI+FAN
Sbjct: 298  PRLRFGKNGVEEVLGLGALSDYEKEGLEALKPELKSSIEKGIKFAN 343



>sp|Q42686|MDHM_CHLRE Malate dehydrogenase, mitochondrial precursor
            (EC 1.1.1.37).>pir|T08077|T08077 malate dehydrogenase (EC
            1.1.1.37) precursor, mitochondrial - Chlamydomonas
            reinhardtii>gb:CRU40212_1673685 Chlamydomonas reinhardtii
            malate dehydrogenase gene, nuclear gene encoding
            mitochondrial protein, complete cds.
          Length = 373

 Score =  395 bits (1014), Expect = e-108
 Identities = 205/348 (58%), Positives = 258/348 (74%), Gaps = 3/348 (0%)
 Frame = +2

Query: 113  LEIEMRSSMLRSLLKNSVSDGSRVARRGFASG---SAPERKVAILGAAGGIGQPLSLLMK 283
            L ++   + + S   ++++  +  A RGFA+    S   RKVA+LGAAGGIGQPLS+LMK
Sbjct: 24   LPVDFIVAAMASSTSSAMAKWAAQAARGFAAAAPSSGKGRKVAVLGAAGGIGQPLSMLMK 83

Query: 284  LNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRK 463
            +N  VS LSL+DIAGTPGVAADVSHINT+++V GF  D  L +AL G D+VIIPAGVPRK
Sbjct: 84   MNSQVSSLSLYDIAGTPGVAADVSHINTKAQVKGFDKD-GLAEALRGCDLVIIPAGVPRK 142

Query: 464  PGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKR 643
            PGMTRDDLF INAGIV+ L  A+ ++CP A++N+ISNPVNSTVPIAAE  KK G YD+++
Sbjct: 143  PGMTRDDLFKINAGIVRDLVTAVGQHCPGAVLNIISNPVNSTVPIAAEQLKKMGVYDKRK 202

Query: 644  LFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVG 823
            + GVTTLDVVRAKTFY               +GGHAG+TILPLFSQATP+A ++ +V+  
Sbjct: 203  VMGVTTLDVVRAKTFYAEKNGLDVASVDVPVVGGHAGVTILPLFSQATPKATMSAEVLDA 262

Query: 824  LTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTEL 1003
            LTKRTQDGGTEVV+AKAGKGSATLSMAYA A+FAD+CL+GLNG P VVEC++V+STVT+ 
Sbjct: 263  LTKRTQDGGTEVVQAKAGKGSATLSMAYAAALFADSCLRGLNGAP-VVECTYVESTVTDA 321

Query: 1004 PFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXXXXXXXXGIQF 1147
            P+FASKV+L   GV+++  LG L+D+                  G+QF
Sbjct: 322  PYFASKVKLSTEGVDKIHDLGPLSDYEKAGLKAMMPELLASIEKGVQF 369



>gb:AF068687_1765646 Glycine max malate dehydrogenase (Mdh-2) gene,
            nuclear gene encoding mitochondrial protein, partial cds.
          Length = 260

 Score =  388 bits (997), Expect = e-106
 Identities = 202/260 (77%), Positives = 213/260 (81%)
 Frame = +2

Query: 377  VVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHAL 556
            VVG+ GDE LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAKYCPHAL
Sbjct: 1    VVGYQGDEELGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKTLCTAIAKYCPHAL 60

Query: 557  VNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXX 736
            VNMI+NPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFY               
Sbjct: 61   VNMITNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKANVPVAGVNAPV 120

Query: 737  IGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGA 916
            +GGHAGITILPLFSQATP+A    DVI  LTKRTQ GGTE  EAKAGKGSATLSMAYAGA
Sbjct: 121  VGGHAGITILPLFSQATPKAIFDDDVIETLTKRTQVGGTEFEEAKAGKGSATLSMAYAGA 180

Query: 917  IFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXX 1096
            +FADACLKGLNGVPDVVECSFVQS+V+ELP+FASKVRLGKNGVEEVLGLG L+DF     
Sbjct: 181  LFADACLKGLNGVPDVVECSFVQSSVSELPYFASKVRLGKNGVEEVLGLGPLSDFEQQGL 240

Query: 1097 XXXXXXXXXXXXXGIQFANQ 1156
                         GI+FANQ
Sbjct: 241  ESLKPELKSSIEKGIKFANQ 260



>pir|T06326|T06326 malate dehydrogenase (EC 1.1.1.37) Mdh-2,
            mitochondrial - soybean (fragment)
          Length = 260

 Score =  388 bits (997), Expect = e-106
 Identities = 202/260 (77%), Positives = 213/260 (81%)
 Frame = +2

Query: 377  VVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHAL 556
            VVG+ GDE LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAKYCPHAL
Sbjct: 1    VVGYQGDEELGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKTLCTAIAKYCPHAL 60

Query: 557  VNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXX 736
            VNMI+NPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFY               
Sbjct: 61   VNMITNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYAGKANVPVAGVNAPV 120

Query: 737  IGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGA 916
            +GGHAGITILPLFSQATP+A    DVI  LTKRTQ GGTE  EAKAGKGSATLSMAYAGA
Sbjct: 121  VGGHAGITILPLFSQATPKAIFDDDVIETLTKRTQVGGTEFEEAKAGKGSATLSMAYAGA 180

Query: 917  IFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXX 1096
            +FADACLKGLNGVPDVVECSFVQS+V+ELP+FASKVRLGKNGVEEVLGLG L+DF     
Sbjct: 181  LFADACLKGLNGVPDVVECSFVQSSVSELPYFASKVRLGKNGVEEVLGLGPLSDFEQQGL 240

Query: 1097 XXXXXXXXXXXXXGIQFANQ 1156
                         GI+FANQ
Sbjct: 241  ESLKPELKSSIEKGIKFANQ 260



>sp|Q42972|MDHG_ORYSA Malate dehydrogenase, glyoxysomal precursor (EC
            1.1.1.37).>pir|T03272|T03272 malate dehydrogenase (EC
            1.1.1.37) precursor, glyoxysomal - rice>gb:RIC12_1703496
            Oryza sativa (japonica cultivar-group) mRNA for
            glyoxysomal malate dehydrogenase, complete cds.
          Length = 356

 Score =  386 bits (991), Expect = e-106
 Identities = 203/319 (63%), Positives = 231/319 (72%)
 Frame = +2

Query: 200  ASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEV 379
            A G+AP  KVAILGA+GGIGQPL+LLMK+NPLVS L L+D+  TPGV AD+SH+NT + V
Sbjct: 38   AKGAAPGFKVAILGASGGIGQPLALLMKMNPLVSVLHLYDVVNTPGVTADISHMNTGAVV 97

Query: 380  VGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALV 559
             GF G   L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++L   IAK CP+A+V
Sbjct: 98   RGFLGQPQLENALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLCEGIAKCCPNAIV 157

Query: 560  NMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXI 739
            N+ISNPVNSTVPIAAEVFKKAGTYD KRL GVTTLDVVRA TF                I
Sbjct: 158  NVISNPVNSTVPIAAEVFKKAGTYDPKRLLGVTTLDVVRANTFVAEVLGLDPRDVNVPVI 217

Query: 740  GGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAI 919
            GGHAG+TILPL SQ  P  +   + I  LT R Q+GGTEVVEAKAG GSATLSMAYA + 
Sbjct: 218  GGHAGVTILPLLSQVNPPCSFTSEEISYLTTRIQNGGTEVVEAKAGAGSATLSMAYAASK 277

Query: 920  FADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXX 1099
            FADACL+GL G   +VECSFV S VTELPFFASKVRLG+ G+EE+L LG L +F      
Sbjct: 278  FADACLRGLRGDAGIVECSFVASQVTELPFFASKVRLGRCGIEEILSLGPLNEFERAGLE 337

Query: 1100 XXXXXXXXXXXXGIQFANQ 1156
                        G+ F N+
Sbjct: 338  KAKKELAESIQKGVAFINK 356



>sp|O82399|MDHI_ARATH Probable malate dehydrogenase, glyoxysomal
            precursor (EC 1.1.1.37).>pir|G84616|G84616 hypothetical
            protein At2g22780 [imported] - Arabidopsis
            thaliana>gb:AC005617_1532837 Arabidopsis thaliana
            chromosome 2 clone T30L20 map CIC06C07, complete
            sequence.>gb:BT003009_1636591 Arabidopsis thaliana
            At2g22780/T30L20.4 gene, complete
            cds.>gb:AF428346_1799276 Arabidopsis thaliana
            At2g22780/T30L20.4 mRNA, complete cds.
          Length = 354

 Score =  382 bits (980), Expect = e-104
 Identities = 205/338 (60%), Positives = 241/338 (71%), Gaps = 3/338 (0%)
 Frame = +2

Query: 152  LKNSVSDGS---RVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDI 322
            L N ++DGS   RVA R  A G +P  KVAILGAAGGIGQPL++LMK+NPLVS L L+D+
Sbjct: 19   LHNQIADGSGLNRVACR--AKGGSPGFKVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDV 76

Query: 323  AGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINA 502
            A  PGV AD+SH++T + V GF G   L +AL G D+VIIPAGVPRKPGMTRDDLFNINA
Sbjct: 77   ANAPGVTADISHMDTSAVVRGFLGQPQLEEALTGMDLVIIPAGVPRKPGMTRDDLFNINA 136

Query: 503  GIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAK 682
            GIV++LS AIAK CP A+VN+ISNPVNSTVPIAAEVFKKAGT+D K+L GVT LDVVRA 
Sbjct: 137  GIVRTLSEAIAKCCPKAIVNIISNPVNSTVPIAAEVFKKAGTFDPKKLMGVTMLDVVRAN 196

Query: 683  TFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVV 862
            TF                +GGHAG+TILPL SQ  P  +     I  LT R Q+GGTEVV
Sbjct: 197  TFVAEVMSLDPREVEVPVVGGHAGVTILPLLSQVKPPCSFTQKEIEYLTDRIQNGGTEVV 256

Query: 863  EAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNG 1042
            EAKAG GSATLSMAYA   FADACL+GL G  ++VEC++V S VTELPFFASKVRLG+ G
Sbjct: 257  EAKAGAGSATLSMAYAAVEFADACLRGLRGDANIVECAYVASHVTELPFFASKVRLGRCG 316

Query: 1043 VEEVLGLGSLTDFXXXXXXXXXXXXXXXXXXGIQFANQ 1156
            ++EV GLG L ++                  G+ FA +
Sbjct: 317  IDEVYGLGPLNEYERMGLEKAKKELSVSIHKGVTFAKK 354



>gb:AC092781_1735751 Oryza sativa chromosome 3 BAC OSJNBb0094O03
            genomic sequence, complete sequence.
          Length = 354

 Score =  379 bits (973), Expect = e-104
 Identities = 202/319 (63%), Positives = 226/319 (70%)
 Frame = +2

Query: 200  ASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEV 379
            A G AP  KVA+LGAAGGIGQPLSLLMKLNPLVS L L+D+  TPGV ADVSH++T + V
Sbjct: 36   AKGGAPGFKVAVLGAAGGIGQPLSLLMKLNPLVSVLHLYDVVNTPGVTADVSHMDTTAVV 95

Query: 380  VGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALV 559
             GF G   L  AL G D+VIIPAG+PRKPGMTRDDLFN NAGIV+SL   +AK CP+A+V
Sbjct: 96   RGFLGPNQLEAALTGMDLVIIPAGLPRKPGMTRDDLFNKNAGIVRSLCEGVAKCCPNAIV 155

Query: 560  NMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXI 739
            N+ISNPVNSTVPIAAEVFKKAGTYD KRL GVTTLDV RA TF                +
Sbjct: 156  NLISNPVNSTVPIAAEVFKKAGTYDPKRLLGVTTLDVARANTFVAEVLGIDPKDVNVPVV 215

Query: 740  GGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAI 919
            GGHAG+TILPL SQ  P  +   D I  LTKR Q+GGTEVVEAKAG GSATLSMA+A A 
Sbjct: 216  GGHAGVTILPLLSQVHPPCSFTPDEISYLTKRIQNGGTEVVEAKAGAGSATLSMAFAAAK 275

Query: 920  FADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXX 1099
            F DACL+ + G   VVECS+V S VTELPFFA+KVRLG+ G EEVL LG L DF      
Sbjct: 276  FGDACLRAMRGDAGVVECSYVASAVTELPFFATKVRLGRAGAEEVLPLGPLNDFERAGLE 335

Query: 1100 XXXXXXXXXXXXGIQFANQ 1156
                        GI F N+
Sbjct: 336  MAKKELMESIQKGIDFMNK 354



>sp|P19446|MDHG_CITLA Malate dehydrogenase, glyoxysomal precursor (EC
            1.1.1.37).>pir|A35957|DEPUGW malate dehydrogenase (EC
            1.1.1.37) precursor, glyoxysomal -
            watermelon>gb:CNAGMDHA_1648102 C.vulgaris glyoxysomal
            malate dehydrogenase mRNA, complete cds.
          Length = 356

 Score =  377 bits (967), Expect = e-103
 Identities = 196/310 (63%), Positives = 229/310 (73%), Gaps = 1/310 (0%)
 Frame = +2

Query: 155  KNSVSDGSRVARRGF-ASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGT 331
            K+ + + S + R    A G AP  KVAILGAAGGIGQPL++LMK+NPLVS L L+D+   
Sbjct: 22   KSQMEESSALRRANCRAKGGAPGFKVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVVNA 81

Query: 332  PGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIV 511
            PGV AD+SH++T + V GF G + L  AL G D++I+PAGVPRKPGMTRDDLF INAGIV
Sbjct: 82   PGVTADISHMDTGAVVRGFLGQQQLEAALTGMDLIIVPAGVPRKPGMTRDDLFKINAGIV 141

Query: 512  KSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFY 691
            K+L   IAK CP A+VN+ISNPVNSTVPIAAEVFKKAGTYD KRL GVT LDVVRA TF 
Sbjct: 142  KTLCEGIAKCCPRAIVNLISNPVNSTVPIAAEVFKKAGTYDPKRLLGVTMLDVVRANTFV 201

Query: 692  XXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAK 871
                           +GGHAG+TILPL SQ  P ++   + I  LT R Q+GGTEVVEAK
Sbjct: 202  AEVLGLDPRDVDVPVVGGHAGVTILPLLSQVKPPSSFTQEEISYLTDRIQNGGTEVVEAK 261

Query: 872  AGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEE 1051
            AG GSATLSMAYA   FADACL+GL G   V+EC+FV S VTELPFFASKVRLG+NG+EE
Sbjct: 262  AGAGSATLSMAYAAVKFADACLRGLRGDAGVIECAFVSSQVTELPFFASKVRLGRNGIEE 321

Query: 1052 VLGLGSLTDF 1081
            V  LG L ++
Sbjct: 322  VYSLGPLNEY 331



>pir|T09263|T09263 malate dehydrogenase (EC 1.1.1.37) precursor,
            glyoxysomal - alfalfa>gb:AF020270_1761621 Medicago sativa
            glyoxysomal malate dehydrogenase precursor (gmdh) mRNA,
            complete cds.
          Length = 358

 Score =  374 bits (961), Expect = e-102
 Identities = 197/316 (62%), Positives = 225/316 (71%)
 Frame = +2

Query: 200  ASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEV 379
            A G  P  KVAILGAAGGIGQPLS+LMK+N LVS L L+D+  TPGV +D+SH++T + V
Sbjct: 40   AKGGTPGFKVAILGAAGGIGQPLSMLMKMNLLVSVLHLYDVVNTPGVTSDISHMDTSAVV 99

Query: 380  VGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALV 559
             GF G   L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAK CP A+V
Sbjct: 100  RGFLGQNQLEDALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEAIAKRCPKAIV 159

Query: 560  NMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXI 739
            N+ISNPVNSTVPIAAEVFK+AGTYD KRL GVT LDVVRA TF                +
Sbjct: 160  NLISNPVNSTVPIAAEVFKRAGTYDPKRLLGVTMLDVVRANTFVAEVMGLDPRDVDVPVV 219

Query: 740  GGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAI 919
            GGHAGITILPL SQ  P ++     I  LT R Q+GGTEVVEAKAG GSATLSMAYA   
Sbjct: 220  GGHAGITILPLLSQVKPPSSFTPKEIEYLTDRIQNGGTEVVEAKAGAGSATLSMAYAAVK 279

Query: 920  FADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXX 1099
            FADACL+ L G  D+++C++V S VTELPFFASKVRLG+NGVEE L LG L+D+      
Sbjct: 280  FADACLRALKGEADIIQCAYVDSQVTELPFFASKVRLGRNGVEEFLPLGPLSDYERASLE 339

Query: 1100 XXXXXXXXXXXXGIQF 1147
                        G+ F
Sbjct: 340  KAKKELATSVEKGVSF 355



>sp|P46488|MDHG_CUCSA Malate dehydrogenase, glyoxysomal precursor (EC
            1.1.1.37).>pir|S52039|S52039 malate dehydrogenase (EC
            1.1.1.37) - cucumber>gb:CUSMDHG_1674339 Cucumis sativus
            glyoxysomal malate dehydrogenase (mdhG) mRNA, complete
            cds.
          Length = 356

 Score =  374 bits (961), Expect = e-102
 Identities = 193/294 (65%), Positives = 223/294 (75%)
 Frame = +2

Query: 200  ASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEV 379
            A G AP  KVAILGAAGGIGQPL++LMK+NPLVS L L+D+   PGV AD+SH++T + V
Sbjct: 38   AKGGAPGFKVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVVNAPGVTADISHMDTGAVV 97

Query: 380  VGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALV 559
             GF G + L +AL G D+V+IPAGVPRKPGMTRDDLF INAGIVK+L   IAK CP A+V
Sbjct: 98   RGFLGQQQLERALTGMDLVVIPAGVPRKPGMTRDDLFKINAGIVKTLCEGIAKCCPTAIV 157

Query: 560  NMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXI 739
            N+ISNPVNSTVPIAAEVFKKAGTYD KRL GVT LDVVRA TF                +
Sbjct: 158  NLISNPVNSTVPIAAEVFKKAGTYDPKRLLGVTMLDVVRANTFVAEVLGLDPRDVNVPVV 217

Query: 740  GGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAI 919
            GGHAG+TILPL SQ  P ++   + I  LT R Q+GGTEVVEAKAG GSATLSMAYA   
Sbjct: 218  GGHAGVTILPLLSQVKPPSSFTQEEINYLTDRIQNGGTEVVEAKAGAGSATLSMAYAAVK 277

Query: 920  FADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            FADACL+GL G   VVEC+FV S VTELPFFA+KVRLG+NG++EV  LG L ++
Sbjct: 278  FADACLRGLRGDAGVVECAFVSSQVTELPFFATKVRLGRNGIDEVYSLGPLNEY 331



>gb:CQ834923_1454118 Sequence 2 from Patent WO2004058956.
          Length = 358

 Score =  371 bits (953), Expect = e-101
 Identities = 194/319 (60%), Positives = 225/319 (70%)
 Frame = +2

Query: 200  ASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEV 379
            A G +P  KVAILGAAGGIGQPL++LMK NPLVS L L+D+A TPGV AD+SH++T + V
Sbjct: 40   AKGGSPGFKVAILGAAGGIGQPLAMLMKTNPLVSVLHLYDVANTPGVTADISHMDTGAVV 99

Query: 380  VGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALV 559
             GF G + L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIV++L   IAK CP A+V
Sbjct: 100  RGFLGPQQLEDALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLCEGIAKCCPKAIV 159

Query: 560  NMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXI 739
            N+ISNPVNSTVPIAAEVFKKAGT+D +RL GVT LD+VRA TF                +
Sbjct: 160  NIISNPVNSTVPIAAEVFKKAGTFDPRRLLGVTMLDIVRANTFVAEVLGLDPREVDVPVV 219

Query: 740  GGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAI 919
            GGHAG+TILPL SQ  P  +   +    LT R Q+GGTEVVEAKAG GSATLSMAYA   
Sbjct: 220  GGHAGVTILPLLSQVKPPCSFTPEETEYLTSRIQNGGTEVVEAKAGAGSATLSMAYAAVK 279

Query: 920  FADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXX 1099
            FADACL GL G   +VEC+FV S VTELPFFASKVRLG+NGVEE+  LG L ++      
Sbjct: 280  FADACLHGLRGDAGIVECAFVSSQVTELPFFASKVRLGRNGVEEIYPLGPLNEYERSGLE 339

Query: 1100 XXXXXXXXXXXXGIQFANQ 1156
                        G+ F  +
Sbjct: 340  KAKKELATSVQKGVNFVKK 358



>gb:AY166633_1586190 Pisum sativum putative malate dehydrogenase (MDH)
            mRNA, complete cds.
          Length = 356

 Score =  370 bits (951), Expect = e-101
 Identities = 193/316 (61%), Positives = 226/316 (71%)
 Frame = +2

Query: 200  ASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEV 379
            A G AP  KVAILGAAGGIGQPLSLL+K+NPLVS L L+D+  TPGV ADVSH++T + V
Sbjct: 38   AKGGAPGFKVAILGAAGGIGQPLSLLLKMNPLVSVLHLYDVVNTPGVTADVSHMDTGAVV 97

Query: 380  VGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALV 559
             GF G   L  AL G D+V+IPAGVPRKPGMTRDDLF INAGIV++L   +AK CP+A+V
Sbjct: 98   RGFLGQPQLENALTGMDLVVIPAGVPRKPGMTRDDLFKINAGIVRTLCEGVAKSCPNAIV 157

Query: 560  NMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXI 739
            N+ISNPVNSTVPIAAEVFKKAGTYD KRL GVTTLDVVRA TF                +
Sbjct: 158  NLISNPVNSTVPIAAEVFKKAGTYDPKRLLGVTTLDVVRANTFVAEVLGVDPREVDVPVV 217

Query: 740  GGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAI 919
            GGHAG+TILPL SQ  P ++ + +    LT R Q+GGTEVVEAKAG GSATLSMAYA A 
Sbjct: 218  GGHAGVTILPLLSQVKPPSSFSAEEAEYLTNRIQNGGTEVVEAKAGAGSATLSMAYAAAK 277

Query: 920  FADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXX 1099
            FA++CL GL G   VVEC+FV S VT+LPFFA+KVRLG+ G EE+  LG L ++      
Sbjct: 278  FANSCLHGLKGEAGVVECAFVDSQVTDLPFFATKVRLGRGGAEEIYQLGPLNEYERAGLE 337

Query: 1100 XXXXXXXXXXXXGIQF 1147
                        G++F
Sbjct: 338  KAKTELAGSIQKGVEF 353



>gb:AY725476_1624503 Lycopersicon esculentum glyoxisomal malate
            dehydrogenase (gMDH) mRNA, complete cds; nuclear gene for
            glyoxisomal product.
          Length = 357

 Score =  369 bits (947), Expect = e-101
 Identities = 198/329 (60%), Positives = 226/329 (68%), Gaps = 1/329 (0%)
 Frame = +2

Query: 164  VSDGSRVARRGF-ASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGV 340
            + DGS + R    A G A   KVAILGAAGGIGQPL++LMK+NPLVS L L+D+   PGV
Sbjct: 26   MGDGSILERTNCRAKGGAAGFKVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVVNAPGV 85

Query: 341  AADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSL 520
             AD+SH++T + V GF G   L  AL G D+VIIPAG+PRKPGMTRDDLF INAGIV++L
Sbjct: 86   TADISHMDTGAVVRGFLGQSELEGALTGMDLVIIPAGIPRKPGMTRDDLFKINAGIVRTL 145

Query: 521  SAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXX 700
               IAK CP+A+VN+ISNPVNSTVPIAAEVFKKAGTYD K+L GVT+LDVVRA TF    
Sbjct: 146  CEGIAKCCPNAIVNLISNPVNSTVPIAAEVFKKAGTYDPKKLLGVTSLDVVRANTFVAEV 205

Query: 701  XXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGK 880
                        +GGHAG+TILPL SQ  P  +  H+    LTKR QDGGTEVVEAK G 
Sbjct: 206  LGLDPREVEVPVVGGHAGVTILPLLSQVKPPCSFTHEETEYLTKRIQDGGTEVVEAKKGA 265

Query: 881  GSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLG 1060
            GSATLSMAYA   FAD CLKGL G   VV C+FV S VTELPFFASKVRLG+ G EEV  
Sbjct: 266  GSATLSMAYAAVKFADVCLKGLRGDAGVVACAFVASQVTELPFFASKVRLGRTGAEEVYQ 325

Query: 1061 LGSLTDFXXXXXXXXXXXXXXXXXXGIQF 1147
            LG L ++                  GI F
Sbjct: 326  LGPLNEYERIGLEKAKKELAESIQKGISF 354



>sp|Q9ZP05|MDHG_ARATH Malate dehydrogenase, glyoxysomal precursor (EC
            1.1.1.37) (mbNAD-MDH).>pir|T49932|T49932 malate
            dehydrogenase (EC 1.1.1.37) precursor, NAD-dependent,
            glyoxysomal [validated] - Arabidopsis
            thaliana>gb:AB020752_1514675 Arabidopsis thaliana genomic
            DNA, chromosome 5, P1 clone:MTH16.>gb:ATF17I14_1548920
            Arabidopsis thaliana DNA chromosome 5, BAC clone F17I14
            (ESSA project).>gb:ATH131206_1551979 Arabidopsis thaliana
            mRNA for microbody NAD-dependent malate
            dehydrogenase.>gb:AY037252_1560146 Arabidopsis thaliana
            AT5g09660/F17I14_150 mRNA, complete
            cds.>gb:AY077653_1567855 Arabidopsis thaliana
            AT5g09660/F17I14_150 mRNA, complete
            cds.>gb:AF428373_1799303 Arabidopsis thaliana
            AT5g09660/F17I14_150 mRNA, complete cds.
          Length = 354

 Score =  366 bits (940), Expect = e-100
 Identities = 195/316 (61%), Positives = 223/316 (70%)
 Frame = +2

Query: 200  ASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEV 379
            A G  P  KVAILGAAGGIGQ LSLLMK+NPLVS L L+D+   PGV ADVSH++T + V
Sbjct: 36   AKGGNPGFKVAILGAAGGIGQSLSLLMKMNPLVSLLHLYDVVNAPGVTADVSHMDTGAVV 95

Query: 380  VGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALV 559
             GF G + L  AL G D+VIIPAG+PRKPGMTRDDLF INAGIVK+L   +AK CP+A+V
Sbjct: 96   RGFLGAKQLEDALTGMDLVIIPAGIPRKPGMTRDDLFKINAGIVKTLCEGVAKCCPNAIV 155

Query: 560  NMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXI 739
            N+ISNPVNSTVPIAAEVFKKAGTYD K+L GVTTLDV RA TF                +
Sbjct: 156  NLISNPVNSTVPIAAEVFKKAGTYDPKKLLGVTTLDVARANTFVAEVLGLDPREVDVPVV 215

Query: 740  GGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAI 919
            GGHAG+TILPL SQ  P ++     I  LT R Q+GGTEVVEAKAG GSATLSMAYA A 
Sbjct: 216  GGHAGVTILPLLSQVKPPSSFTPQEIEYLTNRIQNGGTEVVEAKAGAGSATLSMAYAAAK 275

Query: 920  FADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXX 1099
            FADACL+GL G  +VVECSFV S VTEL FFA+KVRLG+ G EEV  LG L ++      
Sbjct: 276  FADACLRGLRGDANVVECSFVASQVTELAFFATKVRLGRTGAEEVYQLGPLNEYERIGLE 335

Query: 1100 XXXXXXXXXXXXGIQF 1147
                        G++F
Sbjct: 336  KAKDELAGSIQKGVEF 351



>gb:AY057682_1564095 Arabidopsis thaliana AT5g09660/F17I14_150 mRNA,
            complete cds.
          Length = 354

 Score =  366 bits (939), Expect = e-100
 Identities = 194/316 (61%), Positives = 223/316 (70%)
 Frame = +2

Query: 200  ASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEV 379
            A G  P  KVAILGAAGGIGQ LSLLMK+NPLVS L L+D+   PGV ADVSH++T + V
Sbjct: 36   AKGGNPGFKVAILGAAGGIGQSLSLLMKMNPLVSLLHLYDVVNAPGVTADVSHMDTGAVV 95

Query: 380  VGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALV 559
             GF G + L  AL G D+VIIPAG+PRKPGMTRDDLF INAGIVK+L   +AK CP+A+V
Sbjct: 96   RGFLGAKQLEDALTGMDLVIIPAGIPRKPGMTRDDLFKINAGIVKTLCEGVAKCCPNAIV 155

Query: 560  NMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXI 739
            N+ISNPVNST+PIAAEVFKKAGTYD K+L GVTTLDV RA TF                +
Sbjct: 156  NLISNPVNSTIPIAAEVFKKAGTYDPKKLLGVTTLDVARANTFVAEVLGLDPREVDVPVV 215

Query: 740  GGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAI 919
            GGHAG+TILPL SQ  P ++     I  LT R Q+GGTEVVEAKAG GSATLSMAYA A 
Sbjct: 216  GGHAGVTILPLLSQVKPPSSFTPQEIEYLTNRIQNGGTEVVEAKAGAGSATLSMAYAAAK 275

Query: 920  FADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXX 1099
            FADACL+GL G  +VVECSFV S VTEL FFA+KVRLG+ G EEV  LG L ++      
Sbjct: 276  FADACLRGLRGDANVVECSFVASQVTELAFFATKVRLGRTGAEEVYQLGPLNEYERIGLE 335

Query: 1100 XXXXXXXXXXXXGIQF 1147
                        G++F
Sbjct: 336  KAKDELAGSIQKGVEF 351



>gb:SOYGMDH_1716014 Glycine max glyoxysomal malate dehydrogenase mRNA,
            3' end.
          Length = 350

 Score =  364 bits (934), Expect = 3e-99
 Identities = 195/316 (61%), Positives = 221/316 (69%)
 Frame = +2

Query: 200  ASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEV 379
            A G     KVAILGAAGGIGQPL++LMK+NPLVS L L+D+  TPGV +D+SH++T + V
Sbjct: 32   AKGGVSGFKVAILGAAGGIGQPLAMLMKMNPLVSLLHLYDVVNTPGVTSDISHMDTGAVV 91

Query: 380  VGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALV 559
             GF G + L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAK CP A+V
Sbjct: 92   RGFLGQQQLEDALIGMDLVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEAIAKCCPKAIV 151

Query: 560  NMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXI 739
            N+ISNPVNSTVPIAAEVFK+AGTYD KRL GVT LDVVRA TF                +
Sbjct: 152  NVISNPVNSTVPIAAEVFKRAGTYDPKRLLGVTMLDVVRANTFVAEVLGVDPRDVDVPVV 211

Query: 740  GGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAI 919
            GGHAGITILPL SQ  P  +     I  LT R Q+GG EVVEAKAG GSATLSMAYA   
Sbjct: 212  GGHAGITILPLLSQIKPPCSFTPKEIEYLTGRIQNGGPEVVEAKAGAGSATLSMAYAAVK 271

Query: 920  FADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXX 1099
            FADACL  L G   ++EC++V S VTELPFFASKVRLG+ GVEE+L LG L D+      
Sbjct: 272  FADACLHALRGDAGIIECAYVASQVTELPFFASKVRLGRVGVEEILPLGPLNDYERESLE 331

Query: 1100 XXXXXXXXXXXXGIQF 1147
                        GI F
Sbjct: 332  KAKKELAASIEKGISF 347



>sp|P37228|MDHG_SOYBN Malate dehydrogenase, glyoxysomal precursor (EC
            1.1.1.37).
          Length = 353

 Score =  364 bits (934), Expect = 3e-99
 Identities = 195/316 (61%), Positives = 221/316 (69%)
 Frame = +2

Query: 200  ASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEV 379
            A G     KVAILGAAGGIGQPL++LMK+NPLVS L L+D+  TPGV +D+SH++T + V
Sbjct: 35   AKGGVSGFKVAILGAAGGIGQPLAMLMKMNPLVSLLHLYDVVNTPGVTSDISHMDTGAVV 94

Query: 380  VGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALV 559
             GF G + L  AL G D+VIIPAGVPRKPGMTRDDLFNINAGIVK+L  AIAK CP A+V
Sbjct: 95   RGFLGQQQLEDALIGMDLVIIPAGVPRKPGMTRDDLFNINAGIVKTLCEAIAKCCPKAIV 154

Query: 560  NMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXI 739
            N+ISNPVNSTVPIAAEVFK+AGTYD KRL GVT LDVVRA TF                +
Sbjct: 155  NVISNPVNSTVPIAAEVFKRAGTYDPKRLLGVTMLDVVRANTFVAEVLGVDPRDVDVPVV 214

Query: 740  GGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAI 919
            GGHAGITILPL SQ  P  +     I  LT R Q+GG EVVEAKAG GSATLSMAYA   
Sbjct: 215  GGHAGITILPLLSQIKPPCSFTPKEIEYLTGRIQNGGPEVVEAKAGAGSATLSMAYAAVK 274

Query: 920  FADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXX 1099
            FADACL  L G   ++EC++V S VTELPFFASKVRLG+ GVEE+L LG L D+      
Sbjct: 275  FADACLHALRGDAGIIECAYVASQVTELPFFASKVRLGRVGVEEILPLGPLNDYERESLE 334

Query: 1100 XXXXXXXXXXXXGIQF 1147
                        GI F
Sbjct: 335  KAKKELAASIEKGISF 350



>sp|Q9XFW3|MDHH_BRANA Malate dehydrogenase 2, glyoxysomal precursor
            (EC 1.1.1.37).>gb:BNA242713_1633272 Brassica napus mdh2
            gene for malate dehydrogenase 2.
          Length = 358

 Score =  363 bits (931), Expect = 6e-99
 Identities = 192/294 (65%), Positives = 218/294 (74%)
 Frame = +2

Query: 200  ASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEV 379
            A G  P  KVAILGAAGGIGQ LSLLMK+NPLVS L L+D+   PGV ADVSH++T + V
Sbjct: 40   AKGGNPGFKVAILGAAGGIGQSLSLLMKMNPLVSLLHLYDVVNAPGVTADVSHMDTGAVV 99

Query: 380  VGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALV 559
             GF G + L  AL G D+VIIPAGVPRKPGMTRDDLF INAGIVK+L   +AK CP+A+V
Sbjct: 100  RGFLGAKQLEDALTGMDLVIIPAGVPRKPGMTRDDLFKINAGIVKTLCEGVAKCCPNAIV 159

Query: 560  NMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXI 739
            N+ISNPVNSTV IAAEVFKKAGTYD K+L GVTTLDV RA TF                +
Sbjct: 160  NLISNPVNSTVAIAAEVFKKAGTYDPKKLLGVTTLDVARANTFVAEVLGLDPREVDVPVV 219

Query: 740  GGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAI 919
            GGHAG+TILPL SQ  P ++     I  LT R Q+GGTEVVEAKAG GSATLSMAYA A 
Sbjct: 220  GGHAGVTILPLLSQVKPPSSFTPSEIEYLTNRIQNGGTEVVEAKAGAGSATLSMAYAAAK 279

Query: 920  FADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            FADACL+GL G  +V+ECSFV S VTEL FFA+KVRLG+ G EEV  LG L ++
Sbjct: 280  FADACLRGLRGDANVIECSFVASQVTELAFFATKVRLGRTGAEEVFQLGPLNEY 333



>gb:AE014297_1140144 Drosophila melanogaster chromosome 3R, complete
            sequence.>gb:AE003721_1222137 Drosophila melanogaster
            chromosome 3R, section 59 of 118 of the complete
            sequence.>gb:AY119152_1300874 Drosophila melanogaster
            RE60471 full insert cDNA.
          Length = 336

 Score =  362 bits (929), Expect = 1e-98
 Identities = 193/339 (56%), Positives = 235/339 (69%)
 Frame = +2

Query: 137  MLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLF 316
            ML+ + K     G R     F+ G     KV + GAAGGIGQPLSLL+K NPLV+ L+L+
Sbjct: 1    MLKQVTKQLALQGVRT----FSVGQQNNYKVTVCGAAGGIGQPLSLLLKQNPLVTDLALY 56

Query: 317  DIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNI 496
            DI  TPGVAAD+SHI+T+S+  GF G + LG +L+G+DVV+IPAGVPRKPGMTRDDLFN+
Sbjct: 57   DIVHTPGVAADLSHIDTKSKTAGFIGADQLGDSLKGSDVVVIPAGVPRKPGMTRDDLFNV 116

Query: 497  NAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVR 676
            NAGI+K +S +IAK CP ALV +I+NPVN+ VPIAAE+ KKAG YD KRLFGV+TLDVVR
Sbjct: 117  NAGIIKDISNSIAKNCPKALVAIITNPVNTCVPIAAEILKKAGVYDPKRLFGVSTLDVVR 176

Query: 677  AKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTE 856
            A+ F                IGGH+G+TILP+ SQ+ P      D I  LT R Q+ GTE
Sbjct: 177  ARAFIGHALGVDPQTVQIPVIGGHSGVTILPVLSQSQPLFKGNQDTIEKLTVRIQEAGTE 236

Query: 857  VVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGK 1036
            VV+AKAG GSATLSMAYAGA FA + LKGLNG  +V+ECS+VQSTVTE  FF++ + LGK
Sbjct: 237  VVKAKAGAGSATLSMAYAGARFAGSLLKGLNGEKNVIECSYVQSTVTEATFFSTPLVLGK 296

Query: 1037 NGVEEVLGLGSLTDFXXXXXXXXXXXXXXXXXXGIQFAN 1153
            NGV+E LGL  L D+                  GI FAN
Sbjct: 297  NGVQENLGLPKLNDYEKKLLEAAIPELKKNIQKGIDFAN 335



>sp|Q43743|MDHG_BRANA Malate dehydrogenase 1, glyoxysomal precursor
            (EC 1.1.1.37).>gb:BNA242712_1633271 Brassica napus mdh1
            gene for malate dehydrogenase 1.
          Length = 358

 Score =  362 bits (928), Expect = 1e-98
 Identities = 191/294 (64%), Positives = 218/294 (74%)
 Frame = +2

Query: 200  ASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEV 379
            A G  P  KVAILGAAGGIGQ LSLLMK+NPLVS L L+D+   PGV ADVSH++T + V
Sbjct: 40   AKGGNPGFKVAILGAAGGIGQSLSLLMKMNPLVSLLHLYDVVNAPGVTADVSHMDTGAVV 99

Query: 380  VGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALV 559
             GF G + L  AL G D+VIIPAGVPRKPGMTRDDLF INAGIV++L   +AK CP+A+V
Sbjct: 100  RGFLGAKQLEDALTGMDLVIIPAGVPRKPGMTRDDLFKINAGIVRTLCEGVAKCCPNAIV 159

Query: 560  NMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXI 739
            N+ISNPVNSTV IAAEVFKKAGTYD K+L GVTTLDV RA TF                +
Sbjct: 160  NLISNPVNSTVAIAAEVFKKAGTYDPKKLLGVTTLDVARANTFVAEVLGLDPREVDVPVV 219

Query: 740  GGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAI 919
            GGHAG+TILPL SQ  P ++     I  LT R Q+GGTEVVEAKAG GSATLSMAYA A 
Sbjct: 220  GGHAGVTILPLLSQVKPPSSFTPSEIEYLTNRIQNGGTEVVEAKAGAGSATLSMAYAAAK 279

Query: 920  FADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            FADACL+GL G  +V+ECSFV S VTEL FFA+KVRLG+ G EEV  LG L ++
Sbjct: 280  FADACLRGLRGDANVIECSFVASQVTELAFFATKVRLGRTGAEEVFQLGPLNEY 333



>pir|T51862|T51862 malate dehydrogenase (EC 1.1.1.37), chloroplast
            [validated] - Arabidopsis thaliana>gb:ATMDH_1553729
            Arabidopsis thaliana mRNA for chloroplast NAD-dependent
            malate dehydrogenase.
          Length = 403

 Score =  351 bits (901), Expect = 2e-95
 Identities = 189/344 (54%), Positives = 234/344 (68%), Gaps = 2/344 (0%)
 Frame = +2

Query: 131  SSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLS 310
            SS L   L+ SV++     ++ +        KVA+LGAAGGIGQPLSLL+K++PLVS L 
Sbjct: 53   SSSLTKTLRGSVTNAQTSDKKPYGFKINASYKVAVLGAAGGIGQPLSLLIKMSPLVSTLH 112

Query: 311  LFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLF 490
            L+DIA   GVAAD+SH NT S+V  F+G   L   L+  +VV+IPAGVPRKPGMTRDDLF
Sbjct: 113  LYDIANVKGVAADLSHCNTPSQVRDFTGPSELADCLKDVNVVVIPAGVPRKPGMTRDDLF 172

Query: 491  NINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDV 670
            NINA IVK+L  A+A+ CP+A +++ISNPVNSTVPIAAEV KK G YD K+LFGVTTLDV
Sbjct: 173  NINANIVKTLVEAVAENCPNAFIHIISNPVNSTVPIAAEVLKKKGVYDPKKLFGVTTLDV 232

Query: 671  VRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGG 850
            VRA TF                IGGHAGITILPL S+  P  N   + I  LT R Q+ G
Sbjct: 233  VRANTFVSQKKNLKLIDVDVPVIGGHAGITILPLLSKTKPSVNFTDEEIQELTVRIQNAG 292

Query: 851  TEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRL 1030
            TEVV+AKAG GSATLSMAYA A F ++ L+ L+G  DV ECSFV+ST+T+LPFFAS+V++
Sbjct: 293  TEVVDAKAGAGSATLSMAYAAARFVESSLRALDGDGDVYECSFVESTLTDLPFFASRVKI 352

Query: 1031 GKNGVEEVL--GLGSLTDFXXXXXXXXXXXXXXXXXXGIQFANQ 1156
            GKNG+E V+   L  LT++                  G+ FAN+
Sbjct: 353  GKNGLEAVIESDLQGLTEYEQKALEALKVELKASIDKGVAFANK 396



>pir|T45712|T45712 NAD-dependent malate dehydrogenase, chloroplast -
            Arabidopsis thaliana>gb:ATF1P2_1549422 Arabidopsis
            thaliana DNA chromosome 3, BAC clone
            F1P2.>gb:AY128281_1580583 Arabidopsis thaliana
            AT3g47520/F1P2_70 mRNA, complete cds.>gb:BT000621_1634899
            Arabidopsis thaliana chloroplast NAD-dependent malate
            dehydrogenase (At3g47520/F1P2_70) mRNA, complete cds.
          Length = 403

 Score =  350 bits (899), Expect = 3e-95
 Identities = 189/344 (54%), Positives = 233/344 (67%), Gaps = 2/344 (0%)
 Frame = +2

Query: 131  SSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLS 310
            SS L   L+ SV+      ++ +        KVA+LGAAGGIGQPLSLL+K++PLVS L 
Sbjct: 53   SSSLAKTLRGSVTKAQTSDKKPYGFKINASYKVAVLGAAGGIGQPLSLLIKMSPLVSTLH 112

Query: 311  LFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLF 490
            L+DIA   GVAAD+SH NT S+V  F+G   L   L+  +VV+IPAGVPRKPGMTRDDLF
Sbjct: 113  LYDIANVKGVAADLSHCNTPSQVRDFTGPSELADCLKDVNVVVIPAGVPRKPGMTRDDLF 172

Query: 491  NINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDV 670
            NINA IVK+L  A+A+ CP+A +++ISNPVNSTVPIAAEV KK G YD K+LFGVTTLDV
Sbjct: 173  NINANIVKTLVEAVAENCPNAFIHIISNPVNSTVPIAAEVLKKKGVYDPKKLFGVTTLDV 232

Query: 671  VRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGG 850
            VRA TF                IGGHAGITILPL S+  P  N   + I  LT R Q+ G
Sbjct: 233  VRANTFVSQKKNLKLIDVDVPVIGGHAGITILPLLSKTKPSVNFTDEEIQELTVRIQNAG 292

Query: 851  TEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRL 1030
            TEVV+AKAG GSATLSMAYA A F ++ L+ L+G  DV ECSFV+ST+T+LPFFAS+V++
Sbjct: 293  TEVVDAKAGAGSATLSMAYAAARFVESSLRALDGDGDVYECSFVESTLTDLPFFASRVKI 352

Query: 1031 GKNGVEEVL--GLGSLTDFXXXXXXXXXXXXXXXXXXGIQFANQ 1156
            GKNG+E V+   L  LT++                  G+ FAN+
Sbjct: 353  GKNGLEAVIESDLQGLTEYEQKALEALKVELKASIDKGVAFANK 396



>gb:AP004666_1842949 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 8, PAC
            clone:P0431A03.>gb:AP005757_1857322 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 8, PAC
            clone:P0413H11.
          Length = 397

 Score =  350 bits (897), Expect = 5e-95
 Identities = 194/355 (54%), Positives = 235/355 (66%), Gaps = 6/355 (1%)
 Frame = +2

Query: 110  SLEIEMRSSMLRSLLKNSVSDGSRVARRGFASGS--APER--KVAILGAAGGIGQPLSLL 277
            S+  E  SS L        S   R+  +   SGS  +PE   KVA+LGAAGGIGQPL LL
Sbjct: 36   SVSFESGSSFLGRNASLRASVAPRIVPKA-KSGSQISPEASYKVAVLGAAGGIGQPLGLL 94

Query: 278  MKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVP 457
            +K++PLVS L L+DIA   GVAAD+SH NT S+V+ F+G   L   L+G DVV+IPAGVP
Sbjct: 95   IKMSPLVSELHLYDIANVKGVAADLSHCNTPSQVLDFTGPSELANCLKGVDVVVIPAGVP 154

Query: 458  RKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDE 637
            RKPGMTRDDLFNINA IVKSL  A+A  CP A +++ISNPVNSTVPIAAEV K+ G Y+ 
Sbjct: 155  RKPGMTRDDLFNINASIVKSLVEAVADNCPEAFIHIISNPVNSTVPIAAEVLKQKGVYNP 214

Query: 638  KRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVI 817
            K+LFGVTTLDVVRA TF                +GGHAGITILPL S+  P      +  
Sbjct: 215  KKLFGVTTLDVVRANTFVAQKKNLKLIDVDVPVVGGHAGITILPLLSKTMPSVTFTDEET 274

Query: 818  VGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVT 997
              LTKR Q+ GTEVVEAKAG GSATLSMAYA A F ++ L+ L G PDV EC+FVQS +T
Sbjct: 275  EQLTKRIQNAGTEVVEAKAGAGSATLSMAYAAARFVESSLRALAGDPDVYECTFVQSELT 334

Query: 998  ELPFFASKVRLGKNGVEEVLG--LGSLTDFXXXXXXXXXXXXXXXXXXGIQFANQ 1156
            ELPFFAS+V+LGKNGVE ++   L  +T++                  GI+F ++
Sbjct: 335  ELPFFASRVKLGKNGVESIISADLEGVTEYEAKALEALKSELKASIEKGIEFVHK 389



>gb:AP003252_1826338 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 1, PAC
            clone:P0446G04.>gb:AP003734_1832603 Oryza sativa
            (japonica cultivar-group) genomic DNA, chromosome 1, BAC
            clone:B1088C09.
          Length = 396

 Score =  347 bits (891), Expect = 3e-94
 Identities = 192/355 (54%), Positives = 239/355 (67%), Gaps = 6/355 (1%)
 Frame = +2

Query: 110  SLEIEMRSSML--RSLLKNSVSDGSRVARRGFASGSAPER--KVAILGAAGGIGQPLSLL 277
            S+  E RSS L   + L++S+S    V +    S  +PE   KVA+LGAAGGIGQPL LL
Sbjct: 36   SISFESRSSFLGQNASLRSSISPRI-VPKANSGSHISPEASYKVAVLGAAGGIGQPLGLL 94

Query: 278  MKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVP 457
            +K++PLVS L L+DIA   GVAAD+SH NT S+V+ F+G   L   L+G DVV+IPAGVP
Sbjct: 95   IKMSPLVSALHLYDIANVKGVAADLSHCNTPSQVLDFTGPSELANCLKGVDVVVIPAGVP 154

Query: 458  RKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDE 637
            RKPGMTRDDLFNINA IVK+L  A+A  CP A +++ISNPVNSTVPIAAEV K+ G Y+ 
Sbjct: 155  RKPGMTRDDLFNINASIVKTLVEAVADNCPEAFIHIISNPVNSTVPIAAEVLKQKGVYNP 214

Query: 638  KRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVI 817
            K+LFGVTTLDVVRA TF                +GGHAGITILPL S+  P     ++  
Sbjct: 215  KKLFGVTTLDVVRANTFIAQKKNLKLIDVDVPVVGGHAGITILPLLSKTRPSVTFTNEET 274

Query: 818  VGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVT 997
              LT+R Q+ GTEVVEAKAG GSATLSMAYA A F ++ L+ L G PDV EC+FVQS +T
Sbjct: 275  EELTRRIQNAGTEVVEAKAGAGSATLSMAYAAARFVESSLRALAGDPDVYECTFVQSELT 334

Query: 998  ELPFFASKVRLGKNGVEEVLG--LGSLTDFXXXXXXXXXXXXXXXXXXGIQFANQ 1156
            EL FFAS+V+LGKNGVE ++   L  +T++                  GI+F ++
Sbjct: 335  ELLFFASRVKLGKNGVESIISSDLEGVTEYEAKALESLKPELKASIEKGIEFVHK 389



>gb:NTA6974_1691436 Nicotiana tabacum mRNA for NAD-malate
            dehydrogenase.
          Length = 412

 Score =  345 bits (885), Expect = 1e-93
 Identities = 182/316 (57%), Positives = 228/316 (72%), Gaps = 4/316 (1%)
 Frame = +2

Query: 146  SLLKNSVSDGSRVARRGFASGSAPER--KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFD 319
            ++LK S +  ++   +G+ +   P+   KVA+LGA+GGIGQPLSLL+K++PLVS L+L+D
Sbjct: 67   AVLKQSFTPKAQKENKGYGNCVQPQASYKVAVLGASGGIGQPLSLLVKMSPLVSELNLYD 126

Query: 320  IAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNIN 499
            IA   GVAAD+SH NT S+V  F+G   L   L+G +VV+IPAGVPRKPGMTRDDLFNIN
Sbjct: 127  IANVKGVAADLSHCNTPSKVSDFTGASELANCLKGVNVVVIPAGVPRKPGMTRDDLFNIN 186

Query: 500  AGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRA 679
            A IVK+L  A+A  CP A +++ISNPVNSTVPIAAEV K+ G YD K+LFGVTTLDVVRA
Sbjct: 187  ANIVKTLVEAVADNCPDAFIHIISNPVNSTVPIAAEVLKRKGVYDPKKLFGVTTLDVVRA 246

Query: 680  KTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEV 859
             TF                +GGHAGITILPL S+  P      + +  LT R Q+ GTEV
Sbjct: 247  NTFVAQKKSLRLIDVDVPVVGGHAGITILPLLSKTKPSTTFTDEEVQELTVRIQNAGTEV 306

Query: 860  VEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKN 1039
            VEAKAG GSATLSMAYA A F ++ L+ L+G  DV EC+FVQS +TELPFFAS+V+LGKN
Sbjct: 307  VEAKAGAGSATLSMAYAAARFVESSLRALDGDSDVYECAFVQSDLTELPFFASRVKLGKN 366

Query: 1040 GVEEVL--GLGSLTDF 1081
            GVE ++   L  LT++
Sbjct: 367  GVEALIPSDLQGLTEY 382



>gb:AY842260_2546905 Xenopus tropicalis mitochondrial malate
            dehydrogenase 2 (Mdh2) mRNA, complete cds; nuclear gene
            for mitochondrial product.
          Length = 338

 Score =  345 bits (884), Expect = 2e-93
 Identities = 177/309 (57%), Positives = 225/309 (72%), Gaps = 7/309 (2%)
 Frame = +2

Query: 176  SRVAR-------RGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTP 334
            SR+AR       RG ++ +    +VA+LGA+GGIGQPLSLL+K +PL+S+L+L+DIA TP
Sbjct: 3    SRIARPASHGLIRGLSTTAQANARVAVLGASGGIGQPLSLLLKNSPLISNLTLYDIAHTP 62

Query: 335  GVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVK 514
            GVAAD+SHI TR++V G+ G E L ++L+GADVV+IPAGVPRKPGMTRDDLF  NA IV 
Sbjct: 63   GVAADLSHIETRAKVTGYLGAEQLPESLKGADVVVIPAGVPRKPGMTRDDLFTTNASIVA 122

Query: 515  SLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYX 694
            +L+ A AK+CP A++ +ISNPVNST+PI +EVFKK G Y+   +FGVTTLD+VRA TF  
Sbjct: 123  TLTEACAKHCPEAMICIISNPVNSTIPITSEVFKKHGVYNPNHIFGVTTLDIVRANTFVA 182

Query: 695  XXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKA 874
                          +GGHAG TI+PL SQ+TP+     D +  L  R QD GTEVV+AKA
Sbjct: 183  ELKGLDPARVNVPVVGGHAGKTIIPLISQSTPKVEFPQDQLEALIPRIQDAGTEVVKAKA 242

Query: 875  GKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEV 1054
            G GSATLSMAYAGA F  + L  +NG   V+ECSFV+S  TE P+F++ + LGKNG+E+ 
Sbjct: 243  GAGSATLSMAYAGARFVFSLLDAMNGKEGVIECSFVRSEETESPYFSTPLLLGKNGIEKN 302

Query: 1055 LGLGSLTDF 1081
            LGLG LT F
Sbjct: 303  LGLGKLTAF 311



>gb:AY681347_2543732 Xenopus laevis mitochondrial malate dehydrogenase
            2b (Mdh2b) mRNA, complete cds; nuclear gene for
            mitochondrial product.>gb:BC071073_2555937 Xenopus laevis
            MGC79037 protein, mRNA (cDNA clone MGC:79037
            IMAGE:4409121), complete cds.
          Length = 338

 Score =  345 bits (884), Expect = 2e-93
 Identities = 177/309 (57%), Positives = 227/309 (73%), Gaps = 7/309 (2%)
 Frame = +2

Query: 176  SRVAR-------RGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTP 334
            SR+AR       RG ++ +    +VA+LGA+GGIGQPLSLL+K +PL+S+L+L+DIA TP
Sbjct: 3    SRIARPAAHGLIRGLSTTAQANARVAVLGASGGIGQPLSLLLKNSPLISNLALYDIAHTP 62

Query: 335  GVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVK 514
            GVAAD+SHI TR++V G+ G E L ++L+GADVV+IPAGVPRKPGMTRDDLFN NA IV 
Sbjct: 63   GVAADLSHIETRAKVTGYLGAEQLPESLKGADVVVIPAGVPRKPGMTRDDLFNTNASIVA 122

Query: 515  SLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYX 694
            +L+ A AK+CP A++ +I+NPVNST+PI +EVFKK G Y+  R+FGVTTLD+VRA TF  
Sbjct: 123  TLTEACAKHCPEAMICIIANPVNSTIPITSEVFKKHGVYNPNRIFGVTTLDIVRANTFVA 182

Query: 695  XXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKA 874
                          IGGHAG TI+PL SQ+TP+     D +  L  R Q+ GTEVV+AKA
Sbjct: 183  ELKGLDPARVNVPVIGGHAGKTIIPLISQSTPKVEFPQDQLAVLIGRIQEAGTEVVKAKA 242

Query: 875  GKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEV 1054
            G GSATLSMAYAGA F  + L  +NG   V+ECSFV+S  TE P+F++ + LGKNG+E+ 
Sbjct: 243  GAGSATLSMAYAGARFVFSLLDAMNGKEGVIECSFVRSEETESPYFSTPLLLGKNGIEKN 302

Query: 1055 LGLGSLTDF 1081
            LGLG LT +
Sbjct: 303  LGLGKLTAY 311



>gb:AY282738_1315748 Branchiostoma belcheri tsingtaunese mitochondrial
            malate dehydrogenase precursor (MDH) mRNA, complete cds;
            nuclear gene for mitochondrial product.
          Length = 340

 Score =  344 bits (883), Expect = 2e-93
 Identities = 180/324 (55%), Positives = 221/324 (68%)
 Frame = +2

Query: 185  ARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHIN 364
            A R F++ +A   KVA+LGA+GGIGQPLSLL+K N  ++ L+L+DIA TPGVA D+SHI 
Sbjct: 17   ALRNFSTTTACNNKVAVLGASGGIGQPLSLLLKHNAAITQLALYDIAHTPGVACDLSHIE 76

Query: 365  TRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYC 544
            T SEV G+ GD  LG  LEG DVV+IPAGVPRKPGMTRDDLFN NA IV+ L  A  ++C
Sbjct: 77   TGSEVKGYLGDAELGACLEGCDVVVIPAGVPRKPGMTRDDLFNTNASIVRDLVKACTQHC 136

Query: 545  PHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXX 724
            P A + +++NPVNSTVPIA+EV K AGTYD  R+ GVTTLDVVRA TF            
Sbjct: 137  PTAFLLLVTNPVNSTVPIASEVCKAAGTYDPGRVIGVTTLDVVRANTFVANLKGLNPAEV 196

Query: 725  XXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMA 904
                +GGHAG TI+PL SQATP      + +  LTKR QD GTEVV AKAG GSATLSMA
Sbjct: 197  NVPVVGGHAGKTIIPLISQATPSVEFDPETLDNLTKRIQDAGTEVVNAKAGAGSATLSMA 256

Query: 905  YAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFX 1084
            YAGA F ++ L  LNG   V+EC F++S+ TE  +F++ + LGKNG+E+ LGLG L+DF 
Sbjct: 257  YAGARFTNSLLAALNGKEGVIECGFIKSSETESSYFSTPLLLGKNGIEKNLGLGKLSDFE 316

Query: 1085 XXXXXXXXXXXXXXXXXGIQFANQ 1156
                             G +FA+Q
Sbjct: 317  TKLVEDAMDELKGSIAKGEKFASQ 340



>gb:AF218064_1252056 Nucella lapillus malate dehydrogenase precursor
            (Mdh) mRNA, Mdh-10 allele, complete cds; nuclear gene for
            mitochondrial product.
          Length = 341

 Score =  343 bits (881), Expect = 4e-93
 Identities = 179/318 (56%), Positives = 226/318 (71%)
 Frame = +2

Query: 128  RSSMLRSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHL 307
            R S    L ++  S  S+V +         + KVA+LGAAGGIGQPLSLL+K  PL+SHL
Sbjct: 7    RPSQTLCLFRHHFSTSSKVGK---------DVKVAVLGAAGGIGQPLSLLLKEIPLISHL 57

Query: 308  SLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDL 487
            +L+DIA TPGVAAD+SHI TR++V GF G E L K LEGA++V+IPAGVPRKPGMTRDDL
Sbjct: 58   NLYDIAHTPGVAADLSHIETRAKVAGFLGPEELDKCLEGANIVLIPAGVPRKPGMTRDDL 117

Query: 488  FNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLD 667
            FN NAGIV+ L+  +A  CP A++ +I+NPVNSTVPIA+EV KK G YD KR+FGVTTLD
Sbjct: 118  FNTNAGIVRDLTERVAHVCPTAMLGIITNPVNSTVPIASEVLKKHGVYDPKRVFGVTTLD 177

Query: 668  VVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDG 847
            VVR+ TF                IGGH+G+TI+PL SQ TP  +   +    L+ R Q+ 
Sbjct: 178  VVRSNTFIAEAKALDVSKTNVPVIGGHSGVTIIPLISQCTPPVSFPENEREKLSVRIQNA 237

Query: 848  GTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVR 1027
            GTEVVEAKAG GSATLSMAYA A F  + +  LNG  +VV+C+FV+S VT+  +F++ + 
Sbjct: 238  GTEVVEAKAGAGSATLSMAYAAAQFCKSLIDALNGKNEVVQCAFVRSDVTDATYFSTPLL 297

Query: 1028 LGKNGVEEVLGLGSLTDF 1081
            LGKNGVE+ LG+G L D+
Sbjct: 298  LGKNGVEKNLGMGKLLDY 315



>gb:MUSMDH_2128891 Mouse mitochondrial malate dehydrogenase (mMDH)
            mRNA, complete cds.
          Length = 338

 Score =  343 bits (879), Expect = 6e-93
 Identities = 175/298 (58%), Positives = 220/298 (73%)
 Frame = +2

Query: 188  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT 367
            RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct: 14   RRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET 73

Query: 368  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCP 547
            R++V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA A++CP
Sbjct: 74   RAKVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCP 133

Query: 548  HALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXX 727
             A+V +I+NPVNST+PI AEVFKK G Y+  ++FGVTTLD+VRA TF             
Sbjct: 134  EAMVCIIANPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVN 193

Query: 728  XXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAY 907
               IGGHAG TI+PL SQ TP+ +   D +  LT R Q+ GTEVV+AKAG GSATLSMAY
Sbjct: 194  VPVIGGHAGKTIIPLISQCTPKVDFPQDQLATLTGRIQEAGTEVVKAKAGAGSATLSMAY 253

Query: 908  AGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            AGA F  + +  +NG+  VVECSFVQS  TE  +F++ + LGK G+E+ LG+G +T F
Sbjct: 254  AGARFVFSLVDAMNGLEGVVECSFVQSKETECTYFSTPLLLGKKGLEKNLGIGKITPF 311



>sp|P08249|MDHM_MOUSE Malate dehydrogenase, mitochondrial precursor
            (EC 1.1.1.37).>gb:MMDH1_2114718 M.musculus mitochondrial
            malate dehydrogenase gene 5'flank and exon 1 (and joined
            CDS).
          Length = 338

 Score =  342 bits (878), Expect = 8e-93
 Identities = 175/298 (58%), Positives = 219/298 (73%)
 Frame = +2

Query: 188  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT 367
            RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct: 14   RRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET 73

Query: 368  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCP 547
            R+ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA A++CP
Sbjct: 74   RANVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCP 133

Query: 548  HALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXX 727
             A+V +I+NPVNST+PI AEVFKK G Y+  ++FGVTTLD+VRA TF             
Sbjct: 134  EAMVCIIANPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVN 193

Query: 728  XXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAY 907
               IGGHAG TI+PL SQ TP+ +   D +  LT R Q+ GTEVV+AKAG GSATLSMAY
Sbjct: 194  VPVIGGHAGKTIIPLISQCTPKVDFPQDQLATLTGRIQEAGTEVVKAKAGAGSATLSMAY 253

Query: 908  AGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            AGA F  + +  +NG+  VVECSFVQS  TE  +F++ + LGK G+E+ LG+G +T F
Sbjct: 254  AGARFVFSLVDAMNGLEGVVECSFVQSKETECTYFSTPLLLGKKGLEKNLGIGKITPF 311



>gb:BC063165_2105185 Rattus norvegicus malate dehydrogenase,
            mitochondrial, mRNA (cDNA clone MGC:72779 IMAGE:6918633),
            complete cds.
          Length = 338

 Score =  342 bits (876), Expect = 1e-92
 Identities = 174/298 (58%), Positives = 218/298 (73%)
 Frame = +2

Query: 188  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT 367
            RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct: 14   RRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET 73

Query: 368  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCP 547
            R+ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA A++CP
Sbjct: 74   RANVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCP 133

Query: 548  HALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXX 727
             A++ +ISNPVNST+PI AEVFKK G Y+  ++FGVTTLD+VRA TF             
Sbjct: 134  EAMICIISNPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVN 193

Query: 728  XXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAY 907
               IGGHAG TI+PL SQ TP+ +   D +  LT R Q+ GTEVV+AKAG GSATLSMAY
Sbjct: 194  VPVIGGHAGKTIIPLISQCTPKVDFPQDQLATLTGRIQEAGTEVVKAKAGAGSATLSMAY 253

Query: 908  AGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            AGA F  + +  +NG   V+ECSFVQS  TE  +F++ + LGK G+E+ LG+G +T F
Sbjct: 254  AGARFVFSLVDAMNGKEGVIECSFVQSKETECTYFSTPLLLGKKGLEKNLGIGKITPF 311



>pir|S01350|DEMSMM malate dehydrogenase (EC 1.1.1.37) precursor,
            mitochondrial - mouse>gb:BC023482_2094186 Mus musculus
            malate dehydrogenase 2, NAD (mitochondrial), mRNA (cDNA
            clone MGC:31009 IMAGE:5251192), complete
            cds.>gb:BC087199_2565056 Xenopus laevis hypothetical
            LOC495875, mRNA (cDNA clone MGC:98102 IMAGE:7199984),
            complete cds.
          Length = 338

 Score =  341 bits (875), Expect = 2e-92
 Identities = 175/298 (58%), Positives = 218/298 (73%)
 Frame = +2

Query: 188  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT 367
            RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct: 14   RRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET 73

Query: 368  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCP 547
            R+ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA A++CP
Sbjct: 74   RANVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCP 133

Query: 548  HALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXX 727
             A+V +I+NPVNST+PI AEVFKK G Y+  ++FGVTTLD+VRA TF             
Sbjct: 134  EAMVCIIANPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVN 193

Query: 728  XXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAY 907
               IGGHAG TI+PL SQ TP+ +   D +  LT R Q+ GTEVV+AKAG GSATLSMAY
Sbjct: 194  VPVIGGHAGKTIIPLISQCTPKVDFPQDQLATLTGRIQEAGTEVVKAKAGAGSATLSMAY 253

Query: 908  AGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            AGA F  + +  +NG   VVECSFVQS  TE  +F++ + LGK G+E+ LG+G +T F
Sbjct: 254  AGARFVFSLVDAMNGKEGVVECSFVQSKETECTYFSTPLLLGKKGLEKNLGIGKITPF 311



>gb:AY681346_2543731 Xenopus laevis mitochondrial malate dehydrogenase
            2a (Mdh2a) mRNA, complete cds; nuclear gene for
            mitochondrial product.
          Length = 338

 Score =  341 bits (874), Expect = 2e-92
 Identities = 176/309 (56%), Positives = 225/309 (72%), Gaps = 7/309 (2%)
 Frame = +2

Query: 176  SRVAR-------RGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTP 334
            SR+AR       RG ++ +    +V +LGA+GGIGQPLSLL+K +PL+S+L+L+DIA TP
Sbjct: 3    SRIARPAAHGLIRGLSTTAQANARVTVLGASGGIGQPLSLLLKNSPLISNLALYDIAHTP 62

Query: 335  GVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVK 514
            GVAAD+SHI TR++V G+ G E L ++L+ ADVV+IPAGVPRKPGMTRDDLFN NA IV 
Sbjct: 63   GVAADLSHIETRAKVTGYLGAEQLPESLKSADVVVIPAGVPRKPGMTRDDLFNTNASIVA 122

Query: 515  SLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYX 694
            +L+ A AK+CP A++ +ISNPVNST+PI +EVFKK G Y+  R+FGVTTLD+VRA TF  
Sbjct: 123  TLTDACAKHCPEAMICIISNPVNSTIPITSEVFKKHGVYNPNRIFGVTTLDIVRANTFVA 182

Query: 695  XXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKA 874
                          IGGHAG TI+PL SQ+TP+     D +  L  R Q+ GTEVV+AKA
Sbjct: 183  ELKGLDPARVNVPVIGGHAGKTIIPLISQSTPKVEFPQDQLEVLIGRIQEAGTEVVKAKA 242

Query: 875  GKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEV 1054
            G GSATLSMAYAGA F  + L  +NG   V+ECSFV+S  TE P+F++ + LGKNG+E+ 
Sbjct: 243  GAGSATLSMAYAGARFVFSLLDAMNGKEGVIECSFVRSEETESPYFSTPLLLGKNGIEKN 302

Query: 1055 LGLGSLTDF 1081
            LGLG LT +
Sbjct: 303  LGLGKLTAY 311



>sp|P04636|MDHM_RAT Malate dehydrogenase, mitochondrial precursor (EC
            1.1.1.37).>pir|A25509|DERTMM malate dehydrogenase (EC
            1.1.1.37) precursor, mitochondrial -
            rat>gb:RNMDHR_2135229 Rat mRNA for mitochondrial malate
            dehydrogenase (EC 1.1.1.37).
          Length = 338

 Score =  340 bits (873), Expect = 3e-92
 Identities = 173/298 (58%), Positives = 218/298 (73%)
 Frame = +2

Query: 188  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT 367
            RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct: 14   RRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET 73

Query: 368  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCP 547
            R+ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA A++CP
Sbjct: 74   RANVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCP 133

Query: 548  HALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXX 727
             A++ +ISNPVNST+PI AEVFKK G Y+  ++FGVTTLD+VRA TF             
Sbjct: 134  EAMICIISNPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVN 193

Query: 728  XXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAY 907
               IGGHAG TI+PL SQ TP+ +   D +  LT + Q+ GTEVV+AKAG GSATLSMAY
Sbjct: 194  VPVIGGHAGKTIIPLISQCTPKVDFPQDQLATLTGKIQEAGTEVVKAKAGAGSATLSMAY 253

Query: 908  AGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            AGA F  + +  +NG   V+ECSFVQS  TE  +F++ + LGK G+E+ LG+G +T F
Sbjct: 254  AGARFVFSLVDAMNGKEGVIECSFVQSKETECTYFSTPLLLGKKGLEKNLGIGKITPF 311



>gb:BC053272_2550663 Danio rerio zgc:64133, mRNA (cDNA clone MGC:64133
            IMAGE:6796842), complete cds.
          Length = 337

 Score =  340 bits (872), Expect = 4e-92
 Identities = 179/308 (58%), Positives = 220/308 (71%), Gaps = 6/308 (1%)
 Frame = +2

Query: 176  SRVAR------RGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPG 337
            SRVAR      R  ++ S    KVA+LGA+GGIGQPLSLL+K +PLVS LSLFDIA TPG
Sbjct: 3    SRVARPTASLVRSLSTSSQNNAKVAVLGASGGIGQPLSLLLKNSPLVSELSLFDIAHTPG 62

Query: 338  VAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKS 517
            VAAD+SHI TR+ V G+ G + LG AL+G +VV+IPAGVPRKPGMTRDDLFN NA IV +
Sbjct: 63   VAADLSHIETRAHVKGYIGADQLGDALKGCEVVVIPAGVPRKPGMTRDDLFNTNATIVAT 122

Query: 518  LSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXX 697
            L    A++CP A++ +ISNPVNST+PI +EV KK G Y+  ++FGVTTLD+VRA TF   
Sbjct: 123  LVDGCARHCPQAMICIISNPVNSTIPITSEVMKKHGVYNPNKIFGVTTLDIVRANTFVAE 182

Query: 698  XXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAG 877
                         +GGHAGITI+PL SQ TP+     D +  LT R Q+ GTEVV+AKAG
Sbjct: 183  LKGLDPARVNVPVVGGHAGITIIPLISQCTPKVEFPADQLSALTGRIQEAGTEVVKAKAG 242

Query: 878  KGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVL 1057
             GSATLSMAYAGA F  + L  +NG   VVECSFV+S  TE  +F++ + LGKNG+E+ L
Sbjct: 243  AGSATLSMAYAGARFTFSLLDAMNGKEGVVECSFVRSEETECKYFSTPLLLGKNGIEKNL 302

Query: 1058 GLGSLTDF 1081
            GLG L+ F
Sbjct: 303  GLGKLSAF 310



>gb:CR536548_1993841 Homo sapiens full open reading frame cDNA clone
            RZPDo834E0920D for gene MDH2, malate dehydrogenase 2, NAD
            (mitochondrial); complete cds, incl. stopcodon.
          Length = 338

 Score =  339 bits (869), Expect = 9e-92
 Identities = 174/311 (55%), Positives = 222/311 (71%)
 Frame = +2

Query: 149  LLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAG 328
            +L   V   S   RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA 
Sbjct: 1    MLSALVRPVSAALRRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAH 60

Query: 329  TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGI 508
            TPGVAAD+SHI T++ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA I
Sbjct: 61   TPGVAADLSHIETKAAVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATI 120

Query: 509  VKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTF 688
            V +L+AA A++CP A++ +I+NPVNST+PI AEVFKK G Y+  ++FGVTTLD+VRA TF
Sbjct: 121  VATLTAACAQHCPEAMICVIANPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTF 180

Query: 689  YXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEA 868
                            IGGHAG TI+PL SQ TP+ +   D +  LT R Q+ GTEVV+A
Sbjct: 181  VAELKGLDPARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKA 240

Query: 869  KAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVE 1048
            KAG GSATLSMAYAGA F  + +  +NG   VVECSFV+S  TE  +F++ + LGK G+E
Sbjct: 241  KAGAGSATLSMAYAGARFVFSLVDAMNGKEGVVECSFVKSQETECTYFSTPLLLGKKGIE 300

Query: 1049 EVLGLGSLTDF 1081
            + LG+G ++ F
Sbjct: 301  KNLGIGKVSSF 311



>gb:CR925943_1185480 Pongo pygmaeus mRNA; cDNA DKFZp470E0311 (from
            clone DKFZp470E0311).
          Length = 338

 Score =  339 bits (869), Expect = 9e-92
 Identities = 172/302 (56%), Positives = 220/302 (72%)
 Frame = +2

Query: 176  SRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVS 355
            S V RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+S
Sbjct: 10   SAVLRRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLS 69

Query: 356  HINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIA 535
            HI T++ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L++A A
Sbjct: 70   HIETKATVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTSACA 129

Query: 536  KYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXX 715
            ++CP A++ +I+NPVNST+PI AEVFKK G Y+  ++FGVTTLD+VRA TF         
Sbjct: 130  QHCPEAMICVIANPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDP 189

Query: 716  XXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATL 895
                   IGGHAG TI+PL SQ TP+ +   D +  LT R Q+ GTEVV+AKAG GSATL
Sbjct: 190  ARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGSATL 249

Query: 896  SMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLT 1075
            SMAYAGA F  + +  +NG   VVECSFV+S  TE  +F++ + LGK G+E+ LG+G ++
Sbjct: 250  SMAYAGARFVFSLVDAMNGKEGVVECSFVKSQETECTYFSTPLLLGKKGIEKNLGIGKVS 309

Query: 1076 DF 1081
             F
Sbjct: 310  SF 311



>pir|T09294|T09294 malate dehydrogenase (EC 1.1.1.37) precursor -
            alfalfa>gb:AF020273_1761624 Medicago sativa
            nodule-enhanced malate dehydrogenase precursor (nemdh)
            mRNA, complete cds.
          Length = 408

 Score =  339 bits (869), Expect = 9e-92
 Identities = 176/313 (56%), Positives = 220/313 (70%), Gaps = 2/313 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN 403
            KVA+LGAAGGIGQPL+LL+K++PLVS L L+DIA   GVAAD+SH NT S+V+ F+G   
Sbjct: 91   KVAVLGAAGGIGQPLALLIKMSPLVSDLHLYDIANVKGVAADISHCNTPSKVLDFTGASE 150

Query: 404  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN 583
            L   L+G DVV+IPAGVPRKPGMTRDDLFNINAGIV+ L  A+A  CP+A +++ISNPVN
Sbjct: 151  LANCLKGVDVVVIPAGVPRKPGMTRDDLFNINAGIVRDLVTAVADNCPNAFIHIISNPVN 210

Query: 584  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITI 763
            STVPIAAE+ K+ G YD K+LFGV+TLDVVRA TF                +GGHAGITI
Sbjct: 211  STVPIAAEILKQKGVYDPKKLFGVSTLDVVRANTFVAQKKNLRLIDVDVPVVGGHAGITI 270

Query: 764  LPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKG 943
            LPL S+  P  +   + I  LT R Q+ GTEVVEAKAG GSATLSMAYA A F ++ L+ 
Sbjct: 271  LPLLSKTKPSVSFTDEEIEELTVRIQNAGTEVVEAKAGAGSATLSMAYAAARFVESSLRA 330

Query: 944  LNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVL--GLGSLTDFXXXXXXXXXXXX 1117
            L+G  DV ECSFVQS +T+LPFFAS+V++G+ GVE ++   L  L+++            
Sbjct: 331  LDGDADVYECSFVQSDLTDLPFFASRVKIGRKGVEALIPTDLQGLSEYEQKALEALKPEL 390

Query: 1118 XXXXXXGIQFANQ 1156
                  G+ FA +
Sbjct: 391  KASIEKGVAFAQK 403



>sp|P40926|MDHM_HUMAN Malate dehydrogenase, mitochondrial precursor
            (EC 1.1.1.37).>gb:AF047470_1879008 Homo sapiens malate
            dehydrogenase precursor (MDH) mRNA, nuclear gene encoding
            mitochondrial protein, complete cds.>gb:BC001917_1967959
            Homo sapiens malate dehydrogenase 2, NAD (mitochondrial),
            mRNA (cDNA clone MGC:3559 IMAGE:2823443), complete cds.
          Length = 338

 Score =  338 bits (868), Expect = 1e-91
 Identities = 172/302 (56%), Positives = 219/302 (72%)
 Frame = +2

Query: 176  SRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVS 355
            S   RR F++ +    KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+S
Sbjct: 10   SAALRRSFSTSAQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLS 69

Query: 356  HINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIA 535
            HI T++ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA A
Sbjct: 70   HIETKAAVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACA 129

Query: 536  KYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXX 715
            ++CP A++ +I+NPVNST+PI AEVFKK G Y+  ++FGVTTLD+VRA TF         
Sbjct: 130  QHCPEAMICVIANPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDP 189

Query: 716  XXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATL 895
                   IGGHAG TI+PL SQ TP+ +   D +  LT R Q+ GTEVV+AKAG GSATL
Sbjct: 190  ARVNVPVIGGHAGKTIIPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGSATL 249

Query: 896  SMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLT 1075
            SMAYAGA F  + +  +NG   VVECSFV+S  TE  +F++ + LGK G+E+ LG+G ++
Sbjct: 250  SMAYAGARFVFSLVDAMNGKEGVVECSFVKSQETECTYFSTPLLLGKKGIEKNLGIGKVS 309

Query: 1076 DF 1081
             F
Sbjct: 310  SF 311



>sp|P00346|MDHM_PIG Malate dehydrogenase, mitochondrial precursor (EC
            1.1.1.37).
          Length = 338

 Score =  338 bits (867), Expect = 2e-91
 Identities = 172/298 (57%), Positives = 217/298 (72%)
 Frame = +2

Query: 188  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT 367
            RR F++      KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T
Sbjct: 14   RRSFSTSXQNNAKVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIET 73

Query: 368  RSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCP 547
            R+ V G+ G E L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA A++CP
Sbjct: 74   RATVKGYLGPEQLPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCP 133

Query: 548  HALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXX 727
             A++ +ISNPVNST+PI AEVFKK G Y+  ++FGVTTLD+VRA  F             
Sbjct: 134  DAMICIISNPVNSTIPITAEVFKKHGVYNPNKIFGVTTLDIVRANAFVAELKGLDPARVS 193

Query: 728  XXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAY 907
               IGGHAG TI+PL SQ TP+ +   D +  LT R Q+ GTEVV+AKAG GSATLSMAY
Sbjct: 194  VPVIGGHAGKTIIPLISQCTPKVDFPQDQLSTLTGRIQEAGTEVVKAKAGAGSATLSMAY 253

Query: 908  AGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            AGA F  + +  +NG   VVECSFV+S  T+ P+F++ + LGK G+E+ LG+G ++ F
Sbjct: 254  AGARFVFSLVDAMNGKEGVVECSFVKSQETDCPYFSTPLLLGKKGIEKNLGIGKISPF 311



>pir|T06386|T06386 probable malate dehydrogenase (EC 1.1.1.37) -
            garden pea>gb:AF079850_1766410 Pisum sativum
            nodule-enhanced malate dehydrogenase (nemdh) mRNA,
            complete cds.
          Length = 398

 Score =  337 bits (863), Expect = 5e-91
 Identities = 176/313 (56%), Positives = 219/313 (69%), Gaps = 2/313 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN 403
            KVA+LGAAGGIGQPL+LL+K++PLVS L L+DIA   GVAAD+SH NT S+V  F+G   
Sbjct: 81   KVALLGAAGGIGQPLALLIKMSPLVSDLHLYDIANVKGVAADISHCNTPSKVADFTGAAE 140

Query: 404  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN 583
            L   L+G DVV+IPAGVPRKPGMTRDDLFNINAGIV+ L +A+A  CP A +++ISNPVN
Sbjct: 141  LANCLKGVDVVVIPAGVPRKPGMTRDDLFNINAGIVRDLVSAVADNCPGAFIHIISNPVN 200

Query: 584  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITI 763
            STVPIAAE+ K+ G YD K+LFGV+TLDVVRA TF                +GGHAGITI
Sbjct: 201  STVPIAAEILKQKGVYDPKKLFGVSTLDVVRANTFVAQRKNLRLIDVDVPVVGGHAGITI 260

Query: 764  LPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKG 943
            LPL S+  P A+   + I  LT R Q+ GTEVVEAKAG GSATLSMAYA A F ++ L+ 
Sbjct: 261  LPLLSKTKPSASFTDEEIEELTVRIQNAGTEVVEAKAGAGSATLSMAYAAARFVESSLRA 320

Query: 944  LNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVL--GLGSLTDFXXXXXXXXXXXX 1117
            L+G  DV ECS+VQS +T+LPFFAS+V++G+ GVE  +   L  L+++            
Sbjct: 321  LDGDADVYECSYVQSDLTDLPFFASRVKIGRKGVEAFIPTDLQGLSEYEQKALEALKPEL 380

Query: 1118 XXXXXXGIQFANQ 1156
                  G+ FA +
Sbjct: 381  KASIEKGVAFAQK 393



>gb:AF390561_2491269 Sphyraena idiastes malate dehydrogenase (mMDH)
            mRNA, complete cds; nuclear gene for mitochondrial
            product.
          Length = 337

 Score =  336 bits (861), Expect = 8e-91
 Identities = 173/297 (58%), Positives = 215/297 (72%)
 Frame = +2

Query: 191  RGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTR 370
            R  ++ S    KVA+LGA+GGIGQPLSLL+K +PLVSHLSL+DIA TPGVAAD+SHI TR
Sbjct: 14   RTLSTSSQNNAKVAVLGASGGIGQPLSLLLKNSPLVSHLSLYDIAHTPGVAADLSHIETR 73

Query: 371  SEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPH 550
            ++V G  G + L  AL+G +VV+IPAGVPRKPGMTRDDLFN NA IV +L+ A A+ CP 
Sbjct: 74   AQVTGHMGPDQLDAALQGCEVVVIPAGVPRKPGMTRDDLFNTNATIVATLADACARNCPE 133

Query: 551  ALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXX 730
            A++ +I+NPVNST+PI +EV KK G Y+  +LFGVTTLD+VRA TF              
Sbjct: 134  AMICIIANPVNSTIPITSEVMKKRGVYNPNKLFGVTTLDIVRANTFVAELKGLDPARVSV 193

Query: 731  XXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYA 910
              IGGHAG TI+PL SQ TP+     D +  LT R Q+ GTEVV+AKAG GSATLSMAYA
Sbjct: 194  PVIGGHAGKTIIPLISQCTPKVEFPADQLSALTGRIQEAGTEVVKAKAGAGSATLSMAYA 253

Query: 911  GAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            GA F  + L  +NG   VVEC++V+S  TE  +F++ + LGKNG+E+ LGLG LT F
Sbjct: 254  GARFTFSVLDAMNGKEGVVECAYVRSEETESKYFSTPLLLGKNGIEKNLGLGKLTAF 310



>pir|T06325|T06325 malate dehydrogenase (EC 1.1.1.37), nodule-enhanced
            - soybean>gb:AF068686_1765645 Glycine max geranylgeranyl
            hydrogenase (Ggh) and nodule-enhanced malate
            dehydrogenase (Mdh) genes, complete cds.
          Length = 413

 Score =  335 bits (860), Expect = 1e-90
 Identities = 187/360 (51%), Positives = 234/360 (65%), Gaps = 9/360 (2%)
 Frame = +2

Query: 104  LRSLEIEMRSSML-----RSLLKNSVSDGSRVARRGFASGSAPER--KVAILGAAGGIGQ 262
            + S+  E  SS L      +L  +  S   +   + F   S P+   KVA+LGAAGGIGQ
Sbjct: 49   MSSVRCESESSFLVNKTGAALRASFASKAQKENDQNFNYNSQPQASYKVAVLGAAGGIGQ 108

Query: 263  PLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVII 442
            PL+LL+K++PL+S L L+DIA   GVAAD+SH NT S+V  F+G   L   L+  +VV+I
Sbjct: 109  PLALLIKMSPLISDLHLYDIANVKGVAADISHCNTPSQVRDFTGASELANCLKSVNVVVI 168

Query: 443  PAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKA 622
            PAGVPRKPGMTRDDLFNINAGIV+ L +A+A   P A + +ISNPVNSTVPIAAEV K+ 
Sbjct: 169  PAGVPRKPGMTRDDLFNINAGIVRDLVSAVADNSPDAFIQIISNPVNSTVPIAAEVLKQK 228

Query: 623  GTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANL 802
            G YD K+LFGVTTLDVVRA TF                +GGHAGITILPL S+  P A+ 
Sbjct: 229  GVYDPKKLFGVTTLDVVRANTFVAQRKNLKLIDVDVPVVGGHAGITILPLLSKTKPSASF 288

Query: 803  AHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFV 982
              + I  LT R Q+ GTEVVEAKAG GSATLSMAYA A F ++ L+ L+G  DV ECS+V
Sbjct: 289  TDEEIEELTVRIQNAGTEVVEAKAGAGSATLSMAYAAARFVESSLRALDGDGDVYECSYV 348

Query: 983  QSTVTELPFFASKVRLGKNGVEEVL--GLGSLTDFXXXXXXXXXXXXXXXXXXGIQFANQ 1156
            +S +T+LPFFAS+V+LG+ GVE ++   L  LTD+                  GI FA +
Sbjct: 349  ESDLTDLPFFASRVKLGRKGVEALIPSDLQGLTDYEQKALESLKPELMASIEKGIAFAQK 408



>pir|A00355|DEPGMM malate dehydrogenase (EC 1.1.1.37), mitochondrial -
            pig
          Length = 314

 Score =  333 bits (853), Expect = 7e-90
 Identities = 169/286 (59%), Positives = 212/286 (74%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN 403
            KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI TR+ V G+ G E 
Sbjct: 2    KVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIETRATVKGYLGPEQ 61

Query: 404  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN 583
            L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA A++CP A++ +ISNPVN
Sbjct: 62   LPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCPDAMICIISNPVN 121

Query: 584  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITI 763
            ST+PI AEVFKK G Y+  ++FGVTTLD+VRA  F                IGGHAG TI
Sbjct: 122  STIPITAEVFKKHGVYNPNKIFGVTTLDIVRANAFVAELKGLDPARVSVPVIGGHAGKTI 181

Query: 764  LPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKG 943
            +PL SQ TP+ +   D +  LT R Q+ GTEVV+AKAG GSATLSMAYAGA F  + +  
Sbjct: 182  IPLISQCTPKVDFPQDQLSTLTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFVFSLVDA 241

Query: 944  LNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            +NG   VVECSFV+S  T+ P+F++ + LGK G+E+ LG+G ++ F
Sbjct: 242  MNGKEGVVECSFVKSQETDCPYFSTPLLLGKKGIEKNLGIGKISPF 287



>gb:AC005077_1874824 Homo sapiens BAC clone CTA-228D17 from 7,
            complete sequence.
          Length = 316

 Score =  332 bits (851), Expect = 1e-89
 Identities = 168/286 (58%), Positives = 212/286 (74%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN 403
            KVA+LGA+GGIGQPLSLL+K +PLVS L+L+DIA TPGVAAD+SHI T++ V G+ G E 
Sbjct: 4    KVAVLGASGGIGQPLSLLLKNSPLVSRLTLYDIAHTPGVAADLSHIETKAAVKGYLGPEQ 63

Query: 404  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN 583
            L   L+G DVV+IPAGVPRKPGMTRDDLFN NA IV +L+AA A++CP A++ +I+NPVN
Sbjct: 64   LPDCLKGCDVVVIPAGVPRKPGMTRDDLFNTNATIVATLTAACAQHCPEAMICVIANPVN 123

Query: 584  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITI 763
            ST+PI AEVFKK G Y+  ++FGVTTLD+VRA TF                IGGHAG TI
Sbjct: 124  STIPITAEVFKKHGVYNPNKIFGVTTLDIVRANTFVAELKGLDPARVNVPVIGGHAGKTI 183

Query: 764  LPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKG 943
            +PL SQ TP+ +   D +  LT R Q+ GTEVV+AKAG GSATLSMAYAGA F  + +  
Sbjct: 184  IPLISQCTPKVDFPQDQLTALTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFVFSLVDA 243

Query: 944  LNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            +NG   VVECSFV+S  TE  +F++ + LGK G+E+ LG+G ++ F
Sbjct: 244  MNGKEGVVECSFVKSQETECTYFSTPLLLGKKGIEKNLGIGKVSSF 289



>pir|T08177|T08177 malate dehydrogenase (EC 1.1.1.37), sodium
            acetate-induced - Chlamydomonas
            reinhardtii>gb:CRU40465_1673690 Chlamydomonas reinhardtii
            NAD-dependent malate dehydrogenase (MDH2) mRNA, complete
            cds.>gb:CRU42979_1673696 Chlamydomonas reinhardtii
            NAD-dependent malate dehydrogenase (MDH2) gene, nuclear
            gene encoding mitochondrial protein, complete cds.
          Length = 355

 Score =  332 bits (851), Expect = 1e-89
 Identities = 181/325 (55%), Positives = 222/325 (68%), Gaps = 14/325 (4%)
 Frame = +2

Query: 149  LLKNSVSDGSRVARRGFASGSAP-------------ERKVAILGAAGGIGQPLSLLMKLN 289
            LL N V+ G+  ARR     +AP              RKVA+LGAAGGIGQPL+LL+K+N
Sbjct: 2    LLANRVNAGA--ARRVSGRAAAPIAVRAGRRSLVCEARKVALLGAAGGIGQPLALLLKMN 59

Query: 290  PLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPG 469
              V+ L+L+DIA   GVAAD+SH NT  +V G++G E LG  L+GAD+++IPAGVPRKPG
Sbjct: 60   KFVTELALYDIANVVGVAADLSHCNTPVKVTGYTGPEELGACLKGADLIVIPAGVPRKPG 119

Query: 470  MTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLF 649
            MTRDDLFN NAGIVK+L  A+AK+ P+A++ +I+NPVNSTVPIA E  K AG YD K++ 
Sbjct: 120  MTRDDLFNTNAGIVKALVEAVAKHAPNAVLEIITNPVNSTVPIAVETLKLAGVYDPKKVI 179

Query: 650  GVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLT 829
            GVT+LD+VRA TF                IGGHAG TILPL SQ TP           +T
Sbjct: 180  GVTSLDIVRANTFVSEAKGLDMKDVDVPVIGGHAGSTILPLLSQTTPPVTFTEAEKKAMT 239

Query: 830  KRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQS-TVTELP 1006
             +  + GT VVEAKAGKGSATLSMAYA A  A++ L GLNG P++ EC+FVQS  V + P
Sbjct: 240  DKIANAGTVVVEAKAGKGSATLSMAYAAARMAESTLLGLNGEPNIYECAFVQSDVVADCP 299

Query: 1007 FFASKVRLGKNGVEEVLGLGSLTDF 1081
            FFASKV LG NGV +V+GLG L  F
Sbjct: 300  FFASKVLLGPNGVAKVMGLGELDAF 324



>gb:AP004260_1839305 Oryza sativa (japonica cultivar-group) genomic
            DNA, chromosome 7, PAC clone:P0011H09.
          Length = 404

 Score =  330 bits (847), Expect = 3e-89
 Identities = 181/318 (56%), Positives = 217/318 (68%), Gaps = 7/318 (2%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN 403
            KVAILGAAGGIGQPLSLL+K++PLVS L L+DIA   GV AD+ H NT ++V GF+G E 
Sbjct: 79   KVAILGAAGGIGQPLSLLVKMSPLVSALHLYDIANVDGVTADLGHCNTPAKVAGFTGKEE 138

Query: 404  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN 583
            L   L G DVV+IPAGVPRKPGMTRDDLF INAGIV+ L  A+A + P ALV++ISNPVN
Sbjct: 139  LAGCLAGVDVVVIPAGVPRKPGMTRDDLFGINAGIVRELVEAVADHAPAALVHVISNPVN 198

Query: 584  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITI 763
            STVPIAAEV K+ G YD ++LFGVTTLDVVRA TF                +GGHA  TI
Sbjct: 199  STVPIAAEVLKRKGVYDPRKLFGVTTLDVVRANTFVAEMKGLPLADVDVPVVGGHAAATI 258

Query: 764  LPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVE--AKAGKGSATLSMAYAGAIFADACL 937
            LPL S+A P+     + +  LT+R Q+ GTEVVE  AKAG GSATLSMAYA A F +A L
Sbjct: 259  LPLLSKARPKTAFTDEEVEALTRRIQNAGTEVVEAKAKAGGGSATLSMAYAAARFLEASL 318

Query: 938  KGLNGVPDVVECSFVQ-STVTELPFFASKVRLGKNGVEEVLGLGS----LTDFXXXXXXX 1102
            +GL+G  DV ECS+VQ   V ELPFFA +V+LG++GVEEV   G+    LT+F       
Sbjct: 319  RGLDGDADVYECSYVQCQAVPELPFFACRVKLGRDGVEEVAAAGAELRGLTEFEARALEA 378

Query: 1103 XXXXXXXXXXXGIQFANQ 1156
                       G+ +A Q
Sbjct: 379  LKPQLKKSIDKGVAYAQQ 396



>gb:AJ621238_1283340 Echinococcus granulosus mRNA for malate
            dehydrogenase (mdhm gene).
          Length = 338

 Score =  327 bits (839), Expect = 3e-88
 Identities = 167/295 (56%), Positives = 210/295 (71%)
 Frame = +2

Query: 197  FASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSE 376
            F++ +   +K+AILGA+GGIGQPL+LLMK +  VS ++L+DIA   GVAAD+SHI TR++
Sbjct: 18   FSTSTQNPQKIAILGASGGIGQPLALLMKQSLFVSEIALYDIANAAGVAADLSHIETRAK 77

Query: 377  VVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHAL 556
            V G +G +NL  AL+GA VVIIPAGVPRKPGMTRDDLF++NA +V  LS A  KYC  A+
Sbjct: 78   VTGHTGPDNLKAALDGAKVVIIPAGVPRKPGMTRDDLFSMNASVVADLSRACGKYCSDAM 137

Query: 557  VNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXX 736
            + +I+NPVNSTVPIAAE+ KK G Y+ +RLFGVTTLD+ R+ TF                
Sbjct: 138  ICIITNPVNSTVPIAAEILKKEGLYNPRRLFGVTTLDITRSNTFIAEAKGLDVSKVSCPV 197

Query: 737  IGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGA 916
            IGGH+G TI+P+ SQ TP  N A      L  R Q+ GTEVV AKAG GSATLSMAYAGA
Sbjct: 198  IGGHSGNTIVPVLSQCTPSVNFAQKAREELVARIQNAGTEVVNAKAGAGSATLSMAYAGA 257

Query: 917  IFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            +FA++ L  + G  D+VEC+FV+  V E  FFAS V LG NGVE+V G G L ++
Sbjct: 258  LFANSLLHAMKGHADIVECAFVECDVAETEFFASPVLLGPNGVEKVFGAGKLNEY 312



>gb:AF280052_1258555 Nucella lapillus mitochondrial malate
            dehydrogenase precursor (Mdh) mRNA, mMDH-9 allele,
            complete cds; nuclear gene for mitochondrial product.
          Length = 342

 Score =  326 bits (835), Expect = 8e-88
 Identities = 165/287 (57%), Positives = 211/287 (73%)
 Frame = +2

Query: 218  ERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGD 397
            E +VA+LGAAGGIGQPLSLL+K  P+VSHL+L+DIA   GVA+D+SHI +R++V GF G 
Sbjct: 28   EARVAVLGAAGGIGQPLSLLLKQMPIVSHLNLYDIAHVMGVASDLSHIESRAKVQGFLGP 87

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +NL   L+GAD+V+IPAGVPRKPGMTRDDLFN NA IV+ L+AA+A+ CP A++ +I+NP
Sbjct: 88   DNLRPCLDGADIVLIPAGVPRKPGMTRDDLFNTNAAIVRDLTAAVAESCPKAMLGIITNP 147

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VNST PIA+EV KK G YD +R FGVTTLDVVR+ TF                IGGH+GI
Sbjct: 148  VNSTAPIASEVLKKHGVYDPRRAFGVTTLDVVRSNTFIAEAKGLDVSKTNVPVIGGHSGI 207

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TI+PL SQ TP  +   +  V L+ R Q+ GTEVV+AKAG GSATLSMA+A A F  + +
Sbjct: 208  TIIPLISQCTPPVSFPPEERVKLSMRIQNAGTEVVDAKAGAGSATLSMAFAAAEFCKSLI 267

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTD 1078
            + LNG    V+C++V+S  TE  +FA+ V LGK G+E+ LG+G L D
Sbjct: 268  EALNGQEGKVQCAYVRSEETEAKYFATPVLLGKEGIEKNLGMGKLLD 314



>sp|O02640|MDHM_CAEEL Probable malate dehydrogenase, mitochondrial
            precursor (EC 1.1.1.37).>pir|C88486|C88486 protein
            F20H11.3 [imported] - Caenorhabditis
            elegans>gb:AF002197_1230688 Caenorhabditis elegans cosmid
            F20H11, complete sequence.
          Length = 341

 Score =  323 bits (828), Expect = 5e-87
 Identities = 171/320 (53%), Positives = 220/320 (68%), Gaps = 1/320 (0%)
 Frame = +2

Query: 203  SGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVV 382
            S  AP  KVA+LGAAGGIGQPL LL+K +PLV+HL+L+D+  TPGVAAD+SHI++ ++V 
Sbjct: 25   SSQAP--KVALLGAAGGIGQPLGLLLKQDPLVAHLALYDVVNTPGVAADLSHIDSNAKVT 82

Query: 383  GFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVN 562
              +G + L  A+E ADV++IPAGVPRKPGMTRDDLFN NAGIV+ L+A IAK  P AL+ 
Sbjct: 83   AHTGPKELYAAVENADVIVIPAGVPRKPGMTRDDLFNTNAGIVRDLAAVIAKASPKALIA 142

Query: 563  MISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIG 742
            +I+NPVNSTVPIA+EV KKAG YD KR+FGVTTLDVVR++ F                +G
Sbjct: 143  IITNPVNSTVPIASEVLKKAGVYDPKRVFGVTTLDVVRSQAFVSELKGHDASKTVVPVVG 202

Query: 743  GHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIF 922
            GHAGITI+PL SQ  P    + + I  LT R QD GTEVV AKAG GSATLSMA AGA F
Sbjct: 203  GHAGITIIPLLSQVKPSTKFSEEEISKLTPRIQDAGTEVVNAKAGAGSATLSMALAGARF 262

Query: 923  ADACLKGLNGVPDVVECSFVQS-TVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXX 1099
            A+A ++G+ G  + V+C++V S  V  + +F++ V LG NGVE++LG+G ++ +      
Sbjct: 263  ANALVRGIKGEKN-VQCAYVASDAVKGVEYFSTPVELGPNGVEKILGVGKVSAYEQKLID 321

Query: 1100 XXXXXXXXXXXXGIQFANQN 1159
                        G+ F   N
Sbjct: 322  ASVPELNKNIAKGVAFVKGN 341



>pir|T08015|T08015 probable malate dehydrogenase (EC 1.1.1.37)
            precursor, glyoxysomal - rape>gb:BNGMDH_1633549 B.napus
            mRNA for glyoxysomal malate dehydrogenase.
          Length = 351

 Score =  322 bits (826), Expect = 9e-87
 Identities = 176/294 (59%), Positives = 207/294 (70%)
 Frame = +2

Query: 200  ASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEV 379
            A G  P  KVAILGAAGGIGQ LSLLMK+NPL S L L+D+   PGV ADVSH++T + V
Sbjct: 35   AKGGNPGFKVAILGAAGGIGQSLSLLMKVNPLGSLLHLYDVVNAPGVTADVSHMDTGAVV 94

Query: 380  VGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALV 559
             GF G + L  AL G D+VIIPAGVPRKPGMTRDDLF INAGIV++L   +   CP+A+V
Sbjct: 95   RGFLGAKQLEDALTGMDLVIIPAGVPRKPGMTRDDLFKINAGIVRTLCEGVGGCCPNAIV 154

Query: 560  NMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXI 739
            N+ISNPVNSTV IAAEVFKKAGTYD K+L GVTTLDV RA TF                +
Sbjct: 155  NLISNPVNSTVAIAAEVFKKAGTYDPKKLLGVTTLDVARANTFVAEVLGLDPREVDVPVV 214

Query: 740  GGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAI 919
            GGHAG+TILPL SQ TP ++     I  LT + Q GGT+VVEA AG GS+ L +  A A 
Sbjct: 215  GGHAGVTILPLSSQVTPPSSFTPSEIEYLTNKIQHGGTDVVEAHAGVGSSPLPIILA-AP 273

Query: 920  FADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            FADACL+GL G  +V+ECSFV S VT+  F  +KVRLG+ G EEV  LG L ++
Sbjct: 274  FADACLRGLRGDANVIECSFVASQVTDY-FLCTKVRLGRTGAEEVFQLGPLNEY 326



>gb:AE017347_1757992 Cryptococcus neoformans var. neoformans JEC21
            chromosome 7, complete sequence.
          Length = 338

 Score =  322 bits (825), Expect = 1e-86
 Identities = 170/312 (54%), Positives = 216/312 (69%), Gaps = 3/312 (0%)
 Frame = +2

Query: 149  LLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAG 328
            +    V+  S    RGFAS +   RKVA+LGAAGGIGQP+SLL+K NP V+ LSL+DI G
Sbjct: 1    MFARQVAKNSSSLARGFASSARSNRKVAVLGAAGGIGQPMSLLLKQNPGVTGLSLYDIRG 60

Query: 329  TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGI 508
             PGVAAD+SH+NT S V GF  D+ + +AL GA++VIIPAGVPRKPGMTRDDLFN NA I
Sbjct: 61   APGVAADISHVNTHSTVKGFEKDD-IKEALTGAEIVIIPAGVPRKPGMTRDDLFNTNASI 119

Query: 509  VKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTF 688
            V+ L+ A A+YCP A + +ISNPVNSTVPI AEV KK G +DEKR+FG+TTLDVVRA  F
Sbjct: 120  VRDLAEACAEYCPKAFIGIISNPVNSTVPIFAEVLKKKGVFDEKRVFGITTLDVVRASRF 179

Query: 689  YXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEA 868
                            +GGH+G+TI+PL SQ     +++ +    L  R Q GG EVV+A
Sbjct: 180  LGEIKGKDPKDIKVTVVGGHSGVTIVPLLSQTPEGKDVSGEAYKALVNRIQFGGDEVVKA 239

Query: 869  KAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTE---LPFFASKVRLGKN 1039
            KAG GSATLSM YAGA F D+ ++ LNG   +VE +FV+S + E   + +FAS V LG  
Sbjct: 240  KAGTGSATLSMGYAGARFTDSLIRALNGETGIVEPTFVKSPLYESEGVEYFASNVELGPE 299

Query: 1040 GVEEVLGLGSLT 1075
            GV+++  +G L+
Sbjct: 300  GVKKINPVGQLS 311



>gb:PSP16748_1702276 Piromyces sp. E2 mRNA for malate dehydrogenase.
          Length = 316

 Score =  320 bits (820), Expect = 5e-86
 Identities = 169/314 (53%), Positives = 211/314 (67%), Gaps = 3/314 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN 403
            KVA+LGAAGGIGQPLSLL+K +P V+ L+L+DI  +PGVAAD+SHI T+++V G+ G EN
Sbjct: 3    KVAVLGAAGGIGQPLSLLLKSHPQVTELNLYDIVNSPGVAADLSHICTKAKVTGYKGQEN 62

Query: 404  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN 583
            L  AL G D+V+IPAG+PRKPGMTRDDLFNINAGIVK L+  IAK CP A V +ISNPVN
Sbjct: 63   LDAALAGCDIVVIPAGIPRKPGMTRDDLFNINAGIVKGLAEGIAKNCPKAFVCIISNPVN 122

Query: 584  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITI 763
            STVPI AEVFKKAGTYD KRLFGVT LD+VR+ TF                IGGH+G+TI
Sbjct: 123  STVPICAEVFKKAGTYDPKRLFGVTLLDMVRSSTFVSECKGTSPADTKVTVIGGHSGVTI 182

Query: 764  LPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKG 943
            +PL SQ         + +  LT R Q GG EVV+AK G GSATLSMAYA A F D+ ++G
Sbjct: 183  VPLLSQ-VKGLTFTQEEVEALTHRIQFGGDEVVKAKDGAGSATLSMAYAAARFVDSLIEG 241

Query: 944  LNGVPDVVECSFVQSTVT---ELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXX 1114
                  V+EC++V+S +       FFAS + LG +G E++L +G L+++           
Sbjct: 242  AFMKKPVIECAYVESPLAVDDGCSFFASAIELGPSGAEKILPIGPLSEYEQGLYKACVEQ 301

Query: 1115 XXXXXXXGIQFANQ 1156
                   G+ F NQ
Sbjct: 302  LKANIAKGVNFVNQ 315



>gb:CR382130_1662991 Yarrowia lipolytica chromosome D of strain CLIB99
            of Yarrowia lipolytica.
          Length = 338

 Score =  308 bits (788), Expect = 2e-82
 Identities = 167/327 (51%), Positives = 216/327 (66%), Gaps = 4/327 (1%)
 Frame = +2

Query: 191  RGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTR 370
            R F++ +A + KV +LGA GGIGQPLSLL+KLN  V+ L L+D+ G PGVAADVSHI T 
Sbjct: 12   RSFSTSAARQHKVVVLGANGGIGQPLSLLLKLNKNVTDLGLYDLRGAPGVAADVSHIPTN 71

Query: 371  SEVVGFSGDEN-LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCP 547
            S V G+S D N + +AL+GA +V+IPAGVPRKPGMTRDDLFN NA IV+ L+ A+ ++ P
Sbjct: 72   STVAGYSPDNNGIAEALKGAKLVLIPAGVPRKPGMTRDDLFNTNASIVRDLAKAVGEHAP 131

Query: 548  HALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXX 727
             A V +I+NPVNSTVPI AEV K  G YD K+LFGVTTLDV+RA+ F             
Sbjct: 132  DAFVGVIANPVNSTVPIVAEVLKSKGKYDPKKLFGVTTLDVIRAERFVSQLEHTNPTKEY 191

Query: 728  XXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAY 907
               +GGH+G+TI+PL SQ +   ++A +    L  R Q GG EVV+AK G GSATLSMA 
Sbjct: 192  FPVVGGHSGVTIVPLVSQ-SDHPDIAGEARDKLVHRIQFGGDEVVKAKDGAGSATLSMAQ 250

Query: 908  AGAIFADACLKGLNGVPDVVECSFVQSTVTE---LPFFASKVRLGKNGVEEVLGLGSLTD 1078
            A A FAD+ L+G+NG  DVVE +FV S + +   + FF++KV LG NGVEE+  +G + +
Sbjct: 251  AAARFADSLLRGVNGEKDVVEPTFVDSPLFKGEGIDFFSTKVTLGPNGVEEIHPIGKVNE 310

Query: 1079 FXXXXXXXXXXXXXXXXXXGIQFANQN 1159
            +                  G+ F  QN
Sbjct: 311  YEEKLIEAAKADLKKNIEKGVNFVKQN 337



>gb:CR382134_1667079 Debaryomyces hansenii chromosome B of strain
            CBS767 of Debaryomyces hansenii.
          Length = 332

 Score =  306 bits (785), Expect = 5e-82
 Identities = 175/331 (52%), Positives = 213/331 (64%), Gaps = 3/331 (0%)
 Frame = +2

Query: 176  SRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVS 355
            ++VA R F+S ++   KVA+LGA GGIGQPLSLL+KLN  V+ L+L+D+ G PGVAADVS
Sbjct: 3    TKVAARSFSSSASSAYKVAVLGANGGIGQPLSLLLKLNHKVTDLALYDLKGAPGVAADVS 62

Query: 356  HINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIA 535
            HI T S V G+   E L +AL G+D+++IPAGVPRKPGMTRDDLFN NA IV+ L+ A A
Sbjct: 63   HIPTNSTVSGYD-PEGLEQALTGSDIIVIPAGVPRKPGMTRDDLFNTNASIVRDLAKAAA 121

Query: 536  KYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXX 715
             Y P A V +ISNPVNSTVPI AEV K  GTY+ K+LFGVTTLDV+RA  F         
Sbjct: 122  DYAPDAAVCVISNPVNSTVPIVAEVLKSKGTYNPKKLFGVTTLDVLRASRFVSEVAGSNP 181

Query: 716  XXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATL 895
                   +GGH+GITI+PL SQ T   +L  +    L  R Q GG EVV+AK G GSATL
Sbjct: 182  VHEKVTVVGGHSGITIVPLLSQ-TEHKSLDQETRDALIHRIQFGGDEVVQAKNGAGSATL 240

Query: 896  SMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTE---LPFFASKVRLGKNGVEEVLGLG 1066
            SMA AGA F  A L GL G  D+VE SFV S + +   + FF+SKV LG++GV  V  LG
Sbjct: 241  SMAQAGARFTGAVLDGLAGERDIVEPSFVDSPLFKSEGVEFFSSKVTLGQDGVSTVHPLG 300

Query: 1067 SLTDFXXXXXXXXXXXXXXXXXXGIQFANQN 1159
             L+D                   G+ F  QN
Sbjct: 301  GLSDHEESLVKEAKDTLIKNIQKGVDFVKQN 331



>gb:AF084828_1767075 Malassezia furfur major allergenic protein Mal f4
            (Mal f4) gene, complete cds.
          Length = 342

 Score =  305 bits (780), Expect = 2e-81
 Identities = 173/317 (54%), Positives = 216/317 (68%), Gaps = 6/317 (1%)
 Frame = +2

Query: 143  RSLLKNSVSDGSRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDI 322
            R+ L+NSV   +  + R F+  +A  RKVA+LGA+GGIGQPLSLLMKLNP V+ L L+DI
Sbjct: 4    RAALRNSVR--APASARYFSQTAAANRKVAVLGASGGIGQPLSLLMKLNPKVTELRLYDI 61

Query: 323  AGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINA 502
               PGVAAD+SHINT +   G++ D+  G A++GA++V+IPAG+PRKPGMTRDDLFN NA
Sbjct: 62   RLAPGVAADLSHINTPAVTSGYAQDDLEG-AVDGAEIVLIPAGMPRKPGMTRDDLFNSNA 120

Query: 503  GIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAK 682
             IV+ L+  +AK  P A + +ISNPVNSTVPI AEVFKKAG YD KRLFGVTTLD  RA 
Sbjct: 121  SIVRDLAKVVAKVAPKAYIGVISNPVNSTVPIVAEVFKKAGVYDPKRLFGVTTLDTTRAA 180

Query: 683  TFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATP----QANLAHDVIVGLTKRTQDGG 850
            TF                IGGH+G+TI+PL SQA      QA   +D +V    R Q GG
Sbjct: 181  TFLSGIAGSDPQTTNVPVIGGHSGVTIVPLISQAAQGDKVQAGEQYDKLV---HRIQFGG 237

Query: 851  TEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTV--TELPFFASKV 1024
             EVV+AK G GSATLSMAYA A+F +  LKGL+G   V +C+FV+S +   ++ FFAS V
Sbjct: 238  DEVVKAKDGAGSATLSMAYAAAVFTEGLLKGLDG-EAVTQCTFVESPLFKDQVDFFASPV 296

Query: 1025 RLGKNGVEEVLGLGSLT 1075
              G  GV+ +  L  LT
Sbjct: 297  EFGPEGVKNIPALPKLT 313



>gb:AY826858_1629164 Isochrysis galbana clone ISMD1 malate
            dehydrogenase mRNA, partial cds.
          Length = 319

 Score =  302 bits (774), Expect = 1e-80
 Identities = 164/317 (51%), Positives = 207/317 (65%), Gaps = 9/317 (2%)
 Frame = +2

Query: 230  AILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGF------- 388
            A+LGAAGGIGQPLSLL KL+  +  ++ +D+ GTPGVAAD+SHI + +++ G        
Sbjct: 1    AVLGAAGGIGQPLSLLCKLSDHIDEVACYDVVGTPGVAADLSHIPSGAKITGDLPSAGTW 60

Query: 389  --SGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVN 562
              S +  L +AL GA VV+IPAGVPRKPGMTRDDLFN NA IVK+L    AK+CP A++ 
Sbjct: 61   PPSHNAGLERALTGASVVVIPAGVPRKPGMTRDDLFNTNASIVKTLVEGCAKFCPDAVLA 120

Query: 563  MISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIG 742
            +ISNPVNSTVPIAAEV KKAG Y++ ++ GVTTLDV RA TF                IG
Sbjct: 121  IISNPVNSTVPIAAEVLKKAGVYNKNKVVGVTTLDVCRANTFLAEKLGKSPKDINVPVIG 180

Query: 743  GHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIF 922
            GHAGITILPL SQ    + L  DV   LT R Q GG EVV+AKAG GSATLSMAYAG +F
Sbjct: 181  GHAGITILPLLSQVPGASALPADVTAALTHRIQFGGDEVVQAKAGSGSATLSMAYAGFLF 240

Query: 923  ADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXX 1102
             +  +K + G  +V++C++V+ST+T   +FAS  + G  GV+EVLG G+L+ +       
Sbjct: 241  TEGLIKAMKG-EEVIQCAYVESTLTPAAYFASPCKFGPEGVKEVLGFGTLSAYEKQWFDK 299

Query: 1103 XXXXXXXXXXXGIQFAN 1153
                       GI F N
Sbjct: 300  MVPDLQKQIAKGIDFVN 316



>sp|Q9CN86|MDH_PASMU Malate dehydrogenase (EC
            1.1.1.37).>gb:AE006091_215438 Pasteurella multocida
            subsp. multocida str. Pm70 section 58 of 204 of the
            complete genome.>gb:AE004439_1118168 Pasteurella
            multocida subsp. multocida str. Pm70, complete genome.
          Length = 311

 Score =  301 bits (771), Expect = 2e-80
 Identities = 176/313 (56%), Positives = 212/313 (67%), Gaps = 2/313 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+KL  P  S LSL+DIA  TPGVAADVSHI T  +V GF+G+
Sbjct: 2    KVAVLGAAGGIGQALALLLKLQLPAGSELSLYDIAPVTPGVAADVSHIPTAVKVQGFAGE 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    AL+GADVV+I AGV RKPGM R DLFNINAGIV++L   +A+ CP A V +I+NP
Sbjct: 62   DPT-PALQGADVVLISAGVARKPGMDRSDLFNINAGIVRNLIEKVAQVCPKACVGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+++LFGVTTLD++R++TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKKAGVYDKRKLFGVTTLDIIRSETFVSELKNLEPARTTVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ    A      I  LTKR Q+ GTEVVEAKAG GSATLSMA A A FA + +
Sbjct: 181  TILPLLSQ-VQYAEWNDAEIAPLTKRIQNAGTEVVEAKAGGGSATLSMAQAAARFALSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXX 1117
            KGLNG  +VVEC++V+       FFA  VRLGK GVEE+L LGSL+ F            
Sbjct: 240  KGLNG-ENVVECTYVEGDGKYARFFAQPVRLGKEGVEEILPLGSLSAFEQHALDAMLETL 298

Query: 1118 XXXXXXGIQFANQ 1156
                  G +F NQ
Sbjct: 299  RADIELGEKFVNQ 311



>gb:PIGMDH_1443191 Pig mitochondrial malate dehydrogenase (mMDH) mRNA,
            complete cds.
          Length = 298

 Score =  299 bits (766), Expect = 8e-80
 Identities = 152/271 (56%), Positives = 195/271 (71%)
 Frame = +2

Query: 269  SLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPA 448
            SLL+K +PLVS L+L+DIA TPGVAAD+SHI TR+ V G+ G E L   L+G DVV+IPA
Sbjct: 1    SLLLKNSPLVSRLTLYDIAHTPGVAADLSHIETRATVKGYLGPEQLPDCLKGCDVVVIPA 60

Query: 449  GVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGT 628
            GVPRKPGMTRDDLFN NA +V +L+ A A++CP A++ +ISNPVNST+P+ AEVFKK G 
Sbjct: 61   GVPRKPGMTRDDLFNTNATMVATLTVACAQHCPDAMICIISNPVNSTIPMTAEVFKKHGV 120

Query: 629  YDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAH 808
            Y+  ++FGVTTLD+VRA  F                IGGHAG TI+PL SQ TP+ +   
Sbjct: 121  YNPNKIFGVTTLDIVRANAFVAELKGLDPARVSVPVIGGHAGKTIIPLISQCTPKVDFPQ 180

Query: 809  DVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQS 988
            D +  LT R Q+ GTEVV+AKAG GSATLSMAYAGA F  + +  +NG   VVECSFV+S
Sbjct: 181  DQLSTLTGRIQEAGTEVVKAKAGAGSATLSMAYAGARFVFSLVDAMNGKEGVVECSFVKS 240

Query: 989  TVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
              T+ P+F++ + LGK G+E+ L +G ++ F
Sbjct: 241  QETDCPYFSTPLLLGKKGIEKNLRIGKISPF 271



>gb:AF027739_1234356 Trypanosoma brucei malate dehydrogenase (mMDH)
            mRNA, nuclear gene encoding mitochondrial protein,
            complete cds.
          Length = 318

 Score =  299 bits (766), Expect = 8e-80
 Identities = 159/278 (57%), Positives = 199/278 (71%), Gaps = 1/278 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN 403
            KVA+LGAAGGIGQPLSL++K NPLVSHLS +DI G  GVAAD+SHI + ++V G   DE 
Sbjct: 10   KVAVLGAAGGIGQPLSLILKTNPLVSHLSCYDIHGVTGVAADLSHICSPAKVTGHLKDE- 68

Query: 404  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN 583
            L KA++GADVVIIPAG PRKPGMTR+DLF++NA IV+ L +A AK CP AL+ ++SNPVN
Sbjct: 69   LHKAVDGADVVIIPAGTPRKPGMTREDLFSVNATIVRDLVSACAKQCPKALIGVVSNPVN 128

Query: 584  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITI 763
            S VPIA+EV KKAG +D  RLFG+TTLDVVRA+TF                +GGH+G TI
Sbjct: 129  SVVPIASEVLKKAGVFDPARLFGITTLDVVRARTFVAEAAGKSPYDVNVQVVGGHSGPTI 188

Query: 764  LPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKG 943
            +PL SQA    +L  + +  +T R Q GG EVV+AK G GSATLSMAYA   +  + LKG
Sbjct: 189  IPLLSQA--GVSLTEEQVKAITHRVQYGGDEVVKAKGGAGSATLSMAYAAGEWMSSVLKG 246

Query: 944  LNGVPDVVECSFVQSTVTE-LPFFASKVRLGKNGVEEV 1054
            L G   +VEC++VQ+ +   + FF   V LGK GVE++
Sbjct: 247  LRGDKGIVECTYVQTDIIPGVNFFGCPVELGKGGVEKI 284



>gb:AJ863165_1814972 Orpinomyces sp. OUS1 partial mdh1 gene for
            putative malate dehydrogenase, exons 1-5.
          Length = 287

 Score =  298 bits (762), Expect = 2e-79
 Identities = 158/286 (55%), Positives = 197/286 (68%), Gaps = 3/286 (1%)
 Frame = +2

Query: 233  ILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDENLGK 412
            I  AAGGIGQ +SL++K +PLV  L+L+DI   PGVA D+SHINT+++V G++G + L  
Sbjct: 3    IYSAAGGIGQSISLILKKHPLVDELALYDIVNAPGVATDLSHINTKAKVTGYNGVKELDA 62

Query: 413  ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTV 592
            AL G+D+V++PAGVPRKPGMTRDDLF INAGIVK L+ AIAK CP A   +ISNPVNSTV
Sbjct: 63   ALTGSDIVVVPAGVPRKPGMTRDDLFKINAGIVKGLATAIAKNCPKAFSCIISNPVNSTV 122

Query: 593  PIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPL 772
            PI AEVFK  G Y+ K+LFGVTTLDVVRA TF                IGGH+G TI+PL
Sbjct: 123  PICAEVFKTYGCYNPKKLFGVTTLDVVRANTFVSECKGLDVTKTDITVIGGHSGTTIIPL 182

Query: 773  FSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNG 952
             SQ  P        I  LT+  Q GG EVV+AK GKGSATLSMAYAGA F D  L+ +  
Sbjct: 183  LSQ-IPGVTFTDSQIKSLTQHIQFGGDEVVKAKNGKGSATLSMAYAGACFVDKLLQAIVL 241

Query: 953  VPDVVECSFVQSTVTE---LPFFASKVRLGKNGVEEVLGLGSLTDF 1081
               V  CS+V+S + +   + FF+S +++ K GV+E L LG L++F
Sbjct: 242  NKTVTACSYVESPIAKADGIRFFSSALKINKKGVQEYLPLGKLSEF 287



>sp|Q7MYW9|MDH_PHOLL Malate dehydrogenase (EC
            1.1.1.37).>gb:BX571874_789402 Photorhabdus luminescens
            subsp. laumondii TTO1 complete genome; segment 16/17.
          Length = 312

 Score =  298 bits (762), Expect = 2e-79
 Identities = 167/288 (57%), Positives = 201/288 (69%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GF+G 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTEVKIKGFAG- 60

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            E+   ALEGA+VV+I AGV RKPGM R DLFNINAGIV++L   +AK CP +L+ +I+NP
Sbjct: 61   EDATPALEGANVVLISAGVARKPGMDRSDLFNINAGIVRNLVEQVAKTCPKSLIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+ RLFGVTTLDV+R+ TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKKAGVYDKNRLFGVTTLDVIRSNTFVAELKGKKPQEIEVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ  P  N     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A    + +
Sbjct: 181  TILPLLSQ-IPGVNFTDGELAALTKRIQNAGTEVVEAKAGGGSATLSMGQAAARLGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            +GL G  DVVEC++V+       FFA  VRLGKNGVEE L +G L+DF
Sbjct: 240  RGLQGESDVVECAYVEGDGKYARFFAQPVRLGKNGVEERLNIGELSDF 287



>gb:CR382126_1659500 Kluyveromyces lactis strain NRRL Y-1140
            chromosome F of strain NRRL Y-1140 of Kluyveromyces
            lactis.
          Length = 338

 Score =  297 bits (761), Expect = 3e-79
 Identities = 164/307 (53%), Positives = 209/307 (68%), Gaps = 8/307 (2%)
 Frame = +2

Query: 182  VARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHI 361
            +ARR F+S +    KV +LGA GGIGQPLSLL+KLN  V+ L L+D+ G  GVAAD+SHI
Sbjct: 5    IARRQFSSTAFNPYKVTVLGAGGGIGQPLSLLLKLNHKVTDLRLYDLKGAKGVAADLSHI 64

Query: 362  NTRSEVVGFSGDEN-----LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSA 526
             T S V GF+ +       L  AL+  +VV+IPAGVPRKPGMTRDDLF+INAGIV+ L+ 
Sbjct: 65   PTNSTVTGFTPESKESQAELAAALKDTEVVLIPAGVPRKPGMTRDDLFSINAGIVRDLAG 124

Query: 527  AIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXX 706
            AIAK  P+A + +ISNPVNSTVPI AEV K+ G Y+ K+LFGVTTLDV+R+  F      
Sbjct: 125  AIAKNAPNAAILVISNPVNSTVPIVAEVLKQNGVYNPKKLFGVTTLDVIRSSRFISEIRN 184

Query: 707  XXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGS 886
                      +GGH+GITILPL SQ   ++ +  + +  L  R Q GG EVV+AK G GS
Sbjct: 185  TDPTTERVTVVGGHSGITILPLISQTKHKSMIQGETLDKLVHRIQFGGDEVVQAKNGAGS 244

Query: 887  ATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTE---LPFFASKVRLGKNGVEEVL 1057
            ATLSMA AGA FA++ L G  G  DVVE +FV S + +   + FFAS V LG  GVE++ 
Sbjct: 245  ATLSMAEAGARFANSVLAGFEGERDVVESTFVDSPLYKSEGIEFFASPVTLGPEGVEKIH 304

Query: 1058 GLGSLTD 1078
            G+G+L++
Sbjct: 305  GIGALSE 311



>sp|Q87SU7|MDH_VIBPA Malate dehydrogenase (EC
            1.1.1.37).>gb:BA000031_705785 Vibrio parahaemolyticus
            RIMD 2210633 DNA, chromosome 1, complete sequence.
          Length = 311

 Score =  296 bits (759), Expect = 5e-79
 Identities = 168/311 (54%), Positives = 206/311 (66%), Gaps = 2/311 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA++GAAGGIGQ L+LL+K   P  S L+L+DIA  TPGVAAD+SHI T   + G++G+
Sbjct: 2    KVAVIGAAGGIGQALALLLKNRLPAGSDLALYDIAPVTPGVAADLSHIPTPVSIKGYAGE 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    ALEGADVV+I AGV RKPGM R DLFN+NAGIVKSL+  IA  CP A V +I+NP
Sbjct: 62   DPT-PALEGADVVLISAGVARKPGMDRADLFNVNAGIVKSLAEKIAVVCPKACVGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TVPIAAEV KKAG YD++RLFG+TTLDV+R++TF                IGGH+G+
Sbjct: 121  VNTTVPIAAEVLKKAGVYDKRRLFGITTLDVIRSETFVAELKGKDPSDIRVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ       A +V   LTKR Q+ GTEVVEAKAG GSATLSM  A   F  A +
Sbjct: 181  TILPLLSQVEGVEFTAEEV-EALTKRIQNAGTEVVEAKAGGGSATLSMGQAACRFGLALV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXX 1117
            + L G   VVEC++V+      P+FA  V+LGK GVEEVL  G L+DF            
Sbjct: 240  RALQGEEGVVECAYVEGDSEHAPYFAQPVKLGKEGVEEVLSYGELSDFEKAALDGMLETL 299

Query: 1118 XXXXXXGIQFA 1150
                  G++FA
Sbjct: 300  NGDINIGVEFA 310



>gb:AF487682_1804300 Talaromyces emersonii malate dehydrogenase (mdh1)
            mRNA, complete cds; nuclear gene for mitochondrial
            product.
          Length = 339

 Score =  296 bits (757), Expect = 9e-79
 Identities = 169/328 (51%), Positives = 208/328 (63%), Gaps = 4/328 (1%)
 Frame = +2

Query: 188  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT 367
            +R F++ +    KVAILGAAGGIGQPLSLLMKLNP V+ L+L+DI G PGVAAD+SHINT
Sbjct: 13   KRAFSASARQSSKVAILGAAGGIGQPLSLLMKLNPRVTELALYDIRGGPGVAADLSHINT 72

Query: 368  RSEVVGFSGD-ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYC 544
             S V G+    E L  AL+G+++V+IPAGVPRK GMTRDDLFN NA IV+ L+ A A  C
Sbjct: 73   NSTVTGYQPTPEGLRDALKGSEIVLIPAGVPRKRGMTRDDLFNTNASIVRDLAKAAADAC 132

Query: 545  PHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXX 724
            P+A + +ISNPVNSTVPI AEVFK  G Y+ KRLFGVTTLDVVRA  F            
Sbjct: 133  PNANILVISNPVNSTVPIVAEVFKSKGVYNPKRLFGVTTLDVVRASRFISEVKNTDPANE 192

Query: 725  XXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMA 904
                +GGH+G+TI+PL SQ+    ++  +    L  R Q GG E V+AK G GSA LSMA
Sbjct: 193  EVTVVGGHSGVTIVPLISQSN-HPDIEGETRDKLVNRIQFGGDEGVKAKDGAGSAALSMA 251

Query: 905  YAGAIFADACLKGLNGVPDVVECSFVQSTVTE---LPFFASKVRLGKNGVEEVLGLGSLT 1075
            +AGA     C  G  GV  VVE SFV S + +   + FFAS+V LG NG E+VL +G ++
Sbjct: 252  FAGARSPSLCSSG-QGVKGVVEPSFVDSPLYKDQGIDFFASRVELGPNGAEKVLPVGKVS 310

Query: 1076 DFXXXXXXXXXXXXXXXXXXGIQFANQN 1159
             +                  GI F   N
Sbjct: 311  PYEEKLLEAAFADLKKNIQKGIDFVKNN 338



>gb:AF439996_1800036 Talaromyces emersonii malate dehydrogenase (mdh1)
            gene, partial cds; nuclear gene for mitochondrial
            product.
          Length = 339

 Score =  294 bits (753), Expect = 3e-78
 Identities = 168/328 (51%), Positives = 208/328 (63%), Gaps = 4/328 (1%)
 Frame = +2

Query: 188  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT 367
            +R F++ +    KVAILGAAGGIGQPLSLLMKLNP V+ L+L+DI G PGVAAD+SHINT
Sbjct: 13   KRAFSASARQSSKVAILGAAGGIGQPLSLLMKLNPRVTELALYDIRGGPGVAADLSHINT 72

Query: 368  RSEVVGFSGD-ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYC 544
             S V G+    E L  AL+G+++V+IPAGVPRK GMTRDDLFN NA IV+ L+ A A  C
Sbjct: 73   NSTVTGYQPTPEGLRDALKGSEIVLIPAGVPRKRGMTRDDLFNTNASIVRDLAKAAADAC 132

Query: 545  PHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXX 724
            P+A + +ISNPVNSTVPI AEVFK  G Y+ KRLFGVTTLDVVRA  F            
Sbjct: 133  PNANILVISNPVNSTVPIVAEVFKSKGVYNPKRLFGVTTLDVVRASRFISEVKNTDPANE 192

Query: 725  XXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMA 904
                +GGH+G+TI+PL SQ+    ++  +    L  R Q GG E V+AK G GSA LSMA
Sbjct: 193  EVTVVGGHSGVTIVPLISQSN-HPDIEGETRDKLVNRIQFGGDEGVKAKDGAGSAALSMA 251

Query: 905  YAGAIFADACLKGLNGVPDVVECSFVQSTVTE---LPFFASKVRLGKNGVEEVLGLGSLT 1075
            +AGA     C  G  GV  VV+ SFV S + +   + FFAS+V LG NG E+VL +G ++
Sbjct: 252  FAGARSPSLCSSG-QGVKGVVKPSFVDSPLYKDQGIDFFASRVELGPNGAEKVLPVGKVS 310

Query: 1076 DFXXXXXXXXXXXXXXXXXXGIQFANQN 1159
             +                  GI F   N
Sbjct: 311  PYEEKLLEAAFADLKKNIQKGIDFVKNN 338



>gb:CR380958_1653298 Candida glabrata strain CBS138 chromosome L
            complete sequence.
          Length = 336

 Score =  294 bits (752), Expect = 3e-78
 Identities = 165/305 (54%), Positives = 206/305 (67%), Gaps = 5/305 (1%)
 Frame = +2

Query: 176  SRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVS 355
            SR++RR F+S      KV +LGA GGIGQPLSLL+KLN  V+ L L+D+ G PGVA+D+S
Sbjct: 3    SRISRRAFSSTRINPYKVTVLGANGGIGQPLSLLLKLNQKVTDLRLYDLRGAPGVASDLS 62

Query: 356  HINTRSEVVGFSGDE--NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA 529
            HI T S V GF+ +E   L  AL+  D+V+IPAGVPRKPGMTRDDLF INAGIV+ L+ A
Sbjct: 63   HIPTNSTVKGFTPEEADGLKNALKDTDLVLIPAGVPRKPGMTRDDLFAINAGIVRDLATA 122

Query: 530  IAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXX 709
             A+  P+A + +ISNPVNSTVPI AEV +K G Y+ K+LFGVTTLD +RA  F       
Sbjct: 123  AAESAPNAAILVISNPVNSTVPIVAEVLQKKGVYNPKKLFGVTTLDSIRASRFISEVVGT 182

Query: 710  XXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSA 889
                     +GGH+GITI+PL SQ      L  D    L KR Q GG EVV+AK G GSA
Sbjct: 183  DPTQEKVNVVGGHSGITIIPLLSQTKYGDKLDKDQKDALIKRIQFGGDEVVKAKNGAGSA 242

Query: 890  TLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTE---LPFFASKVRLGKNGVEEVLG 1060
            TLSMA AGA+FA+A L G  G  +VVE SFV S + +   + FFAS V LGK GV ++  
Sbjct: 243  TLSMAQAGALFANAVLSGFAGEQNVVEPSFVDSPLYKGEGIEFFASPVTLGKEGVVKIHP 302

Query: 1061 LGSLT 1075
            +G+++
Sbjct: 303  IGTIS 307



>gb:AY288068_1594815 Paracoccidioides brasiliensis malate
            dehydrogenase mRNA, complete cds; nuclear gene for
            mitochondrial product.
          Length = 340

 Score =  293 bits (750), Expect = 6e-78
 Identities = 163/328 (49%), Positives = 213/328 (64%), Gaps = 4/328 (1%)
 Frame = +2

Query: 188  RRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINT 367
            RR F+  +    KVAILGAAGGIGQ LSLLMKL+P V+ L+L+DI G PGVAAD+SHINT
Sbjct: 13   RRAFSVSAPQSSKVAILGAAGGIGQSLSLLMKLSPRVTQLALYDIRGGPGVAADLSHINT 72

Query: 368  RSEVVGFSGDEN-LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYC 544
             S V G+    + L  AL+ +++V+IPAGVPRKPGMTRDDLFN NA IV+ L+ A A   
Sbjct: 73   NSTVTGYDPTPSGLRDALKDSEIVLIPAGVPRKPGMTRDDLFNTNASIVRDLAKAAADAS 132

Query: 545  PHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXX 724
            P+A + +I+NPVNSTVPI AEVFK    Y+ KRLFGVTTLDV+RA  F            
Sbjct: 133  PNANILVIANPVNSTVPIVAEVFKSKNVYNPKRLFGVTTLDVIRASRFISQVKGTDPKDE 192

Query: 725  XXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMA 904
                +GGH+G+TI+PL SQ+    +++ + +  L  R Q GG EVV+AK G GSATLSMA
Sbjct: 193  KVTVVGGHSGVTIVPLISQSN-HPDISGEKLETLVNRIQFGGDEVVKAKDGAGSATLSMA 251

Query: 905  YAGAIFADACLKGLNGVPDVVECSFVQSTVTE---LPFFASKVRLGKNGVEEVLGLGSLT 1075
             AGA FA++ LK   G   V+E +FV S + +   + FFAS+V LG NGVE++L +G ++
Sbjct: 252  MAGARFAESLLKASQGEKGVIEPTFVDSPLYKDQGIDFFASRVELGPNGVEKILPVGKVS 311

Query: 1076 DFXXXXXXXXXXXXXXXXXXGIQFANQN 1159
            ++                  G++F   N
Sbjct: 312  EYEQKLLDACLVDLKKNIAKGVEFVKTN 339



>gb:AE017340_456237 Idiomarina loihiensis L2TR, complete genome.
          Length = 310

 Score =  292 bits (747), Expect = 1e-77
 Identities = 168/312 (53%), Positives = 202/312 (64%), Gaps = 2/312 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAGT-PGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ LSLL+K   P  S LSL+D+A   PGVA D+SHI T  +V GF G 
Sbjct: 2    KVAVLGAAGGIGQALSLLLKTQLPAGSELSLYDVAPVVPGVAVDLSHIPTDVKVTGF-GK 60

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            ++L  AL G+D+V+IPAGVPRKPGM R DLFN+NAGIVK+L   +A  CP+A V +I+NP
Sbjct: 61   DDLASALVGSDIVLIPAGVPRKPGMDRSDLFNMNAGIVKNLVQGVADNCPNACVGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TVPIAAEV KKAG YD+++LFGVTTLDV+R++ F                IGGH+G 
Sbjct: 121  VNTTVPIAAEVLKKAGCYDKRKLFGVTTLDVIRSEAFVGELRGLNPENVNVPVIGGHSGT 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ           I  LT R Q+ GTEVVEAKAG GSATLSM  A A FA + L
Sbjct: 181  TILPLLSQ-VEGVEFTEQEIKDLTHRIQNAGTEVVEAKAGGGSATLSMGQAAARFALSLL 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXX 1117
            KGL G  D +EC++V+       FFA  VRLGKNG EE+L  G L+ F            
Sbjct: 240  KGLQG-QDTIECTYVEGPGDNAKFFAQPVRLGKNGAEEILSYGKLSAFEQKCMDEMLDGL 298

Query: 1118 XXXXXXGIQFAN 1153
                  GI FA+
Sbjct: 299  KGDIQTGIDFAS 310



>gb:AY773261_645871 Actinobacillus succinogenes plasmid pKNJ
            NAD(H)-dependent malate dehydrogenase (mdh) gene,
            complete cds.
          Length = 312

 Score =  291 bits (745), Expect = 2e-77
 Identities = 161/310 (51%), Positives = 205/310 (66%), Gaps = 2/310 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KV +LGA+GGIGQPLSLL+KL+ P  S LSL+D+A  TPGVA D+SHI T  EV GF GD
Sbjct: 2    KVTLLGASGGIGQPLSLLLKLHLPAESDLSLYDVAPVTPGVAKDISHIPTSVEVEGFGGD 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +   +AL+GAD+V+I AGV RKPGMTR DLFN+NAGI+++L   +A+ CP A V +I+NP
Sbjct: 62   DP-SEALKGADIVLICAGVARKPGMTRADLFNVNAGIIQNLVEKVAQVCPQACVCIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VNS +PIAAEV KKAG YD+++LFG+TTLD +R++ F                IGGH+G+
Sbjct: 121  VNSIIPIAAEVLKKAGVYDKRKLFGITTLDTIRSEKFIVQAKNIEINRNDISVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ  P        +  LT R Q+ GTEVVEAKAG GSATLSMAYA   F  +  
Sbjct: 181  TILPLLSQ-IPHVEFTEQELKDLTHRIQNAGTEVVEAKAGAGSATLSMAYAAMRFVVSMA 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXX 1117
            + LNG   + EC++++       FFA  VRLGKNGVEE+L LG+L+ F            
Sbjct: 240  RALNG-EVITECAYIEGDGKFARFFAQPVRLGKNGVEEILPLGTLSAFEQQALEAMLPTL 298

Query: 1118 XXXXXXGIQF 1147
                  G++F
Sbjct: 299  QTDIDNGVKF 308



>gb:AF117876_480383 Vibrio cholerae isolate M551 malate dehydrogenase
            (mdh) gene, complete cds.
          Length = 311

 Score =  291 bits (744), Expect = 3e-77
 Identities = 162/310 (52%), Positives = 206/310 (66%), Gaps = 2/310 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA++GAAGGIGQ L+LL+K   P  S L+L+DIA  TPGVAAD+SHI T   + G++G+
Sbjct: 2    KVAVIGAAGGIGQALALLLKNRLPAGSDLALYDIAPVTPGVAADLSHIPTPVTIKGYAGE 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    ALEGADVV++ AGV RKPGM R DLFN+NAGIVK+L+  IA  CP A V +I+NP
Sbjct: 62   DTT-PALEGADVVLVSAGVARKPGMDRADLFNVNAGIVKALAEKIAVVCPKACVGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TVPIAAEV KKAG YD+++LFGVTTLDV+R++TF                IGGH+G+
Sbjct: 121  VNTTVPIAAEVLKKAGVYDKRKLFGVTTLDVIRSETFVAALKDKDPGQVRVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ     +   + +  LTKR Q+ GTEVVEAKAG GSATLSM  A   F  A +
Sbjct: 181  TILPLLSQ-VEGVSFTDEEVAALTKRIQNAGTEVVEAKAGGGSATLSMGQAACRFGLALV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXX 1117
            K L G  DVVE ++V+      PFFA  ++LGKNGVEE+L +G L+ +            
Sbjct: 240  KALQGESDVVEYAYVEGEGEYAPFFAQPIKLGKNGVEELLDIGKLSAYEQAALDGMLDTL 299

Query: 1118 XXXXXXGIQF 1147
                  G++F
Sbjct: 300  KGDIQIGVEF 309



>sp|P44427|MDH_HAEIN Malate dehydrogenase (EC
            1.1.1.37).>pir|C64110|C64110 malate dehydrogenase (EC
            1.1.1.37) - Haemophilus influenzae  (strain Rd
            KW20)>gb:U32800_204875 Haemophilus influenzae Rd KW20
            section 115 of 163 of the complete
            genome.>gb:L42023_1097424 Haemophilus influenzae Rd KW20
            complete genome.
          Length = 311

 Score =  290 bits (743), Expect = 4e-77
 Identities = 168/288 (58%), Positives = 202/288 (70%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+KL  P  + LSL+DIA  TPGVA DVSHI T   V GFSG+
Sbjct: 2    KVAVLGAAGGIGQALALLLKLQLPAGTDLSLYDIAPVTPGVAVDVSHIPTAVNVKGFSGE 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    ALEGADVV+I AGV RKPGM R DLFNINAGIV+ L   +A  CP A V +I+NP
Sbjct: 62   DPT-PALEGADVVLISAGVARKPGMDRSDLFNINAGIVRGLIEKVAVTCPKACVGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+++LFGVTTLDV+R++TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKKAGVYDKRKLFGVTTLDVLRSETFVAELKGLNVSRTSVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ    A    D I  LTKR Q+ GTEV+ AKAG GSATLSMA A A FA + +
Sbjct: 181  TILPLLSQ-VQYAKWNEDEIEPLTKRIQNAGTEVLNAKAGGGSATLSMAQAAARFARSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            KGL+G   VVEC++V+       FF+  VRLGK GVEE+L +G L++F
Sbjct: 240  KGLSG-ETVVECTYVEGDGKYARFFSQPVRLGKEGVEEILPIGPLSNF 286



>gb:AF117859_480366 Vibrio cholerae isolate M557 malate dehydrogenase
            (mdh) gene, complete cds.>gb:AF117860_480367 Vibrio
            cholerae isolate M558 malate dehydrogenase (mdh) gene,
            complete cds.>gb:AF117861_480368 Vibrio cholerae isolate
            M554 malate dehydrogenase (mdh) gene, complete
            cds.>gb:AF117864_480371 Vibrio cholerae isolate M550
            malate dehydrogenase (mdh) gene, complete cds.
          Length = 311

 Score =  290 bits (742), Expect = 5e-77
 Identities = 162/310 (52%), Positives = 206/310 (66%), Gaps = 2/310 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA++GAAGGIGQ L+LL+K   P  S L+L+DIA  TPGVAAD+SHI T   + G++G+
Sbjct: 2    KVAVIGAAGGIGQALALLLKNRLPAGSDLALYDIAPVTPGVAADLSHIPTPVTIKGYAGE 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    ALEGADVV++ AGV RKPGM R DLFN+NAGIVK+L+  IA  CP A V +I+NP
Sbjct: 62   DPT-PALEGADVVLVSAGVARKPGMDRADLFNVNAGIVKALAEKIAVVCPKACVGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TVPIAAEV KKAG YD+++LFGVTTLDV+R++TF                IGGH+G+
Sbjct: 121  VNTTVPIAAEVLKKAGVYDKRKLFGVTTLDVIRSETFVAALKDKDPGQVRVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ     +   + +  LTKR Q+ GTEVVEAKAG GSATLSM  A   F  A +
Sbjct: 181  TILPLLSQ-VEGVSFTDEEVAALTKRIQNAGTEVVEAKAGGGSATLSMGQAACRFGLALV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXX 1117
            K L G  DVVE ++V+      PFFA  ++LGKNGVEE+L +G L+ +            
Sbjct: 240  KALQGESDVVEYAYVEGEGEYAPFFAQPIKLGKNGVEELLDIGKLSAYEQAALDGMLDTL 299

Query: 1118 XXXXXXGIQF 1147
                  G++F
Sbjct: 300  KGDIQIGVEF 309



>gb:AE016817_1747536 Ashbya gossypii (= Eremothecium gossypii) ATCC
            10895 chromosome IV, complete sequence.
          Length = 332

 Score =  289 bits (740), Expect = 9e-77
 Identities = 166/304 (54%), Positives = 204/304 (67%), Gaps = 5/304 (1%)
 Frame = +2

Query: 179  RVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSH 358
            RVARRGF +      +V++LGA GGIGQPLSLL+KLN  V+ L L+D+ G  GVAAD+SH
Sbjct: 4    RVARRGFRADGVRAYRVSVLGANGGIGQPLSLLLKLNKRVTDLRLYDLKGAKGVAADLSH 63

Query: 359  INTRSEVVGFSGD--ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAI 532
            I T S+V G++ +  E L +AL GADVV++PAGVPRKPGMTRDDLF INAG+V+ L+ AI
Sbjct: 64   IPTNSQVSGYTAENPEALREALTGADVVVVPAGVPRKPGMTRDDLFAINAGVVQQLAGAI 123

Query: 533  AKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXX 712
             ++ P A V +ISNPVNSTVPI A   +K G YD ++LFGVTTLD +RA  F        
Sbjct: 124  GQHAPGAAVLVISNPVNSTVPIMAAELRKLGVYDPRKLFGVTTLDSIRASRFISEVQGTD 183

Query: 713  XXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSAT 892
                    IGGH+GITI+P+ SQ T    +       L  R Q GG EVV+AK G GSAT
Sbjct: 184  PTRERVPVIGGHSGITIIPVLSQ-TQHTGIDKATRDALIHRIQFGGDEVVKAKNGAGSAT 242

Query: 893  LSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTE---LPFFASKVRLGKNGVEEVLGL 1063
            LSMA AGA FADA L GL G   VVE +FV S + +   + FFAS V LG  GVEEV  +
Sbjct: 243  LSMARAGAKFADAVLAGLAGEQGVVEPAFVDSPLYKSEGIEFFASAVTLGPRGVEEVHPV 302

Query: 1064 GSLT 1075
            G+L+
Sbjct: 303  GTLS 306



>gb:AB185127_16703 Moritella sp. 38C1 mdh gene for malate
            dehydrogenase, complete cds.>gb:AB185128_16704 Moritella
            sp. 38F1 mdh gene for malate dehydrogenase, complete cds.
          Length = 312

 Score =  289 bits (740), Expect = 9e-77
 Identities = 161/288 (55%), Positives = 198/288 (68%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T   + GFSG 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPAGSELSLYDIAPVTPGVAVDLSHIPTDVTITGFSGT 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    AL GADVV+I AGV RKPGM R DLFNINAGI+K+L++  A+ CP A + +I+NP
Sbjct: 62   DPTA-ALVGADVVLISAGVARKPGMDRSDLFNINAGIIKNLASKCAEVCPTACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TVPIAAEV K+AG YD+++LFG+TTLDV+R++TF                IGGH+G+
Sbjct: 121  VNTTVPIAAEVLKQAGVYDKRKLFGITTLDVIRSETFVSALKGISLADVAVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ       A + I  LT R Q+ GTEVVEAKAG GSATLSM +A A F  + +
Sbjct: 181  TILPLLSQVKGVEFTAEE-IATLTTRIQNAGTEVVEAKAGGGSATLSMGHAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   +VEC++V        FFA  V LGKNGVEEVL  G L+DF
Sbjct: 240  RALQGEKGIVECTYVDGGSEHATFFAQPVLLGKNGVEEVLAYGDLSDF 287



>pir|T41286|T41286 malate dehydrogenase precursor, mitochondrial -
            fission yeast (Schizosaccharomyces
            pombe)>gb:SPCC306_1721243 S.pombe chromosome III cosmid
            c306.
          Length = 341

 Score =  289 bits (740), Expect = 9e-77
 Identities = 161/304 (52%), Positives = 202/304 (66%), Gaps = 4/304 (1%)
 Frame = +2

Query: 182  VARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHI 361
            +A R F++ S+   KVA+LGA GGIGQPLS+L+KLN  VS L+LFDI G PGVAAD+ HI
Sbjct: 16   IAPRSFSTTSSRAFKVAVLGAGGGIGQPLSMLLKLNDKVSELALFDIRGAPGVAADIGHI 75

Query: 362  NTRSEVVGFSGDEN-LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAK 538
            NT S VVG++ D+  L KAL GADVVIIPAGVPRKPGMTRDDLF  NA IV+ L+ A  +
Sbjct: 76   NTTSNVVGYAPDDKGLEKALNGADVVIIPAGVPRKPGMTRDDLFATNASIVRDLAFAAGE 135

Query: 539  YCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXX 718
             CP A   +++NPVNSTVPI  +  ++ G +  K LFGVTTLD VRA  F          
Sbjct: 136  TCPEAKYLVVTNPVNSTVPIFKKALERVGVHQPKHLFGVTTLDSVRASRFTSQVTNGKAE 195

Query: 719  XXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLS 898
                  +GGH+G TI+PL SQ      L  +    L  R Q GG EVV+AKAG GSATLS
Sbjct: 196  LLHIPVVGGHSGATIVPLLSQG--GVELTGEKRDALIHRIQFGGDEVVKAKAGAGSATLS 253

Query: 899  MAYAGAIFADACLKGLNGVPDVVECSFVQSTVTE---LPFFASKVRLGKNGVEEVLGLGS 1069
            MAYAGA  A + L+ L G   V EC+FV+S + +   + FFAS+V LGK+GV+ +  +G 
Sbjct: 254  MAYAGARMASSVLRALAGESGVEECTFVESPLYKDQGIDFFASRVTLGKDGVDTIHPVGK 313

Query: 1070 LTDF 1081
            + D+
Sbjct: 314  INDY 317



>gb:AB187217_16866 Moritella yayanosii mdh gene for malate
            dehydrogenase, complete cds.
          Length = 312

 Score =  288 bits (738), Expect = 1e-76
 Identities = 161/288 (55%), Positives = 200/288 (69%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T   + GF+G 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPAGSDLSLYDIAPVTPGVAVDLSHIPTDVTIAGFAGT 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +   +AL GADVV+I AGV RKPGM R DLFNINAGI+K+L+A  A+ CP+A + +I+NP
Sbjct: 62   DPT-EALVGADVVLISAGVARKPGMDRSDLFNINAGIIKNLAAKCAEVCPNACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TVPIAAEV K+AG YD+++LFG+TTLDV+R++TF                IGGH+G+
Sbjct: 121  VNTTVPIAAEVLKQAGVYDKRKLFGITTLDVIRSETFVSELKGISLADVEVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ       A + IV LT R Q+ GTEVVEAKAG GSATLSM  A A F  + +
Sbjct: 181  TILPLLSQVKGVEFTAEE-IVTLTARIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   +VEC++V        FFA  V LGKNGVEEVL  G L++F
Sbjct: 240  RALQGEQGIVECTYVDGGSEHATFFAQPVLLGKNGVEEVLAYGELSEF 287



>sp|P17505|MDHM_YEAST Malate dehydrogenase, mitochondrial precursor
            (EC 1.1.1.37).>pir|A31945|DEBYMM malate dehydrogenase (EC
            1.1.1.37) precursor, mitochondrial - yeast (Saccharomyces
            cerevisiae)>gb:SCYKL085W_1713059 S.cerevisiae chromosome
            XI reading frame ORF YKL085w.>gb:YSCMALA_1729861
            S.cerevisiae mitochondrial malate dehydrogenase (MDH1)
            gene, complete cds.
          Length = 334

 Score =  288 bits (737), Expect = 2e-76
 Identities = 165/305 (54%), Positives = 205/305 (67%), Gaps = 5/305 (1%)
 Frame = +2

Query: 176  SRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVS 355
            SRVA+R F+S  A   KV +LGA GGIGQPLSLL+KLN  V+ L L+D+ G  GVA D+S
Sbjct: 3    SRVAKRAFSSTVANPYKVTVLGAGGGIGQPLSLLLKLNHKVTDLRLYDLKGAKGVATDLS 62

Query: 356  HINTRSEVVGFSGDE--NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA 529
            HI T S V GF+ +E   L  AL+  D+V+IPAGVPRKPGMTRDDLF INA IV+ L+AA
Sbjct: 63   HIPTNSVVKGFTPEEPDGLNNALKDTDMVLIPAGVPRKPGMTRDDLFAINASIVRDLAAA 122

Query: 530  IAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXX 709
             A+  P+A + +ISNPVNSTVPI A+V K  G Y+ K+LFGVTTLD +RA  F       
Sbjct: 123  TAESAPNAAILVISNPVNSTVPIVAQVLKNKGVYNPKKLFGVTTLDSIRAARFISEVENT 182

Query: 710  XXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSA 889
                     IGGH+GITI+PL SQ T    ++ D    L  R Q GG EVV+AK G GSA
Sbjct: 183  DPTQERVNVIGGHSGITIIPLISQ-TNHKLMSDDKRHELIHRIQFGGDEVVKAKNGAGSA 241

Query: 890  TLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTE---LPFFASKVRLGKNGVEEVLG 1060
            TLSMA+AGA FA+A L G  G  DV+E SFV S + +   + FFAS V LG +G+E++  
Sbjct: 242  TLSMAHAGAKFANAVLSGFKGERDVIEPSFVDSPLFKSEGIEFFASPVTLGPDGIEKIHP 301

Query: 1061 LGSLT 1075
            +G L+
Sbjct: 302  IGELS 306



>gb:AY557914_1614141 Saccharomyces cerevisiae clone FLH004209.01X
            YKL085W gene, complete cds.
          Length = 334

 Score =  288 bits (736), Expect = 2e-76
 Identities = 165/304 (54%), Positives = 204/304 (67%), Gaps = 5/304 (1%)
 Frame = +2

Query: 176  SRVARRGFASGSAPERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVS 355
            SRVA+R F+S  A   KV +LGA GGIGQPLSLL+KLN  V+ L L+D+ G  GVA D+S
Sbjct: 3    SRVAKRAFSSTVANPYKVTVLGAGGGIGQPLSLLLKLNHKVTDLRLYDLKGAKGVATDLS 62

Query: 356  HINTRSEVVGFSGDE--NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAA 529
            HI T S V GF+ +E   L  AL+  D+V+IPAGVPRKPGMTRDDLF INA IV+ L+AA
Sbjct: 63   HIPTNSVVKGFTPEEPDGLNNALKDTDMVLIPAGVPRKPGMTRDDLFAINASIVRDLAAA 122

Query: 530  IAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXX 709
             A+  P+A + +ISNPVNSTVPI A+V K  G Y+ K+LFGVTTLD +RA  F       
Sbjct: 123  TAESAPNAAILVISNPVNSTVPIVAQVLKNKGVYNPKKLFGVTTLDSIRAARFISEVENT 182

Query: 710  XXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSA 889
                     IGGH+GITI+PL SQ T    ++ D    L  R Q GG EVV+AK G GSA
Sbjct: 183  DPTQERVNVIGGHSGITIIPLISQ-TNHKLMSDDKRHELIHRIQFGGDEVVKAKNGAGSA 241

Query: 890  TLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTE---LPFFASKVRLGKNGVEEVLG 1060
            TLSMA+AGA FA+A L G  G  DV+E SFV S + +   + FFAS V LG +G+E++  
Sbjct: 242  TLSMAHAGAKFANAVLSGFKGERDVIEPSFVDSPLFKSEGIEFFASPVTLGPDGIEKIHP 301

Query: 1061 LGSL 1072
            +G L
Sbjct: 302  IGEL 305



>gb:AF117866_480373 Vibrio cholerae isolate M535 malate dehydrogenase
            (mdh) gene, complete cds.>gb:AF117867_480374 Vibrio
            cholerae isolate M553 malate dehydrogenase (mdh) gene,
            complete cds.
          Length = 311

 Score =  288 bits (736), Expect = 2e-76
 Identities = 161/310 (51%), Positives = 205/310 (66%), Gaps = 2/310 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA++GAAGGIGQ L+LL+K   P  S L+L+DIA  TPGVAAD+SHI T   + G++G+
Sbjct: 2    KVAVIGAAGGIGQALALLLKNRLPAGSDLALYDIAPVTPGVAADLSHIPTPVTIKGYAGE 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    ALEGADVV++ AGV RKPGM R DLFN+NAGIVK+L+  IA  CP A V +I+NP
Sbjct: 62   DPT-PALEGADVVLVSAGVARKPGMDRADLFNVNAGIVKALAEKIAVVCPKACVGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TVPIAAEV KKAG YD+++LFGVTTLDV+R++TF                IGGH+G+
Sbjct: 121  VNTTVPIAAEVLKKAGVYDKRKLFGVTTLDVIRSETFVAALKDKDPGQVRLPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ     +   + +  LTKR Q+ GTEVVEAKAG GSATLSM  A   F  A +
Sbjct: 181  TILPLLSQ-VEGVSFTDEEVAALTKRIQNAGTEVVEAKAGGGSATLSMGQAACRFGLALV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXX 1117
            K L G  DVVE ++V+      PFFA  ++LGKNGVE +L +G L+ +            
Sbjct: 240  KALQGESDVVEYAYVEGEGEYAPFFAQPIKLGKNGVEALLDIGKLSAYEQAALDGMLDTL 299

Query: 1118 XXXXXXGIQF 1147
                  G++F
Sbjct: 300  KGDIQIGVEF 309



>gb:AB185121_16697 Moritella sp. 36B1 mdh gene for malate
            dehydrogenase, complete cds.
          Length = 312

 Score =  288 bits (736), Expect = 2e-76
 Identities = 160/288 (55%), Positives = 198/288 (68%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T   + GF+G 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPAGSELSLYDIAPVTPGVAVDLSHIPTDVTITGFAGT 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    AL GADVV+I AGV RKPGM R DLFNINAGI+K+L++  A+ CP A + +I+NP
Sbjct: 62   DPTD-ALVGADVVLISAGVARKPGMDRSDLFNINAGIIKNLASKCAEVCPTACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TVPIAAEV K+AG YD+++LFG+TTLDV+R++TF                IGGH+G+
Sbjct: 121  VNTTVPIAAEVLKQAGVYDKRKLFGITTLDVIRSETFVSALKGISLADVAVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ       A + I  LT R Q+ GTEVVEAKAG GSATLSM +A A F  + +
Sbjct: 181  TILPLLSQVKGVEFTAEE-IATLTTRIQNAGTEVVEAKAGGGSATLSMGHAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   +VEC++V        FFA  V LGKNGVEEVL  G L+DF
Sbjct: 240  RALQGEKGIVECTYVDGGSEHATFFAQPVLLGKNGVEEVLAYGDLSDF 287



>pir|G82324|G82324 malate dehydrogenase VC0432 [imported] - Vibrio
            cholerae  (strain N16961 serogroup O1)>gb:AE004130_50835
            Vibrio cholerae O1 biovar eltor str. N16961 chromosome I,
            section 38 of 251 of the complete
            chromosome.>gb:AE003852_1051609 Vibrio cholerae O1 biovar
            eltor str. N16961 chromosome I, complete chromosome.
          Length = 353

 Score =  288 bits (736), Expect = 2e-76
 Identities = 161/310 (51%), Positives = 205/310 (66%), Gaps = 2/310 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA++GAAGGIGQ L+LL+K   P  S L+L+DIA  TPGVAAD+SHI T   + G++G+
Sbjct: 44   KVAVIGAAGGIGQALALLLKNRLPAGSDLALYDIAPVTPGVAADLSHIPTPVTIKGYAGE 103

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    ALEGADVV++ AGV RKPGM R DLFN+NAGIVK+L+  IA  CP A V +I+NP
Sbjct: 104  DPT-PALEGADVVLVSAGVARKPGMDRADLFNVNAGIVKALAEKIAVVCPKACVGIITNP 162

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TVPIAAEV KKAG YD+++LFGVTTLDV+R++TF                IGGH+G+
Sbjct: 163  VNTTVPIAAEVLKKAGVYDKRKLFGVTTLDVIRSETFVAALKDKDPGQVRVPVIGGHSGV 222

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ     +   + +  LTKR Q+ GTEVVEAKAG GSATLSM  A   F  A +
Sbjct: 223  TILPLLSQ-VEGVSFTDEEVAALTKRIQNAGTEVVEAKAGGGSATLSMGQAACRFGLALV 281

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXX 1117
            K L G  DVVE ++V+      PFFA  ++LGKNGVE +L +G L+ +            
Sbjct: 282  KALQGESDVVEYAYVEGEGEYAPFFAQPIKLGKNGVEALLDIGKLSAYEQAALDGMLDTL 341

Query: 1118 XXXXXXGIQF 1147
                  G++F
Sbjct: 342  KGDIQIGVEF 351



>sp|Q9KUT3|MDH_VIBCH Malate dehydrogenase (EC
            1.1.1.37).>gb:VCH575356_209509 Vibrio cholerae gene for
            malate dehydrogenase.>gb:AF117863_480370 Vibrio cholerae
            isolate M549 malate dehydrogenase (mdh) gene, complete
            cds.>gb:AF117865_480372 Vibrio cholerae isolate M793
            malate dehydrogenase (mdh) gene, complete
            cds.>gb:AF117868_480375 Vibrio cholerae isolate M561
            malate dehydrogenase (mdh) gene, complete
            cds.>gb:AF117869_480376 Vibrio cholerae isolate M556
            malate dehydrogenase (mdh) gene, complete
            cds.>gb:AF117870_480377 Vibrio cholerae isolate M645
            malate dehydrogenase (mdh) gene, complete
            cds.>gb:AF117871_480378 Vibrio cholerae isolate M559
            malate dehydrogenase (mdh) gene, complete
            cds.>gb:AF117872_480379 Vibrio cholerae isolate M560
            malate dehydrogenase (mdh) gene, complete
            cds.>gb:AF117873_480380 Vibrio cholerae isolate M563
            malate dehydrogenase (mdh) gene, complete
            cds.>gb:AF117874_480381 Vibrio cholerae isolate M555
            malate dehydrogenase (mdh) gene, complete
            cds.>gb:AF117875_480382 Vibrio cholerae isolate M536
            malate dehydrogenase (mdh) gene, complete
            cds.>gb:AF117877_480384 Vibrio cholerae isolate M562
            malate dehydrogenase (mdh) gene, complete cds.
          Length = 311

 Score =  288 bits (736), Expect = 2e-76
 Identities = 161/310 (51%), Positives = 205/310 (66%), Gaps = 2/310 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA++GAAGGIGQ L+LL+K   P  S L+L+DIA  TPGVAAD+SHI T   + G++G+
Sbjct: 2    KVAVIGAAGGIGQALALLLKNRLPAGSDLALYDIAPVTPGVAADLSHIPTPVTIKGYAGE 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    ALEGADVV++ AGV RKPGM R DLFN+NAGIVK+L+  IA  CP A V +I+NP
Sbjct: 62   DPT-PALEGADVVLVSAGVARKPGMDRADLFNVNAGIVKALAEKIAVVCPKACVGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TVPIAAEV KKAG YD+++LFGVTTLDV+R++TF                IGGH+G+
Sbjct: 121  VNTTVPIAAEVLKKAGVYDKRKLFGVTTLDVIRSETFVAALKDKDPGQVRVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ     +   + +  LTKR Q+ GTEVVEAKAG GSATLSM  A   F  A +
Sbjct: 181  TILPLLSQ-VEGVSFTDEEVAALTKRIQNAGTEVVEAKAGGGSATLSMGQAACRFGLALV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXX 1117
            K L G  DVVE ++V+      PFFA  ++LGKNGVE +L +G L+ +            
Sbjct: 240  KALQGESDVVEYAYVEGEGEYAPFFAQPIKLGKNGVEALLDIGKLSAYEQAALDGMLDTL 299

Query: 1118 XXXXXXGIQF 1147
                  G++F
Sbjct: 300  KGDIQIGVEF 309



>sp|Q7X3X5|MDH_MORS2 Malate dehydrogenase (EC
            1.1.1.37).>gb:AB097559_12710 Moritella sp. 2D2 mdh gene
            for malate dehydrogenase, complete cds.>gb:AB185129_16705
            Moritella sp. 2C2 mdh gene for malate dehydrogenase,
            complete cds.
          Length = 312

 Score =  287 bits (734), Expect = 4e-76
 Identities = 161/288 (55%), Positives = 197/288 (68%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T   + GFSG 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPAGSELSLYDIAPVTPGVAVDLSHIPTDVTITGFSGI 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    AL GADVV+I AGV RKPGM R DLFNINAGI+K+L++  A+ CP A + +I+NP
Sbjct: 62   DPTA-ALVGADVVLISAGVARKPGMDRSDLFNINAGIIKNLASKCAEVCPTACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TVPIAAEV K+AG YD+++LFG+TTLDV+R++TF                IGGH+G 
Sbjct: 121  VNTTVPIAAEVLKQAGVYDKRKLFGITTLDVIRSETFVSALKGISLADVAVPVIGGHSGA 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ       A + I  LT R Q+ GTEVVEAKAG GSATLSM +A A F  + +
Sbjct: 181  TILPLLSQVKGVEFTAEE-IATLTTRIQNAGTEVVEAKAGGGSATLSMGHAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   +VEC++V        FFA  V LGKNGVEEVL  G L+DF
Sbjct: 240  RALQGEKGIVECTYVDGGSEHATFFAQPVLLGKNGVEEVLAYGDLSDF 287



>gb:AE016767_327969 Escherichia coli CFT073 section 13 of 18 of the
            complete genome.>gb:AE014075_958553 Escherichia coli
            CFT073 complete genome.
          Length = 334

 Score =  286 bits (733), Expect = 6e-76
 Identities = 163/313 (52%), Positives = 202/313 (64%), Gaps = 2/313 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG 
Sbjct: 24   KVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG- 82

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            E+   ALEGADVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NP
Sbjct: 83   EDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNP 142

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+
Sbjct: 143  VNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGV 202

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ  P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + +
Sbjct: 203  TILPLLSQ-VPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLV 261

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXX 1117
            + L G   VVEC++V+       FF+  + LGKNGVEE   +G+L+ F            
Sbjct: 262  RALQGEQGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAFEQNALEGMLDTL 321

Query: 1118 XXXXXXGIQFANQ 1156
                  G +F N+
Sbjct: 322  KKDIALGEEFVNK 334



>sp|Q8DEC2|MDH_VIBVU Malate dehydrogenase (EC
            1.1.1.37).>gb:AE016799_335438 Vibrio vulnificus CMCP6
            chromosome I section 3 of 11 of the complete
            sequence.>gb:AE016795_1045162 Vibrio vulnificus CMCP6
            chromosome I complete sequence.
          Length = 310

 Score =  286 bits (733), Expect = 6e-76
 Identities = 163/310 (52%), Positives = 204/310 (65%), Gaps = 2/310 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA++GAAGGIGQ L+LL+K   P  S L+L+DIA  TPGVAAD+SHI T   + G++G+
Sbjct: 2    KVAVIGAAGGIGQALALLLKNRLPAGSDLALYDIAPVTPGVAADLSHIPTHVSIKGYAGE 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    ALEGADVV+I AGV RKPGM R DLFN+NAGIVKSL+  IA  CP+A + +I+NP
Sbjct: 62   DPT-PALEGADVVLISAGVARKPGMDRADLFNVNAGIVKSLAERIAVVCPNACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TVPIAAEV KKAG YD+++LFGVTTLDV+R++TF                IGGH+G+
Sbjct: 121  VNTTVPIAAEVLKKAGVYDKRKLFGVTTLDVIRSETFVAELKGQDPGEVRVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ       + + I  LTKR Q+ GTEVVEAKAG GSATLSM  A   F  A +
Sbjct: 181  TILPLLSQ-VEGVEFSDEEIAALTKRIQNAGTEVVEAKAGGGSATLSMGQAACRFGLALV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXX 1117
            K L G  +V+E ++V+       FFA  V+LGK GVEE+L  G L+DF            
Sbjct: 240  KALQG-EEVIEYAYVEGNGEHASFFAQPVKLGKEGVEEILPYGELSDFEKAALDGMLETL 298

Query: 1118 XXXXXXGIQF 1147
                  G+ F
Sbjct: 299  NSDIQIGVDF 308



>sp|Q83Q04|MDH_SHIFL Malate dehydrogenase (EC
            1.1.1.37).>gb:AE005674_72860 Shigella flexneri 2a str.
            301, complete genome.>gb:AE016989_372997 Shigella
            flexneri 2a str. 2457T section 12 of 16 of the complete
            genome.>gb:AE014073_997747 Shigella flexneri 2a str.
            2457T complete genome.
          Length = 312

 Score =  286 bits (733), Expect = 6e-76
 Identities = 163/313 (52%), Positives = 202/313 (64%), Gaps = 2/313 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG- 60

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            E+   ALEGADVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NP
Sbjct: 61   EDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKNCPKACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ  P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + +
Sbjct: 181  TILPLLSQ-VPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXX 1117
            + L G   VVEC++V+       FF+  + LGKNGVEE   +G+L+ F            
Sbjct: 240  RALQGEQGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAFEQNALEGMLDTL 299

Query: 1118 XXXXXXGIQFANQ 1156
                  G +F N+
Sbjct: 300  KKDIALGKEFVNK 312



>sp|P82177|MDH_SHEON Malate dehydrogenase (EC
            1.1.1.37).>gb:AE015522_315185 Shewanella oneidensis MR-1
            section 71 of 457 of the complete
            genome.>gb:AE014299_950782 Shewanella oneidensis MR-1
            complete genome.
          Length = 311

 Score =  286 bits (733), Expect = 6e-76
 Identities = 163/310 (52%), Positives = 200/310 (64%), Gaps = 2/310 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  E+ GF+G+
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPAGSKLSLYDIAPVTPGVAVDLSHIPTAVEIKGFAGE 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    AL GADVV+I AGV RKPGM R DLFNINAGIV++L   +A  CP ALV +I+NP
Sbjct: 62   DPT-PALVGADVVLISAGVARKPGMDRSDLFNINAGIVRNLIEKVAVTCPKALVGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+ RLFGVTTLDV+R++TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVMKKAGVYDKNRLFGVTTLDVIRSETFIAELKGLNVADVKINVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ       + + +  LTKR Q+ GTEVVEAKAG GSATLSM  A   F  + +
Sbjct: 181  TILPLLSQ-VEGVTFSDEEVASLTKRIQNAGTEVVEAKAGGGSATLSMGQAACRFGMSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXX 1117
            +GL G  +VVEC++V        FFA  V LGKNG+E+VL  G ++ F            
Sbjct: 240  RGLQGEANVVECAYVDGGSEHAEFFAQPVLLGKNGIEKVLPYGEVSAFEANARDSMLDTL 299

Query: 1118 XXXXXXGIQF 1147
                  G+ F
Sbjct: 300  KGDIKLGVDF 309



>sp|P48364|MDH_MORS5 Malate dehydrogenase (EC
            1.1.1.37).>gb:VIBMD_209934 Vibrio sp. No.5710 gene for
            malate dehydrogenase, complete cds.
          Length = 312

 Score =  286 bits (733), Expect = 6e-76
 Identities = 160/288 (55%), Positives = 198/288 (68%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T   + GF+G 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPAGSDLSLYDIAPVTPGVAVDLSHIPTDVTIAGFAGM 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    AL GADVV+I AGV RKPGM R DLFNINAGI+K+L+   A+ CP+A + +I+NP
Sbjct: 62   DPTD-ALVGADVVLISAGVARKPGMDRSDLFNINAGIIKNLAGKCAEVCPNACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TVPIAAEV K+AG YD+++LFG+TTLDV+R++TF                IGGH+G+
Sbjct: 121  VNTTVPIAAEVLKQAGVYDKRKLFGITTLDVIRSETFVSALKGISLADVEVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ       A +V V LT R Q+ GTEVVEAKAG GSATLSM  A A F  + +
Sbjct: 181  TILPLLSQVKGVEFTAEEV-VALTARIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   +VEC++V        FFA  V LGKNGVEEVL  G L++F
Sbjct: 240  RALQGEKGIVECTYVDGGSEHATFFAQPVLLGKNGVEEVLAYGELSEF 287



>sp|P61891|MDH_ECO57 Malate dehydrogenase (EC
            1.1.1.37).>sp|P61890|MDH_ECOL6 Malate dehydrogenase (EC
            1.1.1.37).>sp|P61889|MDH_ECOLI Malate dehydrogenase (EC
            1.1.1.37).>pir|F65115|DEECM malate dehydrogenase (EC
            1.1.1.37) - Escherichia coli  (strain
            K-12)>pir|E91142|E91142 malate dehydrogenase [imported] -
            Escherichia coli (strain O157:H7, substrain RIMD
            0509952)>pir|H85987|H85987 malate dehydrogenase
            [imported] - Escherichia coli (strain O157:H7, substrain
            EDL933)>gb:AE005174_68363 Escherichia coli O157:H7
            EDL933, complete genome.>gb:ECOUW67_130798 Escherichia
            coli K-12 chromosomal region from 67.4 to 76.0
            minutes.>gb:U00096_202245 Escherichia coli K-12 MG1655
            complete genome.>gb:BA000007_662121 Escherichia coli
            O157:H7 DNA, complete genome.
          Length = 312

 Score =  286 bits (733), Expect = 6e-76
 Identities = 163/313 (52%), Positives = 202/313 (64%), Gaps = 2/313 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG- 60

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            E+   ALEGADVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NP
Sbjct: 61   EDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ  P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + +
Sbjct: 181  TILPLLSQ-VPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXX 1117
            + L G   VVEC++V+       FF+  + LGKNGVEE   +G+L+ F            
Sbjct: 240  RALQGEQGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAFEQNALEGMLDTL 299

Query: 1118 XXXXXXGIQFANQ 1156
                  G +F N+
Sbjct: 300  KKDIALGEEFVNK 312



>gb:AY309494_1597888 Triticum aestivum glyoxysomal malate
            dehydrogenase mRNA, partial cds.
          Length = 245

 Score =  286 bits (732), Expect = 7e-76
 Identities = 148/245 (60%), Positives = 172/245 (70%)
 Frame = +2

Query: 422  GADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIA 601
            G D+VIIPAG+PRKPGMTRDDLFN NAGIV+S+   +AK CP+A+VN+ISNPVNSTVPIA
Sbjct: 1    GMDLVIIPAGLPRKPGMTRDDLFNKNAGIVRSICEGVAKSCPNAIVNLISNPVNSTVPIA 60

Query: 602  AEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQ 781
            AEVFK+AGTY  KRL GVTTLDV RA TF                +GGHAG+TILPL SQ
Sbjct: 61   AEVFKRAGTYCPKRLLGVTTLDVARANTFVAEVLGVDPREVNVPVVGGHAGVTILPLLSQ 120

Query: 782  ATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPD 961
             +P  +   D I  LT R Q+GGTEVVEAKAG GSATLSMA+A A FADACL+G+ G   
Sbjct: 121  VSPPCSFTPDEISYLTNRIQNGGTEVVEAKAGAGSATLSMAFAAAKFADACLQGMRGDAG 180

Query: 962  VVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXXXXXXXXGI 1141
            +VECS+V S VTELPFFASKVRLG+ G E++L LG L DF                  G+
Sbjct: 181  IVECSYVASEVTELPFFASKVRLGRGGAEKILPLGPLNDFERAGLEKAKKELSESIEKGV 240

Query: 1142 QFANQ 1156
             F N+
Sbjct: 241  SFMNK 245



>gb:AF293125_496599 Escherichia coli isolate M1379_F4A malate
            dehydrogenase (mdh) and arginine biosynthesis repressor
            (argR) genes, partial cds.
          Length = 292

 Score =  286 bits (732), Expect = 7e-76
 Identities = 160/288 (55%), Positives = 197/288 (68%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG- 60

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            E+   ALEGADVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NP
Sbjct: 61   EDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKNCPKACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ  P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + +
Sbjct: 181  TILPLLSQ-VPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   VVEC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 240  RALQGEQGVVECAYVEGDGQYARFFSQPLLLGKNGVEECKSIGTLSAF 287



>gb:AB185126_16702 Moritella sp. 56A1 mdh gene for malate
            dehydrogenase, complete cds.
          Length = 312

 Score =  286 bits (732), Expect = 7e-76
 Identities = 160/288 (55%), Positives = 197/288 (68%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T   + GFSG 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPAGSELSLYDIAPVTPGVAVDLSHIPTDVTITGFSGT 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    AL GADVV+I AGV RKPGM R DLFNINAGI+K+L++  A+ CP A + +I+NP
Sbjct: 62   DPTA-ALVGADVVLISAGVARKPGMDRSDLFNINAGIIKNLASKCAEVCPTACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TVPIAAEV K+AG YD+++LFG+TTLDV+R++TF                IGGH+G 
Sbjct: 121  VNTTVPIAAEVLKQAGVYDKRKLFGITTLDVIRSETFVSALKGISLADVAVPVIGGHSGA 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ       A + I  LT R Q+ GTEVVEAKAG GSATLSM +A A F  + +
Sbjct: 181  TILPLLSQVKGVEFTAEE-IATLTTRIQNAGTEVVEAKAGGGSATLSMGHAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   +VEC++V        FFA  V LGKNGVEEVL  G L++F
Sbjct: 240  RALQGEKGIVECTYVDGGSEHATFFAQPVLLGKNGVEEVLAYGDLSEF 287



>gb:AF293131_496611 Escherichia coli isolate M1347_B7 malate
            dehydrogenase (mdh) and arginine biosynthesis repressor
            (argR) genes, partial cds.
          Length = 292

 Score =  286 bits (731), Expect = 9e-76
 Identities = 160/288 (55%), Positives = 197/288 (68%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG- 60

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            E+   ALEGADVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NP
Sbjct: 61   EDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQLGEVEVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ  P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + +
Sbjct: 181  TILPLLSQ-VPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   VVEC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 240  RALQGEQGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 287



>gb:AF117862_480369 Vibrio cholerae isolate M548 malate dehydrogenase
            (mdh) gene, complete cds.
          Length = 311

 Score =  286 bits (731), Expect = 9e-76
 Identities = 160/310 (51%), Positives = 204/310 (65%), Gaps = 2/310 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA++GAAGGIGQ L+LL+K   P  S L+L+DIA  TPGVAAD+SHI T   + G++G+
Sbjct: 2    KVAVIGAAGGIGQALALLLKNRLPAGSDLALYDIAPVTPGVAADLSHIPTPVTIKGYAGE 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    ALEGADVV++ AGV RKPGM R DLFN+NAGIVK+L+  IA  CP A V +I+NP
Sbjct: 62   DPT-PALEGADVVLVSAGVARKPGMDRADLFNVNAGIVKALAEKIAVVCPKACVGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TVPIAAEV KKAG YD+++LFGVTTLDV+R++TF                IGGH+G+
Sbjct: 121  VNTTVPIAAEVLKKAGVYDKRKLFGVTTLDVIRSETFVAALKDKDPGQVRVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ     +   + +  LT R Q+ GTEVVEAKAG GSATLSM  A   F  A +
Sbjct: 181  TILPLLSQ-VEGVSFTDEEVAALTNRIQNAGTEVVEAKAGGGSATLSMGQAACRFGLALV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXX 1117
            K L G  DVVE ++V+      PFFA  ++LGKNGVE +L +G L+ +            
Sbjct: 240  KALQGESDVVEYAYVEGEGEYAPFFAQPIKLGKNGVEALLDIGKLSAYEQAALDGMLDTL 299

Query: 1118 XXXXXXGIQF 1147
                  G++F
Sbjct: 300  KGDIQIGVEF 309



>gb:AB187218_16867 Moritella japonica mdh gene for malate
            dehydrogenase, complete cds.
          Length = 312

 Score =  286 bits (731), Expect = 9e-76
 Identities = 159/288 (55%), Positives = 197/288 (68%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T   + GF+G 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPAGSELSLYDIAAVTPGVAVDLSHIPTDVTIAGFAGT 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    AL GADVV+I AGV RKPGM R DLFNINAGI+K+L+   A+ CP+A + +I+NP
Sbjct: 62   DPTD-ALVGADVVLISAGVARKPGMDRSDLFNINAGIIKNLAGKCAEVCPNACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TVPIAAEV K+AG YD+++LFG+TTLDV+R++TF                IGGH+G+
Sbjct: 121  VNTTVPIAAEVLKQAGVYDKRKLFGITTLDVIRSETFVSELKGISLADVEVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ       A + I  LT R Q+ GTEVVEAKAG GSATLSM  A A F  + +
Sbjct: 181  TILPLLSQVKGVEFTAEE-IATLTPRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   +VEC++V        FFA  V LGKNGVEEVL  G L++F
Sbjct: 240  RALQGEEGIVECTYVDGGSEHATFFAQPVLLGKNGVEEVLAYGELSEF 287



>gb:AB185124_16700 Shewanella sp. 33F1 mdh gene for malate
            dehydrogenase, complete cds.>gb:AB185125_16701 Shewanella
            sp. 33H2 mdh gene for malate dehydrogenase, complete cds.
          Length = 311

 Score =  286 bits (731), Expect = 9e-76
 Identities = 160/310 (51%), Positives = 198/310 (63%), Gaps = 2/310 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  EV GF+G 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPAGSKLSLYDIAPVTPGVAVDLSHIPTAVEVKGFAGQ 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    ALEGADVV+I AGV RKPGM R DLFNINAGIV++L    A  CP AL+ +I+NP
Sbjct: 62   DP-SAALEGADVVLISAGVARKPGMDRSDLFNINAGIVRNLMEKCAATCPKALIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV K AG YD+ RLFG+TTLDV+R++TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKAAGVYDKNRLFGITTLDVIRSETFIAEAKGLNVADVKVSVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ     +   + +  +T R Q+ GTEVVEAKAG GSATLSM  A   F  + +
Sbjct: 181  TILPLLSQ-VEGVSFTDEEVAAMTTRIQNAGTEVVEAKAGGGSATLSMGQAACRFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXX 1117
            +GL G  ++VEC++V        FFA  V LGKNGVE+VL  G +++F            
Sbjct: 240  RGLQGEENIVECAYVDGGSEHAEFFAQPVLLGKNGVEKVLAYGDVSEFEANARDAMLDTL 299

Query: 1118 XXXXXXGIQF 1147
                  G+ F
Sbjct: 300  KADITLGVDF 309



>gb:AB185122_16698 Moritella sp. 36C1 mdh gene for malate
            dehydrogenase, complete cds.>gb:AB185123_16699 Moritella
            sp. 36G1 mdh gene for malate dehydrogenase, complete cds.
          Length = 312

 Score =  286 bits (731), Expect = 9e-76
 Identities = 160/288 (55%), Positives = 197/288 (68%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T   + GFSG 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPAGSELSLYDIAPVTPGVAVDLSHIPTDVTITGFSGT 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    AL GADVV+I AGV RKPGM R DLFNINAGI+K+L++  A+ CP A + +I+NP
Sbjct: 62   DPTD-ALVGADVVLISAGVARKPGMDRSDLFNINAGIIKNLASKCAEVCPTACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TVPIAAEV K+AG YD+++LFG+TTLDV+R++TF                IGGH+G 
Sbjct: 121  VNTTVPIAAEVLKQAGVYDKRKLFGITTLDVIRSETFVSALKGISLADVAVPVIGGHSGA 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ       A + I  LT R Q+ GTEVVEAKAG GSATLSM +A A F  + +
Sbjct: 181  TILPLLSQVKGVEFTAEE-IATLTTRIQNAGTEVVEAKAGGGSATLSMGHAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   +VEC++V        FFA  V LGKNGVEEVL  G L++F
Sbjct: 240  RALQGEKGIVECTYVDGGSEHATFFAQPVLLGKNGVEEVLAYGDLSEF 287



>gb:AF293155_496659 Escherichia coli isolate M1354_D7 malate
            dehydrogenase (mdh) and arginine biosynthesis repressor
            (argR) genes, partial cds.
          Length = 292

 Score =  285 bits (730), Expect = 1e-75
 Identities = 160/288 (55%), Positives = 197/288 (68%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG- 60

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            E+   ALEGADVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NP
Sbjct: 61   EDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ  P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + +
Sbjct: 181  TILPLLSQ-VPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGLAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   VVEC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 240  RALQGEQGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 287



>gb:AF293114_496577 Escherichia coli isolate M1362_F1A malate
            dehydrogenase (mdh) and arginine biosynthesis repressor
            (argR) genes, partial cds.>gb:AF293115_496579 Escherichia
            coli isolate M1349_F1B malate dehydrogenase (mdh) and
            arginine biosynthesis repressor (argR) genes, partial
            cds.>gb:AF293116_496581 Escherichia coli isolate
            M1383_F2A malate dehydrogenase (mdh) and arginine
            biosynthesis repressor (argR) genes, partial
            cds.>gb:AF293117_496583 Escherichia coli isolate
            M1342_F2B malate dehydrogenase (mdh) and arginine
            biosynthesis repressor (argR) genes, partial
            cds.>gb:AF293118_496585 Escherichia coli isolate
            M1363_F3A malate dehydrogenase (mdh) and arginine
            biosynthesis repressor (argR) genes, partial
            cds.>gb:AF293119_496587 Escherichia coli isolate
            M1377_F3C malate dehydrogenase (mdh) and arginine
            biosynthesis repressor (argR) genes, partial
            cds.>gb:AF293120_496589 Escherichia coli isolate
            M1361_F4B malate dehydrogenase (mdh) and arginine
            biosynthesis repressor (argR) genes, partial
            cds.>gb:AF293121_496591 Escherichia coli isolate M1376_FX
            malate dehydrogenase (mdh) and arginine biosynthesis
            repressor (argR) genes, partial cds.>gb:AF293122_496593
            Escherichia coli isolate M1370_FY malate dehydrogenase
            (mdh) and arginine biosynthesis repressor (argR) genes,
            partial cds.>gb:AF293123_496595 Escherichia coli isolate
            M1339_B12 malate dehydrogenase (mdh) and arginine
            biosynthesis repressor (argR) genes, partial
            cds.>gb:AF293124_496597 Escherichia coli isolate
            M1366_F3B malate dehydrogenase (mdh) and arginine
            biosynthesis repressor (argR) genes, partial
            cds.>gb:AF293126_496601 Escherichia coli isolate M1356_F5
            malate dehydrogenase (mdh) and arginine biosynthesis
            repressor (argR) genes, partial cds.
          Length = 292

 Score =  285 bits (730), Expect = 1e-75
 Identities = 160/288 (55%), Positives = 197/288 (68%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG- 60

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            E+   ALEGADVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NP
Sbjct: 61   EDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKNCPKACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ  P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + +
Sbjct: 181  TILPLLSQ-VPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   VVEC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 240  RALQGEQGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 287



>gb:AF293106_496562 Escherichia coli isolate M1378_D8 malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF293107_496563
            Escherichia coli isolate ECOR54 malate dehydrogenase
            (mdh) and arginine biosynthesis repressor (argR) genes,
            partial cds.>gb:AF293108_496565 Escherichia coli isolate
            ECOR59 malate dehydrogenase (mdh) and arginine
            biosynthesis repressor (argR) genes, partial
            cds.>gb:AF293109_496567 Escherichia coli isolate
            M1367_D10 malate dehydrogenase (mdh) and arginine
            biosynthesis repressor (argR) genes, partial
            cds.>gb:AF293110_496569 Escherichia coli isolate ECOR40
            malate dehydrogenase (mdh) and arginine biosynthesis
            repressor (argR) genes, partial cds.>gb:AF293111_496571
            Escherichia coli isolate ECOR7 malate dehydrogenase (mdh)
            and arginine biosynthesis repressor (argR) genes, partial
            cds.>gb:AF293112_496573 Escherichia coli isolate
            M1357_B16 malate dehydrogenase (mdh) and arginine
            biosynthesis repressor (argR) genes, partial
            cds.>gb:AF293113_496575 Escherichia coli isolate M1344_B5
            malate dehydrogenase (mdh) and arginine biosynthesis
            repressor (argR) genes, partial cds.>gb:AF293127_496603
            Escherichia coli isolate M1358_B15 malate dehydrogenase
            (mdh) and arginine biosynthesis repressor (argR) genes,
            partial cds.>gb:AF293128_496605 Escherichia coli isolate
            M1353_B17 malate dehydrogenase (mdh) and arginine
            biosynthesis repressor (argR) genes, partial
            cds.>gb:AF293132_496613 Escherichia coli isolate ECOR28
            malate dehydrogenase (mdh) and arginine biosynthesis
            repressor (argR) genes, partial cds.>gb:AF293133_496615
            Escherichia coli isolate ECOR30 malate dehydrogenase
            (mdh) and arginine biosynthesis repressor (argR) genes,
            partial cds.>gb:AF293134_496617 Escherichia coli isolate
            ECOR33 malate dehydrogenase (mdh) and arginine
            biosynthesis repressor (argR) genes, partial
            cds.>gb:AF293135_496619 Escherichia coli isolate M1343_SS
            malate dehydrogenase (mdh) and arginine biosynthesis
            repressor (argR) genes, partial cds.>gb:AF293136_496621
            Escherichia coli isolate M1340_B10 malate dehydrogenase
            (mdh) and arginine biosynthesis repressor (argR) genes,
            partial cds.>gb:AF293137_496623 Escherichia coli isolate
            M1345_B6 malate dehydrogenase (mdh) and arginine
            biosynthesis repressor (argR) genes, partial
            cds.>gb:AF293138_496625 Escherichia coli isolate
            M1359_B14 malate dehydrogenase (mdh) and arginine
            biosynthesis repressor (argR) genes, partial
            cds.>gb:AF293139_496627 Escherichia coli isolate M517_B2
            malate dehydrogenase (mdh) and arginine biosynthesis
            repressor (argR) genes, partial cds.>gb:AF293140_496629
            Escherichia coli isolate M1346_B4 malate dehydrogenase
            (mdh) and arginine biosynthesis repressor (argR) genes,
            partial cds.>gb:AF293141_496631 Escherichia coli isolate
            M1375_F6A malate dehydrogenase (mdh) and arginine
            biosynthesis repressor (argR) genes, partial
            cds.>gb:AF293142_496633 Escherichia coli isolate M1382_F6
            malate dehydrogenase (mdh) and arginine biosynthesis
            repressor (argR) genes, partial cds.>gb:AF293143_496635
            Escherichia coli isolate M1351_B18 malate dehydrogenase
            (mdh) and arginine biosynthesis repressor (argR) genes,
            partial cds.>gb:AF293144_496637 Escherichia coli isolate
            M1352_B1 malate dehydrogenase (mdh) and arginine
            biosynthesis repressor (argR) genes, partial
            cds.>gb:AF293145_496639 Escherichia coli isolate M1348_B3
            malate dehydrogenase (mdh) and arginine biosynthesis
            repressor (argR) genes, partial cds.>gb:AF293146_496641
            Escherichia coli isolate M1341_B8 malate dehydrogenase
            (mdh) and arginine biosynthesis repressor (argR) genes,
            partial cds.>gb:AF293147_496643 Escherichia coli isolate
            M1369_D11 malate dehydrogenase (mdh) and arginine
            biosynthesis repressor (argR) genes, partial
            cds.>gb:AF293148_496645 Escherichia coli isolate
            M1364_D12 malate dehydrogenase (mdh) and arginine
            biosynthesis repressor (argR) genes, partial
            cds.>gb:AF293149_496647 Escherichia coli isolate M1373_D3
            malate dehydrogenase (mdh) and arginine biosynthesis
            repressor (argR) genes, partial cds.>gb:AF293150_496649
            Escherichia coli isolate M1355_D5 malate dehydrogenase
            (mdh) and arginine biosynthesis repressor (argR) genes,
            partial cds.>gb:AF293151_496651 Escherichia coli isolate
            M1380_D9 malate dehydrogenase (mdh) and arginine
            biosynthesis repressor (argR) genes, partial
            cds.>gb:AF293152_496653 Escherichia coli isolate
            M1374_D13 malate dehydrogenase (mdh) and arginine
            biosynthesis repressor (argR) genes, partial
            cds.>gb:AF293153_496655 Escherichia coli isolate M1360_D4
            malate dehydrogenase (mdh) and arginine biosynthesis
            repressor (argR) genes, partial cds.>gb:AF293154_496657
            Escherichia coli isolate M1371_D6 malate dehydrogenase
            (mdh) and arginine biosynthesis repressor (argR) genes,
            partial cds.>gb:AF293158_496665 Escherichia coli isolate
            M1365_B11 malate dehydrogenase (mdh) and arginine
            biosynthesis repressor (argR) genes, partial cds.
          Length = 292

 Score =  285 bits (730), Expect = 1e-75
 Identities = 160/288 (55%), Positives = 197/288 (68%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG- 60

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            E+   ALEGADVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NP
Sbjct: 61   EDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ  P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + +
Sbjct: 181  TILPLLSQ-VPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   VVEC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 240  RALQGEQGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 287



>sp|Q7MP97|MDH_VIBVY Malate dehydrogenase (EC
            1.1.1.37).>gb:BA000037_721293 Vibrio vulnificus YJ016
            DNA, chromosome I, complete sequence.
          Length = 310

 Score =  285 bits (730), Expect = 1e-75
 Identities = 161/288 (55%), Positives = 201/288 (69%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA++GAAGGIGQ L+LL+K   P  S L+L+DIA  TPGVAAD+SHI T   + G++G+
Sbjct: 2    KVAVIGAAGGIGQALALLLKNRLPAGSDLALYDIAPVTPGVAADLSHIPTPVSIKGYAGE 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    ALEGADVV+I AGV RKPGM R DLFN+NAGIVKSL+  IA  CP+A + +I+NP
Sbjct: 62   DPT-PALEGADVVLISAGVARKPGMDRADLFNVNAGIVKSLAERIAVVCPNACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TVPIAAEV KKAG YD+++LFGVTTLDV+R++TF                IGGH+G+
Sbjct: 121  VNTTVPIAAEVLKKAGVYDKRKLFGVTTLDVIRSETFVAELKGQDPGEVRVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ       + + I  LTKR Q+ GTEVVEAKAG GSATLSM  A   F  A +
Sbjct: 181  TILPLLSQ-VEGVEFSDEEIAALTKRIQNAGTEVVEAKAGGGSATLSMGQAACRFGLALV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            K L G  +V+E ++V+       FFA  V+LGK GVEE+L  G L+DF
Sbjct: 240  KALQG-EEVIEYAYVEGNGEHASFFAQPVKLGKEGVEEILPYGELSDF 286



>gb:AF293129_496607 Escherichia coli isolate M1368_B9 malate
            dehydrogenase (mdh) and arginine biosynthesis repressor
            (argR) genes, partial cds.
          Length = 292

 Score =  285 bits (729), Expect = 2e-75
 Identities = 160/288 (55%), Positives = 197/288 (68%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG- 60

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            E+   ALEGADVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NP
Sbjct: 61   EDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKKAGVYDKHKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ  P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + +
Sbjct: 181  TILPLLSQ-VPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   VVEC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 240  RALQGEQGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 287



>gb:AB185118_16694 Moritella sp. 16F1 mdh gene for malate
            dehydrogenase, complete cds.>gb:AB185119_16695 Moritella
            sp. 16H2 mdh gene for malate dehydrogenase, complete cds.
          Length = 312

 Score =  285 bits (729), Expect = 2e-75
 Identities = 159/288 (55%), Positives = 198/288 (68%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T   + GF+G 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPAGSELSLYDIAPVTPGVAVDLSHIPTDVTIAGFAGT 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    AL GADVV+I AGV RKPGM R DLFNINAGI+K+L++  A+ CP A + +I+NP
Sbjct: 62   DPTD-ALIGADVVLISAGVARKPGMDRSDLFNINAGIIKNLASKCAEVCPTACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TVPIAAEV K+AG YD+++LFG+TTLDV+R++TF                IGGH+G+
Sbjct: 121  VNTTVPIAAEVLKQAGVYDKRKLFGITTLDVIRSETFVSALKGIPLADVTVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ       A + I  LT R Q+ GTEVVEAKAG GSATLSM +A A F  + +
Sbjct: 181  TILPLLSQVKGVEFTAEE-IATLTPRIQNAGTEVVEAKAGGGSATLSMGHAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   +VEC++V        FFA  V LGKNGVEEVL  G L++F
Sbjct: 240  RALQGEKGIVECTYVDGGSEHAKFFAQPVLLGKNGVEEVLAYGDLSEF 287



>gb:AB185116_16692 Moritella sp. 47A1 mdh gene for malate
            dehydrogenase, complete cds.
          Length = 312

 Score =  285 bits (728), Expect = 2e-75
 Identities = 159/288 (55%), Positives = 197/288 (68%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T   + GF+G 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPAGSELSLYDIAPVTPGVAVDLSHIPTDVTITGFAGT 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    AL GADVV+I AGV RKPGM R DLFNINAGI+K+L++  A+ CP A + +I+NP
Sbjct: 62   DPTD-ALVGADVVLISAGVARKPGMDRSDLFNINAGIIKNLASKCAEVCPTACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TVPIAAEV K+AG YD+++LFG+TTLDV+R++TF                IGGH+G 
Sbjct: 121  VNTTVPIAAEVLKQAGVYDKRKLFGITTLDVIRSETFVSALKGISLADVAVPVIGGHSGA 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ       A + I  LT R Q+ GTEVVEAKAG GSATLSM +A A F  + +
Sbjct: 181  TILPLLSQVKGVEFTAEE-IATLTTRIQNAGTEVVEAKAGGGSATLSMGHAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   +VEC++V        FFA  V LGKNGVEEVL  G L++F
Sbjct: 240  RALQGEKGIVECTYVDGGSEHATFFAQPVLLGKNGVEEVLAYGDLSEF 287



>sp|P61892|MDH_YERPE Malate dehydrogenase (EC
            1.1.1.37).>sp|P61893|MDH_YERPS Malate dehydrogenase (EC
            1.1.1.37).>pir|AE0427|AE0427 malate dehydrogenase
            [imported] - Yersinia pestis (strain
            CO92)>gb:AE013669_298998 Yersinia pestis KIM section 69
            of 415 of the complete genome.>gb:AE017129_386414
            Yersinia pestis biovar Medievalis str. 91001 section 3 of
            16 of the complete genome.>gb:AF282309_495399 Yersinia
            pestis malate dehydrogenase (mdh) gene, complete
            cds.>gb:AF282310_495400 Yersinia pseudotuberculosis
            malate dehydrogenase (mdh) gene, complete
            cds.>gb:AJ414157_525274 Yersinia pestis strain CO92
            complete genome; segment 17/20.>gb:BX936398_835105
            Yersinia pseudotuberculosis IP32953 genome, complete
            sequence.>gb:AE009952_929181 Yersinia pestis KIM complete
            genome.>gb:AE017042_1142980 Yersinia pestis biovar
            Medievalis str. 91001 complete genome.
          Length = 312

 Score =  284 bits (727), Expect = 3e-75
 Identities = 162/313 (51%), Positives = 201/313 (64%), Gaps = 2/313 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T   + GFSG 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPSGSDLSLYDIAPVTPGVAVDLSHIPTAVNIKGFSG- 60

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            E+   AL+GAD+V+I AGV RKPGM R DLFN+NAGIV++L   IA+ CP+AL+ +I+NP
Sbjct: 61   EDATPALQGADIVLISAGVARKPGMDRSDLFNVNAGIVRNLVEQIARTCPNALIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+ +LFG+TTLD +R+ TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKKAGVYDKNKLFGITTLDTIRSNTFVAELKGKQPQDIEVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ  P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + +
Sbjct: 181  TILPLLSQ-IPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXX 1117
            + L G  +VVECS+V+       FFA  + LGKNGV E   +G L+ F            
Sbjct: 240  RALQGESNVVECSYVEGDGKYARFFAQPILLGKNGVAERKDIGKLSAFEQQALENMLDVL 299

Query: 1118 XXXXXXGIQFANQ 1156
                  G +F NQ
Sbjct: 300  HKDIELGEKFVNQ 312



>gb:AF293157_496663 Escherichia coli isolate ECOR37 malate
            dehydrogenase (mdh) and arginine biosynthesis repressor
            (argR) genes, partial cds.
          Length = 292

 Score =  284 bits (726), Expect = 4e-75
 Identities = 159/288 (55%), Positives = 196/288 (68%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG- 60

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            E+   ALEGADVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NP
Sbjct: 61   EDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ  P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A   F  + +
Sbjct: 181  TILPLLSQ-VPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAATRFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   VVEC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 240  RALQGEQGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 287



>gb:AF293105_496561 Escherichia coli isolate M1350_B13 malate
            dehydrogenase (mdh) gene, partial cds.
          Length = 292

 Score =  284 bits (726), Expect = 4e-75
 Identities = 159/288 (55%), Positives = 197/288 (68%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI +  ++ GFSG 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPSAVKIKGFSG- 60

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            E+   ALEGADVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NP
Sbjct: 61   EDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGDVEVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ  P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + +
Sbjct: 181  TILPLLSQ-VPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   VVEC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 240  RALQGEKGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 287



>gb:ECMDH1_126604 E. coli mdh gene for malate dehydrogenase.
          Length = 312

 Score =  284 bits (726), Expect = 4e-75
 Identities = 162/313 (51%), Positives = 201/313 (64%), Gaps = 2/313 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG- 60

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            E+   ALEGADVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NP
Sbjct: 61   EDATPALEGADVVLISAGVRRKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+ +L GVTTLD++R+ TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKKAGVYDKNKLLGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ  P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + +
Sbjct: 181  TILPLLSQ-VPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXX 1117
            + L G   VVEC++V+       FF+  + LGKNGVEE   +G+L+ F            
Sbjct: 240  RALQGEQGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAFEQNALEGMLDTL 299

Query: 1118 XXXXXXGIQFANQ 1156
                  G +F N+
Sbjct: 300  KKDIALGQEFVNK 312



>gb:AB187216_16865 Moritella marina mdh gene for malate dehydrogenase,
            complete cds.
          Length = 312

 Score =  284 bits (726), Expect = 4e-75
 Identities = 159/288 (55%), Positives = 197/288 (68%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T   + GF+G 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPAGSDLSLYDIAPVTPGVAVDLSHIPTDVTIAGFAGM 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    AL GADVV+I AGV RKPGM R DLFNINAGI+K+L+   A+ CP+A + +I+NP
Sbjct: 62   DPTD-ALVGADVVLISAGVARKPGMDRSDLFNINAGIIKNLAGKCAEVCPNACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TVPIAAEV K+AG YD+++LFG+TTLDV+R++TF                IGGH+G+
Sbjct: 121  VNTTVPIAAEVLKQAGVYDKRKLFGITTLDVIRSETFVSELKGISLADVEVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ       A + I  LT R Q+ GTEVVEAKAG GSATLSM  A A F  + +
Sbjct: 181  TILPLLSQVKGVEFTAEE-IATLTPRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   +VEC++V        FFA  V LGKNGVEEVL  G L++F
Sbjct: 240  RALQGEEGIVECTYVDGGSEHATFFAQPVLLGKNGVEEVLAYGELSEF 287



>sp|Q7WS85|MDH_SALPA Malate dehydrogenase (EC
            1.1.1.37).>sp|Q8Z3E0|MDH_SALTI Malate dehydrogenase (EC
            1.1.1.37).>pir|AD0910|AD0910 malate dehydrogenase
            [imported] - Salmonella enterica subsp. enterica serovar
            Typhi (strain CT18)>gb:AE016845_347265 Salmonella
            enterica subsp. enterica serovar Typhi Ty2, section 12 of
            16 of the complete genome.>gb:AL627278_543596 Salmonella
            enterica serovar Typhi (Salmonella typhi) strain CT18,
            complete chromosome; segment 14/20.>gb:AY320468_609241
            Salmonella paratyphi strain ZJ-32 malate dehydrogenase
            (mdh) gene, complete cds.>gb:AY320469_609242 Salmonella
            paratyphi strain ZJ-60 malate dehydrogenase (mdh) gene,
            complete cds.>gb:AE014613_984597 Salmonella enterica
            subsp. enterica serovar Typhi Ty2, complete genome.
          Length = 312

 Score =  284 bits (726), Expect = 4e-75
 Identities = 162/288 (56%), Positives = 196/288 (68%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG 
Sbjct: 2    KVAVLGAAGGIGQALALLLKNQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG- 60

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            E+   ALEGADVV+I AGV RKPGM R DLFN+NAGIVK+L   IAK CP A V +I+NP
Sbjct: 61   EDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKLPTEVEVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ  P  +        LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + +
Sbjct: 181  TILPLLSQ-IPGVSFTEQEAAELTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   VVEC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 240  RALQGEKGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSTF 287



>sp|P25077|MDH_SALTY Malate dehydrogenase (EC
            1.1.1.37).>gb:CP000026_77933 Salmonella enterica subsp.
            enterica serovar Paratypi A str. ATCC
            9150.>gb:AE008854_245000 Salmonella typhimurium LT2,
            section 158 of 220 of the complete
            genome.>gb:AE006468_1002082 Salmonella typhimurium LT2,
            complete genome.
          Length = 312

 Score =  283 bits (725), Expect = 5e-75
 Identities = 162/288 (56%), Positives = 196/288 (68%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG 
Sbjct: 2    KVAVLGAAGGIGQALALLLKNQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG- 60

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            E+   ALEGADVV+I AGV RKPGM R DLFN+NAGIVK+L   IAK CP A V +I+NP
Sbjct: 61   EDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKLPTEVEVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ  P  +        LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + +
Sbjct: 181  TILPLLSQ-IPGVSFTEQEAAELTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   VVEC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 240  RALQGEKGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 287



>gb:AF293130_496609 Escherichia coli isolate M1381_D2 malate
            dehydrogenase (mdh) and arginine biosynthesis repressor
            (argR) genes, partial cds.
          Length = 292

 Score =  282 bits (722), Expect = 1e-74
 Identities = 159/288 (55%), Positives = 196/288 (68%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG- 60

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            E+   ALEGADVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NP
Sbjct: 61   EDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ     +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + +
Sbjct: 181  TILPLLSQVL-GVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   VVEC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 240  RALQGEQGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 287



>gb:AB185120_16696 Shewanella sp. T4609 mdh gene for malate
            dehydrogenase, complete cds.
          Length = 311

 Score =  282 bits (722), Expect = 1e-74
 Identities = 160/310 (51%), Positives = 199/310 (64%), Gaps = 2/310 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KV +LGAAGGIGQ L+LL+K   P+ S LSL+DIA  TPGVA D+SHI T  EV GF+G 
Sbjct: 2    KVCVLGAAGGIGQALALLLKTQLPVGSKLSLYDIAPVTPGVAVDLSHIPTDVEVEGFAGQ 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    ALEGADVV+I AGV RKPGM R DLFNINAGIV++L    A   P AL+ +I+NP
Sbjct: 62   DPTA-ALEGADVVLISAGVARKPGMDRSDLFNINAGIVRNLVEKCAATSPKALIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+ RLFG+TTLDV+R++TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKKAGVYDKNRLFGITTLDVLRSETFIAEAKGVKVADVKVNVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ     + + +    +TKR Q+ GTEVVEAKAG GSATLSM  A   F  + +
Sbjct: 181  TILPLLSQ-VEGVSFSEEEAAAMTKRIQNAGTEVVEAKAGGGSATLSMGQAACRFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXX 1117
            +GL G  +V+EC+++        FFA  V LGKNGVE+VL  G L++F            
Sbjct: 240  RGLQGESNVIECAYIDGGSEHAAFFAQPVLLGKNGVEKVLPYGKLSEFEVNARDAMLDTL 299

Query: 1118 XXXXXXGIQF 1147
                  G+ F
Sbjct: 300  KADIKLGVDF 309



>gb:ECOMDHA_129391 E. coli mdh gene encoding malate dehydrogenase,
            complete cds.
          Length = 313

 Score =  282 bits (721), Expect = 1e-74
 Identities = 159/288 (55%), Positives = 195/288 (67%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG- 60

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            E+   ALEG DVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A +  I+NP
Sbjct: 61   EDATPALEGRDVVLISAGVRRKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGNITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ  P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + +
Sbjct: 181  TILPLLSQ-VPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   VVEC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 240  RALQGEQGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 287



>gb:AE016827_342895 Mannheimia succiniciproducens MBEL55E, complete
            genome.
          Length = 312

 Score =  281 bits (720), Expect = 2e-74
 Identities = 160/288 (55%), Positives = 199/288 (69%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+KL  P  S LSL+D+A  TPGVA D+SHI T   V GF+G 
Sbjct: 2    KVAVLGAAGGIGQALALLLKLQLPAGSSLSLYDVAPVTPGVAKDLSHIPTDVVVEGFAGT 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +   +AL+GAD+V+I AGV RKPGMTR DLF +NAGI++SL+  +A+ CP A V +I+NP
Sbjct: 62   DP-SEALKGADIVLISAGVARKPGMTRADLFGVNAGIIRSLTEKVAEQCPKACVGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+ V IAAEV KKAG YD+++LFG+TTLD++RA+TF                IGGH+G+
Sbjct: 121  VNAMVAIAAEVLKKAGVYDKRKLFGITTLDILRAETFIAELKGLDPTRVTIPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ       + + I+ LT R Q+ GTEVVEAKAG GSATLSMA A A FA A +
Sbjct: 181  TILPLLSQVQNVEWSSEEEIIALTHRIQNAGTEVVEAKAGGGSATLSMAQAAARFALALV 240

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            K   G   VVEC++V+       FFA  VRLG  GVEE L LG L+ F
Sbjct: 241  KASQGA-KVVECAYVEGDGKYARFFAQPVRLGTEGVEEYLTLGKLSAF 287



>gb:AB185117_16693 Moritella sp. 47B1 mdh gene for malate
            dehydrogenase, complete cds.
          Length = 312

 Score =  281 bits (720), Expect = 2e-74
 Identities = 158/288 (54%), Positives = 196/288 (68%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T   + GF+G 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPAGSELSLYDIAPVTPGVAVDLSHIPTDVTITGFAGT 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    AL GADVV+I AGV RKPGM R DLFNINAGI+K+L++  A+ CP A + +I+NP
Sbjct: 62   DPTD-ALVGADVVLISAGVARKPGMDRSDLFNINAGIIKNLASKCAEVCPTACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TVPIAAEV K+AG YD+++LFG+TTLDV+R++TF                IGGH+G 
Sbjct: 121  VNTTVPIAAEVLKQAGVYDKRKLFGITTLDVIRSETFVSALKGISLADVAVPVIGGHSGA 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ       A + I  LT R Q+ GTEVVEAKAG GSATLSM +A A F  + +
Sbjct: 181  TILPLLSQVKGVEFTAEE-IATLTTRIQNAGTEVVEAKAGGGSATLSMGHAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   +VEC++V         FA  V LGKNGVEEVL  G L++F
Sbjct: 240  RALQGEKGIVECTYVDGGSEHATSFAQPVLLGKNGVEEVLAYGDLSEF 287



>gb:AF293156_496661 Escherichia coli isolate M1372_D1 malate
            dehydrogenase (mdh) and arginine biosynthesis repressor
            (argR) genes, partial cds.
          Length = 292

 Score =  280 bits (717), Expect = 4e-74
 Identities = 158/288 (54%), Positives = 196/288 (68%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG- 60

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            E+   ALEGADVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NP
Sbjct: 61   EDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ     +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + +
Sbjct: 181  TILPLLSQVL-GVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   VVEC++V+       FF+  + LGK+GVEE   +G+L+ F
Sbjct: 240  RALQGEQGVVECAYVEGDGQYARFFSQPLLLGKSGVEERKSIGTLSAF 287



>gb:CP000020_870452 Vibrio fischeri ES114 chromosome I, complete
            sequence.
          Length = 311

 Score =  280 bits (716), Expect = 5e-74
 Identities = 160/288 (55%), Positives = 195/288 (67%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA++GAAGGIGQ L+LL+K   P  S L+L+DIA  TPGVAAD+SHI T   + G+ G+
Sbjct: 2    KVAVIGAAGGIGQALALLLKNRLPAGSDLALYDIAPVTPGVAADLSHIPTPVSIKGYCGE 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    ALEGADVV+I AGV RKPGM R DLFNINAGIVKSL+  IA  CP A + +I+NP
Sbjct: 62   DPT-PALEGADVVLISAGVARKPGMDRSDLFNINAGIVKSLTEKIAVTCPKACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+ +LFGVTTLDV+R++TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKKAGVYDKNKLFGVTTLDVIRSETFVAELKDKDPGEIRVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ       A +V   LT R Q+ GTEVVEAKAG GSATLSM  A   F  + +
Sbjct: 181  TILPLLSQVQGVEFTAEEV-AALTPRIQNAGTEVVEAKAGGGSATLSMGQAACRFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            K L+G   VVEC++V+       FFA  + LGKNGVEE+   G L+ F
Sbjct: 240  KALSGEEGVVECAYVEGNGEHARFFAQPILLGKNGVEEIQSYGELSAF 287



>pir|S16143|DEEBM malate dehydrogenase (EC 1.1.1.37) - Salmonella
            typhimurium>gb:STMDHG_192817 S.typhimurium mdh gene for
            malate dehydrogenase.>gb:STYLT2MDH_194421 Salmonella
            typhimurium malate dehydrogenase (MDH) gene, complete
            cds.
          Length = 312

 Score =  279 bits (714), Expect = 9e-74
 Identities = 160/288 (55%), Positives = 194/288 (67%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+L AAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG 
Sbjct: 2    KVAVLAAAGGIGQALALLLKNQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG- 60

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            E+   ALEGADVV+I AGV RKPGM R DLFN+NAGIVK+L   IAK CP A V +I+NP
Sbjct: 61   EDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+ +LFGVTTLD++R+  F                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNPFVAELKGKLPTEVEVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ  P  +        LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + +
Sbjct: 181  TILPLLSQ-IPGVSFTEQEAAELTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGVSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   VVEC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 240  RALQGEKGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 287



>gb:AY320470_609243 Salmonella paratyphi strain ZJ-74 malate
            dehydrogenase (mdh) gene, complete cds.
          Length = 312

 Score =  279 bits (713), Expect = 1e-73
 Identities = 160/288 (55%), Positives = 194/288 (67%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG 
Sbjct: 2    KVAVLGAAGGIGQALALLLKNQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG- 60

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            E+   ALEGADVV+I AGV RKPGM R DLFN+NAGIVK+L   IAK CP A V +I+NP
Sbjct: 61   EDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKLPTEVEVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
             ILPL  Q  P  +        LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + +
Sbjct: 181  KILPLLLQ-IPGVSFTEQEAAELTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   VVEC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 240  RALQGEKGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 287



>sp|P37226|MDH_PHOPR Malate dehydrogenase (EC
            1.1.1.37).>gb:CR378664_93800 Photobacterium profundum
            SS9; segment 2/12.
          Length = 312

 Score =  277 bits (708), Expect = 4e-73
 Identities = 158/311 (50%), Positives = 199/311 (63%), Gaps = 2/311 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA++GAAGGIGQ L+LL+K   P  S L+L+DIA  TPGVAAD+SHI T   + G+ G 
Sbjct: 2    KVAVIGAAGGIGQALALLLKNGLPAGSDLALYDIAPVTPGVAADLSHIPTPVSIKGYGGV 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    ALEGADVV+I AGV RKPGM R DLFN+NAGI+KSL+  IA  CP A V +I+NP
Sbjct: 62   DPT-PALEGADVVLISAGVARKPGMDRSDLFNVNAGIIKSLAEKIAVVCPKACVGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAA+V KKAG YD++RLFG+TTLD++R++TF                IGGH+G+
Sbjct: 121  VNTTVAIAADVLKKAGVYDKRRLFGITTLDIIRSETFVAELKGKTPSDIQVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ       + + I  LT R Q+ GTEVVEAKAG GSATLSM  A   F  + +
Sbjct: 181  TILPLLSQ-VEGVEFSDEEIKALTPRIQNAGTEVVEAKAGGGSATLSMGQAAYRFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXX 1117
            + L G   +VEC++V+       FFA  V LGK+GVEEV+  G L+ F            
Sbjct: 240  RALQGEQGIVECAYVEGDGKHARFFAQPVLLGKDGVEEVIDYGKLSTFEQEALNNMLDTL 299

Query: 1118 XXXXXXGIQFA 1150
                  G +FA
Sbjct: 300  TSDITLGEEFA 310



>gb:AY089402_1297058 Drosophila melanogaster AT22817 full insert cDNA.
          Length = 347

 Score =  276 bits (707), Expect = 6e-73
 Identities = 146/287 (50%), Positives = 188/287 (65%), Gaps = 2/287 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN 403
            KVA++G+ GGIGQPLSLL+K NP +S LSL+DI  T GV  D+SHINTR+ V  F G   
Sbjct: 29   KVAVVGSVGGIGQPLSLLLKHNPQISTLSLYDIKNTTGVGVDLSHINTRASVCPFEGKNG 88

Query: 404  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN 583
            L KA++ AD+V+IPAG+PRKPGM R+DL ++NA +   ++ A ++ CP A++  I+NP+N
Sbjct: 89   LKKAMDKADIVVIPAGLPRKPGMKREDLVDVNASVACEVAFAASEVCPGAMLAFITNPIN 148

Query: 584  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITI 763
              VPI A + K  GTYD  RLFGVTTLDVVRA+TF                IGGH G TI
Sbjct: 149  VIVPIVATILKAKGTYDPNRLFGVTTLDVVRAQTFVADILNVDPQKVNIPVIGGHTGRTI 208

Query: 764  LPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKG 943
            LP+ SQ  P           L +R Q+ GTEVV AK G GSATLSMA+A   F ++ +KG
Sbjct: 209  LPILSQCDPPFKGTDKEREALIQRIQNAGTEVVNAKDGLGSATLSMAFAATQFVNSLIKG 268

Query: 944  LNGVPD--VVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTD 1078
            + G  D  +VEC++V+S VTE  FFA+ + LG  GV+E  GL  L D
Sbjct: 269  IKGSKDECIVECAYVESDVTEAQFFATPLILGPQGVKENTGLPDLDD 315



>gb:AY075238_1296086 Drosophila melanogaster AT19883 full length cDNA.
          Length = 349

 Score =  276 bits (707), Expect = 6e-73
 Identities = 145/309 (46%), Positives = 193/309 (62%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN 403
            KVA++GA GGIGQPLSLL++  P +  L+L D++   G+A D+SHI+   +V+GF+G++ 
Sbjct: 24   KVAVVGAGGGIGQPLSLLLRRCPGIDELALHDLSEMKGIATDLSHISQTGKVIGFTGEKE 83

Query: 404  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN 583
            L  A+ GADVV++ AG+PR PGM RD L   N  +   ++ AI+   P A +  I+NPVN
Sbjct: 84   LESAVSGADVVVVAAGMPRLPGMQRDHLMAANGNVAVKVATAISNASPRAHLAFITNPVN 143

Query: 584  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITI 763
              VP AAEV    GT+D +RLFG+TTLDVVR+K F                IGGHAGITI
Sbjct: 144  MIVPAAAEVLMAHGTFDSRRLFGITTLDVVRSKKFIGDSMNISPDDVNIPVIGGHAGITI 203

Query: 764  LPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKG 943
            LPL SQ  P        I  LT R Q+ GTEVV AKAGKGSATLSMAYAGA F ++ L+G
Sbjct: 204  LPLISQCQPIYRCDLQEIQNLTHRIQEAGTEVVNAKAGKGSATLSMAYAGATFVNSLLRG 263

Query: 944  LNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXXXX 1123
            + G   ++EC+FV S +T+ PFFAS + LGK+G++  + L  ++D+              
Sbjct: 264  IAGQDGLIECAFVASKLTDAPFFASPLELGKDGIKRYIPLPQMSDYEKEALEKLLPILRQ 323

Query: 1124 XXXXGIQFA 1150
                GI FA
Sbjct: 324  NADEGINFA 332



>gb:AE014296_1136088 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003539_1214584 Drosophila melanogaster
            chromosome 3L, section 46 of 83 of the complete sequence.
          Length = 347

 Score =  276 bits (706), Expect = 7e-73
 Identities = 146/287 (50%), Positives = 187/287 (65%), Gaps = 2/287 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN 403
            KVA++G+ GGIGQPLSLL+K NP +S LSL+DI  T GV  D+SHINTR+ V  F G   
Sbjct: 29   KVAVVGSVGGIGQPLSLLLKHNPQISTLSLYDIKNTTGVGVDLSHINTRASVCPFEGKNG 88

Query: 404  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN 583
            L KA++ AD+V+IPAG+PRKPGM R+DL ++NA +   ++ A ++ CP A++  I+NP+N
Sbjct: 89   LKKAMDKADIVVIPAGLPRKPGMKREDLVDVNASVACEVAFAASEVCPGAMLAFITNPIN 148

Query: 584  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITI 763
              VPI A + K  GTYD  RLFGVTTLDVVRA+TF                IGGH G TI
Sbjct: 149  VIVPIVATILKAKGTYDPNRLFGVTTLDVVRAQTFVADILNVDPQKVNIPVIGGHTGRTI 208

Query: 764  LPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKG 943
            LP+ SQ  P           L +R Q+ GTEVV AK G GSATLSMA+A   F  + +KG
Sbjct: 209  LPILSQCDPPFKGTDKEREALIQRIQNAGTEVVNAKDGLGSATLSMAFAATQFVSSLIKG 268

Query: 944  LNGVPD--VVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTD 1078
            + G  D  +VEC++V+S VTE  FFA+ + LG  GV+E  GL  L D
Sbjct: 269  IKGSKDECIVECAYVESDVTEAQFFATPLILGPQGVKENTGLPDLDD 315



>gb:AE014296_1136087 Drosophila melanogaster chromosome 3L, complete
            sequence.>gb:AE003539_1214583 Drosophila melanogaster
            chromosome 3L, section 46 of 83 of the complete sequence.
          Length = 349

 Score =  276 bits (706), Expect = 7e-73
 Identities = 144/309 (46%), Positives = 193/309 (62%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN 403
            KVA++GA GGIGQPLSLL++  P +  L+L D++   G+A D+SHI+   +V+GF+G++ 
Sbjct: 24   KVAVVGAGGGIGQPLSLLLRRCPGIDELALHDLSEMKGIATDLSHISQTGKVIGFTGEKE 83

Query: 404  LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN 583
            L  A+ GADVV++ AG+PR PGM RD L   N  +   ++ AI+   P A +  I+NPVN
Sbjct: 84   LESAVSGADVVVVAAGMPRLPGMQRDHLMAANGNVAVKVATAISNASPRAHLAFITNPVN 143

Query: 584  STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITI 763
              VP AAEV    GT+D +RLFG+TTLDVVR+K F                IGGHAGITI
Sbjct: 144  MIVPAAAEVLMAHGTFDSRRLFGITTLDVVRSKKFIGDSMNISPDDVNIPVIGGHAGITI 203

Query: 764  LPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKG 943
            LPL SQ  P        I  LT R Q+ GTEVV AKAGKGSATLSMAYAGA F ++ L+G
Sbjct: 204  LPLISQCQPIYRCDLQEIQNLTHRIQEAGTEVVNAKAGKGSATLSMAYAGATFVNSLLRG 263

Query: 944  LNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXXXX 1123
            + G   ++EC+FV S +T+ PFFAS + LGK+G++  + L  ++D+              
Sbjct: 264  IAGQDGLIECAFVASKLTDAPFFASPLELGKDGIKRYIPLPQMSDYEKEALEKLLPILRQ 323

Query: 1124 XXXXGIQFA 1150
                G+ FA
Sbjct: 324  NADEGVNFA 332



>gb:PHRMALATE_158448 Photobacterium SS9 malate dehydrogenase (mdh)
            gene, complete cds.
          Length = 312

 Score =  275 bits (703), Expect = 2e-72
 Identities = 157/311 (50%), Positives = 198/311 (63%), Gaps = 2/311 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA++GAAGGIGQ L+LL+K   P  S L+L+DIA  TPGVAAD+SHI T   + G+ G 
Sbjct: 2    KVAVIGAAGGIGQALALLLKNGLPAGSDLALYDIAPVTPGVAADLSHIPTPVSIKGYGGV 61

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            +    ALEGADVV+I AGV RKPGM R DLFN+NAGI+KSL+  IA  CP A V +I+NP
Sbjct: 62   DPT-PALEGADVVLISAGVARKPGMDRSDLFNVNAGIIKSLAEKIAVVCPKACVGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAA+V KKAG YD++RLFG+TTLD++R++TF                IGGH+G+
Sbjct: 121  VNTTVAIAADVLKKAGVYDKRRLFGITTLDIIRSETFVAELKGKTPSELQVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ       + + I  LT R Q+ GTEVVEAK G GSATLSM  A   F  + +
Sbjct: 181  TILPLLSQ-VEGVEFSDEEIKALTPRIQNAGTEVVEAKRGGGSATLSMGQAAYRFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXXXXXXXXXXXX 1117
            + L G   +VEC++V+       FFA  V LGK+GVEEV+  G L+ F            
Sbjct: 240  RALQGQQGIVECAYVEGDGKHARFFAQPVLLGKDGVEEVIDYGKLSTFEQEALNNMLDTL 299

Query: 1118 XXXXXXGIQFA 1150
                  G +FA
Sbjct: 300  TSDITLGEEFA 310



>gb:BX950851_839436 Erwinia carotovora subsp. atroseptica SCRI1043,
            complete genome.
          Length = 311

 Score =  275 bits (702), Expect = 2e-72
 Identities = 155/288 (53%), Positives = 196/288 (68%), Gaps = 2/288 (0%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KVA+LGAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ G+SG 
Sbjct: 2    KVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGYSG- 60

Query: 398  ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNP 577
            E+   AL GAD+V+I AGV RKPGM R DLFN+NAGIV++L   IA  CP A + +I+NP
Sbjct: 61   EDAKPALAGADIVLISAGVARKPGMDRSDLFNVNAGIVRNLVEQIAITCPKACIGIITNP 120

Query: 578  VNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGI 757
            VN+TV IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+
Sbjct: 121  VNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPQDINVPVIGGHSGV 180

Query: 758  TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
            TILPL SQ +   + +   +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + +
Sbjct: 181  TILPLLSQVS-GISFSEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLV 239

Query: 938  KGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            + L G   VVEC++V+S      FFA  + LGK+GV E   +G+L+ F
Sbjct: 240  RALQGENGVVECAYVESDGKHARFFAQPILLGKDGVAERKDIGTLSAF 287



>gb:AE017347_1757951 Cryptococcus neoformans var. neoformans JEC21
            chromosome 7, complete sequence.
          Length = 336

 Score =  270 bits (691), Expect = 4e-71
 Identities = 158/307 (51%), Positives = 196/307 (63%), Gaps = 22/307 (7%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN 403
            K  + GAAGGIGQPLSLL+KLNPL++ LSL+D+   PGVAAD+SHI T ++V GF   +N
Sbjct: 3    KAVVCGAAGGIGQPLSLLLKLNPLITELSLYDVVNAPGVAADLSHIATPAQVAGFLPPDN 62

Query: 404  -LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV 580
               KAL+GAD+V+IPAGVPRKPGMTRDDLFNINAGI  +L+ +IA  CP A + +ISNPV
Sbjct: 63   GAEKALKGADIVVIPAGVPRKPGMTRDDLFNINAGICATLAQSIANACPEAFILVISNPV 122

Query: 581  NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXX--XXXXXXXXXXIGGHAG 754
            NSTVP+ AE  KKAG ++ K+LFGV+ LDVVRA TF                  +GGH+G
Sbjct: 123  NSTVPVFAETLKKAGVFNPKKLFGVSHLDVVRASTFVASVLGKPKDAANYSVPVVGGHSG 182

Query: 755  ITILPLFSQATPQ-ANLAHDVIV--GLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFA 925
             TILPL SQA P  A +  D      L  R Q GG EVV+AK G GSATLSMA AGA FA
Sbjct: 183  ATILPLLSQAKPAIAEVLSDKEKRDALVHRIQFGGDEVVKAKDGAGSATLSMAQAGAEFA 242

Query: 926  DACLKGLNGVPDVVECSFVQSTV----------------TELPFFASKVRLGKNGVEEVL 1057
            +  L+   G     +   VQS V                 +L +F+  V LG NG+E++L
Sbjct: 243  EFVLQAAYGSQ---KGKVVQSYVFLGADAGGNEVKKEISADLDYFSVNVELGPNGIEKIL 299

Query: 1058 GLGSLTD 1078
             +G + D
Sbjct: 300  PIGKIDD 306



>sp|Q59838|MDH_SALMU Malate dehydrogenase (EC 1.1.1.37)
            (Fragment).>gb:SEU04762_182266 Salmonella enterica
            Muenchen malate dehydrogenase (mdh) gene, partial cds.
          Length = 283

 Score =  269 bits (688), Expect = 9e-71
 Identities = 154/278 (55%), Positives = 188/278 (67%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E++  ALEGA
Sbjct: 1    IGQALALLLKNQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDVTPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   IAK CP A V +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKLPTEVEVPVIGGHSGVTILPLLSQ-I 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +        LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G  DVV
Sbjct: 179  PGVSFTEQEAAELTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEKDVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:CR382131_1664044 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 331

 Score =  269 bits (687), Expect = 1e-70
 Identities = 141/255 (55%), Positives = 181/255 (70%), Gaps = 2/255 (0%)
 Frame = +2

Query: 224 KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGF-SGDE 400
           K  + GAAGGIGQPLSLL+KL+P V+ L+L+D+  +PGVAAD+SHI+T+++V G+   D+
Sbjct: 3   KAVVAGAAGGIGQPLSLLLKLSPYVTELALYDVVNSPGVAADLSHISTKAKVTGYLPKDD 62

Query: 401 NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPV 580
            L  AL GA++V+IPAG+PRKPGMTRDDLF INAGIV+ L   +A+Y P A V +ISNPV
Sbjct: 63  GLKNALTGANIVVIPAGIPRKPGMTRDDLFKINAGIVRDLVTGVAQYAPDAFVLIISNPV 122

Query: 581 NSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXX-XXXXXXXIGGHAGI 757
           NSTVPIAAEV KK   ++ K+LFGVTTLDVVRA+TF                 +GGH+G 
Sbjct: 123 NSTVPIAAEVLKKHNVFNPKKLFGVTTLDVVRAQTFTAAVVGESDPTKLNIPVVGGHSGD 182

Query: 758 TILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACL 937
           TI+PL S   P+  +  D +  L KR Q GG EVV+AK G GSATLSMA AG  FA+A L
Sbjct: 183 TIVPLLSLTKPKVEIPADKLDDLVKRIQFGGDEVVQAKDGLGSATLSMAQAGFRFAEAVL 242

Query: 938 KGLNGVPDVVECSFV 982
           KG  G   ++E +++
Sbjct: 243 KGAAGEKGIIEPAYI 257



>gb:AF091759_478529 Escherichia coli isolate RL012A malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF091772_478542
            Escherichia coli isolate RT104 malate dehydrogenase (mdh)
            gene, partial cds.>gb:AF091773_478543 Escherichia coli
            isolate RT174 malate dehydrogenase (mdh) gene, partial
            cds.
          Length = 288

 Score =  268 bits (684), Expect = 3e-70
 Identities = 151/278 (54%), Positives = 187/278 (67%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:AF004202_467390 Escherichia coli malate dehydrogenase (mdh) gene,
            partial cds.
          Length = 288

 Score =  268 bits (684), Expect = 3e-70
 Identities = 151/278 (54%), Positives = 187/278 (67%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:AF004200_467388 Escherichia coli malate dehydrogenase (mdh) gene,
            partial cds.>gb:AF004203_467391 Escherichia coli malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF004204_467392
            Escherichia coli malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF004205_467393 Escherichia coli malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF004206_467394
            Escherichia coli malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF004207_467395 Escherichia coli malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF004208_467396
            Escherichia coli malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF004209_467397 Escherichia coli malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF071027_475998
            Escherichia coli strain EDL933 malate dehydrogenase
            (mdhA) gene, partial cds.>gb:AF071028_475999 Escherichia
            coli strain E2348/69 malate dehydrogenase (mdhA) gene,
            partial cds.>gb:AF071030_476001 Escherichia coli isolate
            C54-58 malate dehydrogenase (mdhA) gene, partial
            cds.>gb:AF071031_476002 Escherichia coli isolate F60-51
            malate dehydrogenase (mdhA) gene, partial
            cds.>gb:AF071032_476003 Escherichia coli isolate 3077-88
            malate dehydrogenase (mdhA) gene, partial
            cds.>gb:AF071033_476004 Escherichia coli isolate C374-83
            malate dehydrogenase (mdhA) gene, partial
            cds.>gb:AF091760_478530 Escherichia coli isolate RT002C
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF091761_478531 Escherichia coli isolate RT002E
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF091762_478532 Escherichia coli isolate RT008A
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF091763_478533 Escherichia coli isolate RT016A
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF091764_478534 Escherichia coli isolate RT017A
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF091765_478535 Escherichia coli isolate RT018A
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF091766_478536 Escherichia coli isolate RT019A
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF091767_478537 Escherichia coli isolate RT030A
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF091768_478538 Escherichia coli isolate RT040
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF091769_478539 Escherichia coli isolate RT065
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF091774_478544 Escherichia coli isolate RT213
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF091776_478546 Escherichia coli isolate RT302
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF091777_478547 Escherichia coli isolate SA014A
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF091778_478548 Escherichia coli isolate TV031A
            malate dehydrogenase (mdh) gene, partial cds.
          Length = 288

 Score =  268 bits (684), Expect = 3e-70
 Identities = 151/278 (54%), Positives = 187/278 (67%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:AF091771_478541 Escherichia coli isolate RT083 malate
            dehydrogenase (mdh) gene, partial cds.
          Length = 288

 Score =  267 bits (683), Expect = 3e-70
 Identities = 150/278 (53%), Positives = 187/278 (67%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   V+
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVI 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:AF091758_478528 Escherichia coli isolate MB001D malate
            dehydrogenase (mdh) gene, partial cds.
          Length = 288

 Score =  267 bits (682), Expect = 5e-70
 Identities = 151/278 (54%), Positives = 187/278 (67%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNPGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:SEU04784_182287 Salmonella enterica isolate S3041 malate
            dehydrogenase (mdh) gene, partial cds.
          Length = 283

 Score =  267 bits (682), Expect = 5e-70
 Identities = 153/278 (55%), Positives = 187/278 (67%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKNQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   IAK CP A V +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKLPTEVEVSVIGGHSGVTILPLLSQ-I 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  + +      LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFSEQEAAELTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEKGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:AF091770_478540 Escherichia coli isolate RT082 malate
            dehydrogenase (mdh) gene, partial cds.
          Length = 288

 Score =  266 bits (681), Expect = 6e-70
 Identities = 150/278 (53%), Positives = 187/278 (67%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   ++K CP A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVSKTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:AF004199_467387 Escherichia coli malate dehydrogenase (mdh) gene,
            partial cds.
          Length = 288

 Score =  266 bits (681), Expect = 6e-70
 Identities = 150/278 (53%), Positives = 187/278 (67%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   ++K CP A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVSKTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:AF004197_467385 Escherichia coli malate dehydrogenase (mdh) gene,
            partial cds.
          Length = 275

 Score =  266 bits (681), Expect = 6e-70
 Identities = 150/276 (54%), Positives = 186/276 (67%), Gaps = 2/276 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQLGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLT 1075
            EC++V+       FF+  + LGKNGVEE   +G+L+
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLS 274



>gb:SEU04786_182288 Salmonella enterica isolate S3053 malate
            dehydrogenase (mdh) gene, partial cds.
          Length = 283

 Score =  266 bits (681), Expect = 6e-70
 Identities = 153/278 (55%), Positives = 186/278 (66%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKNQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   IAK CP A V +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKLPTEVEVPVIGGHSGVTILPLLSQ-I 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +        LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PDVSFTEQEAAELTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEKGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:SEU04777_182280 Salmonella enterica isolate S3025 malate
            dehydrogenase (mdh) gene, partial cds.
          Length = 283

 Score =  266 bits (681), Expect = 6e-70
 Identities = 153/278 (55%), Positives = 186/278 (66%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKNQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   IAK CP A V +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAALKGKLPTEVEVPVIGGHSGVTILPLLSQ-I 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +        LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEAADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEKGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:AF230579_490583 Escherichia coli 2314 malate dehydrogenase (mdh)
            gene, partial cds.
          Length = 275

 Score =  266 bits (680), Expect = 8e-70
 Identities = 150/276 (54%), Positives = 186/276 (67%), Gaps = 2/276 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGDQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLT 1075
            EC++V+       FF+  + LGKNGVEE   +G+L+
Sbjct: 239  ECAYVEGVGQYARFFSQPLLLGKNGVEERKSIGTLS 274



>gb:AF004201_467389 Escherichia coli malate dehydrogenase (mdh) gene,
            partial cds.
          Length = 288

 Score =  266 bits (680), Expect = 8e-70
 Identities = 150/278 (53%), Positives = 186/278 (66%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A   F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAATRFGLSLVRALQGEQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:AF004181_467369 Escherichia coli malate dehydrogenase (mdh) gene,
            partial cds.>gb:AF004192_467380 Escherichia coli malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF004193_467381
            Escherichia coli malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF004194_467382 Escherichia coli malate
            dehydrogenase (mdh) gene, partial cds.
          Length = 275

 Score =  266 bits (680), Expect = 8e-70
 Identities = 150/276 (54%), Positives = 186/276 (67%), Gaps = 2/276 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKNCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLT 1075
            EC++V+       FF+  + LGKNGVEE   +G+L+
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLS 274



>gb:AF004170_467358 Escherichia coli malate dehydrogenase (mdh) gene,
            partial cds.>gb:AF004171_467359 Escherichia coli malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF004172_467360
            Escherichia coli malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF004173_467361 Escherichia coli malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF004174_467362
            Escherichia coli malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF004175_467363 Escherichia coli malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF004176_467364
            Escherichia coli malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF004177_467365 Escherichia coli malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF004179_467367
            Escherichia coli malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF004180_467368 Escherichia coli malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF004182_467370
            Escherichia coli malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF004183_467371 Escherichia coli malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF004184_467372
            Escherichia coli malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF004186_467374 Escherichia coli malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF004187_467375
            Escherichia coli malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF004188_467376 Escherichia coli malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF004190_467378
            Escherichia coli malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF004191_467379 Escherichia coli malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF004195_467383
            Escherichia coli malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF004196_467384 Escherichia coli malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF230568_490572
            Escherichia coli 2165 malate dehydrogenase (mdh) gene,
            partial cds.>gb:AF230569_490573 Escherichia coli 2274
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF230570_490574 Escherichia coli 2382 malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF230571_490575
            Escherichia coli 4999 malate dehydrogenase (mdh) gene,
            partial cds.>gb:AF230572_490576 Escherichia coli 5026
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF230573_490577 Escherichia coli 5028 malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF230575_490579
            Escherichia coli 161 malate dehydrogenase (mdh) gene,
            partial cds.>gb:AF230576_490580 Escherichia coli 298
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF230580_490584 Escherichia coli 2339 malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF230582_490586
            Escherichia coli 78 malate dehydrogenase (mdh) gene,
            partial cds.>gb:AF230583_490587 Escherichia coli 271
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF230584_490588 Escherichia coli 287 malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF230585_490589
            Escherichia coli 288 malate dehydrogenase (mdh) gene,
            partial cds.>gb:AF230586_490590 Escherichia coli 268
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF230587_490591 Escherichia coli 270 malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF230588_490592
            Escherichia coli 1684 malate dehydrogenase (mdh) gene,
            partial cds.>gb:AF230589_490593 Escherichia coli 1698
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF230590_490594 Escherichia coli 2374 malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF230593_490597
            Escherichia coli 2026 malate dehydrogenase (mdh) gene,
            partial cds.>gb:AF230594_490598 Escherichia coli 2355
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF230595_490599 Escherichia coli 2357 malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF230596_490600
            Escherichia coli 45 malate dehydrogenase (mdh) gene,
            partial cds.>gb:AF230597_490601 Escherichia coli 46
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF230598_490602 Escherichia coli 47 malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF230599_490603
            Escherichia coli 5074 malate dehydrogenase (mdh) gene,
            partial cds.>gb:AF230600_490604 Escherichia coli TA002
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF230601_490605 Escherichia coli TA243 malate
            dehydrogenase (mdh) gene, partial cds.
          Length = 275

 Score =  266 bits (680), Expect = 8e-70
 Identities = 150/276 (54%), Positives = 186/276 (67%), Gaps = 2/276 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLT 1075
            EC++V+       FF+  + LGKNGVEE   +G+L+
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLS 274



>gb:SEU04782_182285 Salmonella enterica isolate S3051 malate
            dehydrogenase (mdh) gene, partial cds.>gb:SEU04783_182286
            Salmonella enterica isolate S3044 malate dehydrogenase
            (mdh) gene, partial cds.
          Length = 283

 Score =  266 bits (680), Expect = 8e-70
 Identities = 153/278 (55%), Positives = 187/278 (67%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKNQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   IAK CP A V +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKLPTEVEVPVIGGHSGVTILPLLSQ-I 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  + +      LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFSEQEAAELTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEKGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:SEU04780_182283 Salmonella enterica isolate S2980 malate
            dehydrogenase (mdh) gene, partial cds.>gb:SEU04781_182284
            Salmonella enterica isolate S2983 malate dehydrogenase
            (mdh) gene, partial cds.
          Length = 283

 Score =  266 bits (680), Expect = 8e-70
 Identities = 153/278 (55%), Positives = 186/278 (66%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKNQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   IAK CP A V +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKLPTEVEVPVIGGHSGVTILPLLSQ-I 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +        LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEAADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGETGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:SEU04769_182273 Salmonella enterica isolate S2985 malate
            dehydrogenase (mdh) gene, partial cds.>gb:SEU04771_182274
            Salmonella enterica isolate S2993 malate dehydrogenase
            (mdh) gene, partial cds.>gb:SEU04775_182278 Salmonella
            enterica isolate S3027 malate dehydrogenase (mdh) gene,
            partial cds.>gb:SEU04776_182279 Salmonella enterica
            isolate S3015 malate dehydrogenase (mdh) gene, partial
            cds.>gb:SEU04778_182281 Salmonella enterica isolate S2979
            malate dehydrogenase (mdh) gene, partial cds.
          Length = 283

 Score =  266 bits (680), Expect = 8e-70
 Identities = 153/278 (55%), Positives = 186/278 (66%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKNQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   IAK CP A V +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKLPTEVEVPVIGGHSGVTILPLLSQ-I 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +        LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEAADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEKGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:SEU04764_182268 Salmonella enterica Typhi malate dehydrogenase
            (mdh) gene, partial cds.
          Length = 283

 Score =  266 bits (680), Expect = 8e-70
 Identities = 153/278 (55%), Positives = 186/278 (66%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKNQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   IAK CP A V +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKLPTEVEVPVIGGHSGVTILPLLSQ-I 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +        LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEAAELTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEKGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSTF 276



>gb:AF091775_478545 Escherichia coli isolate RT272 malate
            dehydrogenase (mdh) gene, partial cds.
          Length = 288

 Score =  266 bits (679), Expect = 1e-69
 Identities = 150/278 (53%), Positives = 187/278 (67%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            +VV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAE
Sbjct: 60   NVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:SEU04773_182276 Salmonella enterica isolate S3013 malate
            dehydrogenase (mdh) gene, partial cds.>gb:SEU04774_182277
            Salmonella enterica isolate S3014 malate dehydrogenase
            (mdh) gene, partial cds.
          Length = 283

 Score =  266 bits (679), Expect = 1e-69
 Identities = 153/278 (55%), Positives = 186/278 (66%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKNQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   IAK CP A V +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKLPTEVEVPVIGGHSGVTILPLLSQ-I 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +        LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEAADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEKGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERRSVGTLSAF 276



>gb:SEU04763_182267 Salmonella enterica Newport malate dehydrogenase
            (mdh) gene, partial cds.
          Length = 283

 Score =  266 bits (679), Expect = 1e-69
 Identities = 153/278 (55%), Positives = 186/278 (66%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKNQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   IAK CP A V +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKRPTEVEVPVIGGHSGVTILPLLSQ-I 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +        LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEAAELTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEKGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:SEU04761_182265 Salmonella enterica Gallinarium malate
            dehydrogenase (mdh) gene, partial cds.>gb:SEU04765_182269
            Salmonella enterica Typhimurium isolate S4194 malate
            dehydrogenase (mdh) gene, partial cds.>gb:SEU04767_182271
            Salmonella enterica isolate S3057 malate dehydrogenase
            (mdh) gene, partial cds.>gb:SEU04768_182272 Salmonella
            enterica isolate S2995 malate dehydrogenase (mdh) gene,
            partial cds.
          Length = 283

 Score =  266 bits (679), Expect = 1e-69
 Identities = 153/278 (55%), Positives = 186/278 (66%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKNQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   IAK CP A V +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKLPTEVEVPVIGGHSGVTILPLLSQ-I 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +        LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEAAELTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEKGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:ECU04757_132999 Escherichia coli isolate E830587 malate
            dehydrogenase (mdh) gene, partial cds.
          Length = 288

 Score =  266 bits (679), Expect = 1e-69
 Identities = 150/278 (53%), Positives = 186/278 (66%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAK G GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKRGGGSATLSMGQAAARFGLSLVRALQGEQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:ECU04756_132998 Escherichia coli isolate E2666-74 malate
            dehydrogenase (mdh) gene, partial cds.
          Length = 288

 Score =  266 bits (679), Expect = 1e-69
 Identities = 150/278 (53%), Positives = 186/278 (66%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAK G GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKRGGGSATLSMGQAAARFGLSLVRALQGEQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:ECU04746_132988 Escherichia coli isolate EC38 malate dehydrogenase
            (mdh) gene, partial cds.>gb:ECU04747_132989 Escherichia
            coli isolate EC44 malate dehydrogenase (mdh) gene,
            partial cds.>gb:ECU04748_132990 Escherichia coli isolate
            EC46 malate dehydrogenase (mdh) gene, partial
            cds.>gb:ECU04770_133003 Escherichia coli isolate EC40
            malate dehydrogenase (mdh) gene, partial cds.
          Length = 288

 Score =  266 bits (679), Expect = 1e-69
 Identities = 150/278 (53%), Positives = 186/278 (66%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAK G GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKRGGGSATLSMGQAAARFGLSLVRALQGEQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:ECU04745_132987 Escherichia coli isolate EC35 malate dehydrogenase
            (mdh) gene, partial cds.
          Length = 288

 Score =  266 bits (679), Expect = 1e-69
 Identities = 150/278 (53%), Positives = 186/278 (66%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAK G GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKRGGGSATLSMGQAAARFGLSLVRALQGEQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:ECU04742_132984 Escherichia coli isolate EC10 malate dehydrogenase
            (mdh) gene, partial cds.>gb:ECU04743_132985 Escherichia
            coli isolate EC14 malate dehydrogenase (mdh) gene,
            partial cds.>gb:ECU04744_132986 Escherichia coli isolate
            EC32 malate dehydrogenase (mdh) gene, partial
            cds.>gb:ECU04752_132994 Escherichia coli isolate EC52
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:ECU04753_132995 Escherichia coli isolate EC58
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:ECU04754_132996 Escherichia coli isolate EC64
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:ECU04755_132997 Escherichia coli isolate EC70
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:ECU04758_133000 Escherichia coli isolate E851819
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:ECU04759_133001 Escherichia coli isolate A8190
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:ECU04760_133002 Escherichia coli isolate E3406
            malate dehydrogenase (mdh) gene, partial cds.
          Length = 288

 Score =  266 bits (679), Expect = 1e-69
 Identities = 150/278 (53%), Positives = 186/278 (66%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAK G GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKRGGGSATLSMGQAAARFGLSLVRALQGEQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:AF071029_476000 Escherichia coli isolate 5624-50 malate
            dehydrogenase (mdhA) gene, partial cds.
          Length = 288

 Score =  265 bits (678), Expect = 1e-69
 Identities = 150/278 (53%), Positives = 186/278 (66%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQXPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
             C++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  XCAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:SEU04772_182275 Salmonella enterica isolate S2991 malate
            dehydrogenase (mdh) gene, partial cds.
          Length = 283

 Score =  265 bits (678), Expect = 1e-69
 Identities = 153/278 (55%), Positives = 185/278 (66%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKNQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   IAK CP A V +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKLPTEVEVPVIGGHSGVTILPLLSQ-I 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +        LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + +  L G   VV
Sbjct: 179  PGVSFTEQEAADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVHALQGEKGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDSQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:CR382134_1667059 Debaryomyces hansenii chromosome B of strain
            CBS767 of Debaryomyces hansenii.
          Length = 338

 Score =  265 bits (677), Expect = 2e-69
 Identities = 156/300 (52%), Positives = 193/300 (64%), Gaps = 23/300 (7%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHI----NTRSEVVGFS 391
            KV + GAAGGIGQPLSLL+KLNP +  LSLFD+   PGV AD+SHI    +T S +    
Sbjct: 3    KVTVCGAAGGIGQPLSLLLKLNPKIDELSLFDVVNVPGVGADLSHICSNSSTSSHLPSSR 62

Query: 392  GDEN-LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMI 568
             D++ L ++L+G+D+VIIPAGVPRKPGMTRDDLFNINA IV+ L+  IA+  P A V +I
Sbjct: 63   EDKSALAESLKGSDLVIIPAGVPRKPGMTRDDLFNINASIVRDLAQGIAENAPKAFVLII 122

Query: 569  SNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYX--XXXXXXXXXXXXXXIG 742
            SNPVNSTVPI AE  KK G Y+ +RLFGVTTLD+VRA TF                  IG
Sbjct: 123  SNPVNSTVPIVAETLKKNGVYNPQRLFGVTTLDIVRANTFISQKYAKETKATDFNINVIG 182

Query: 743  GHAGITILPLFSQATPQA---NLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAG 913
            GH+G TI+PL+S    ++    L+ +    L  R Q GG EVV+AK G GSATLSMAYAG
Sbjct: 183  GHSGETIVPLYSIGNSKSYYDKLSEEDKKALINRVQFGGDEVVKAKDGAGSATLSMAYAG 242

Query: 914  AIFADACLKGLNGV-PDVVECSFV------------QSTVTELPFFASKVRLGKNGVEEV 1054
               A++ LK L     +VVEC+F+            +  V  L FF+  VRLG NG+EEV
Sbjct: 243  YKLAESILKALTSKGEEVVECTFLNLDDSIKGAAEAKKLVKNLDFFSLPVRLGANGIEEV 302



>gb:AF004198_467386 Escherichia coli malate dehydrogenase (mdh) gene,
            partial cds.>gb:AF230581_490585 Escherichia coli 4981
            malate dehydrogenase (mdh) gene, partial cds.
          Length = 275

 Score =  265 bits (677), Expect = 2e-69
 Identities = 149/276 (53%), Positives = 186/276 (67%), Gaps = 2/276 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GT+VVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTDVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLT 1075
            EC++V+       FF+  + LGKNGVEE   +G+L+
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLS 274



>gb:AF004178_467366 Escherichia coli malate dehydrogenase (mdh) gene,
            partial cds.>gb:AF004189_467377 Escherichia coli malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF230577_490581
            Escherichia coli 2 malate dehydrogenase (mdh) gene,
            partial cds.>gb:AF230578_490582 Escherichia coli 820
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF230591_490595 Escherichia coli 1668 malate
            dehydrogenase (mdh) gene, partial cds.
          Length = 275

 Score =  265 bits (677), Expect = 2e-69
 Identities = 149/276 (53%), Positives = 186/276 (67%), Gaps = 2/276 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   ++K CP A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVSKTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLT 1075
            EC++V+       FF+  + LGKNGVEE   +G+L+
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLS 274



>gb:AF230656_490666 Escherichia sp. Souza-57 malate dehydrogenase
            (mdh) gene, partial cds.
          Length = 275

 Score =  265 bits (676), Expect = 2e-69
 Identities = 148/276 (53%), Positives = 185/276 (67%), Gaps = 2/276 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPAGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDARPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   +A  CP A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLIQQVATTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPTELEVPVIGGHSGVTILPLLSQ-I 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLT 1075
            EC++V+       FF+  + LGKNG+EE   +G+L+
Sbjct: 239  ECAYVEGDGEHARFFSQPLLLGKNGIEERKSIGTLS 274



>gb:AF230655_490665 Enterobacter cloacae malate dehydrogenase (mdh)
            gene, partial cds.
          Length = 275

 Score =  265 bits (676), Expect = 2e-69
 Identities = 148/276 (53%), Positives = 186/276 (67%), Gaps = 2/276 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   AL+GA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDARPALQGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   IA+ CP A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAEICPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPTEVEVPVIGGHSGVTILPLLSQ-I 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEKGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLT 1075
            EC++V+       FF+  + LGKNG+EE   +G+L+
Sbjct: 239  ECAYVEGDGEHARFFSQPLLLGKNGIEERKSIGTLS 274



>gb:AF230592_490596 Escherichia coli 1930 malate dehydrogenase (mdh)
            gene, partial cds.
          Length = 275

 Score =  264 bits (675), Expect = 3e-69
 Identities = 148/276 (53%), Positives = 186/276 (67%), Gaps = 2/276 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   ++K CP A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVSKTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLT 1075
            EC++V+       FF+  + +GKNGVEE   +G+L+
Sbjct: 239  ECAYVEGDGQYARFFSQPLLMGKNGVEERKSIGTLS 274



>gb:AF230574_490578 Escherichia coli 55 malate dehydrogenase (mdh)
            gene, partial cds.
          Length = 275

 Score =  264 bits (675), Expect = 3e-69
 Identities = 149/276 (53%), Positives = 186/276 (67%), Gaps = 2/276 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            +VV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAE
Sbjct: 60   NVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLT 1075
            EC++V+       FF+  + LGKNGVEE   +G+L+
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLS 274



>gb:SEU04766_182270 Salmonella enterica Typhimurium isolate S1164
            malate dehydrogenase (mdh) gene, partial cds.
          Length = 283

 Score =  264 bits (675), Expect = 3e-69
 Identities = 153/278 (55%), Positives = 185/278 (66%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKNQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   IAK CP A V +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKLPTEVEVPVIGGHSGVTILPLLSQ-I 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +        LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + +  L G   VV
Sbjct: 179  PGVSFTEQEAAELTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVLALQGEKGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:AF267605_494011 Escherichia coli strain 5905 malate dehydrogenase
            (mdh) gene, partial cds.
          Length = 282

 Score =  264 bits (674), Expect = 4e-69
 Identities = 148/273 (54%), Positives = 184/273 (67%), Gaps = 2/273 (0%)
 Frame = +2

Query: 269  SLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVII 442
            +LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGADVV+I
Sbjct: 1    ALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGADVVLI 59

Query: 443  PAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKA 622
             AGVPRKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAEV KKA
Sbjct: 60   SAGVPRKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAEVLKKA 119

Query: 623  GTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANL 802
            G YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  P  + 
Sbjct: 120  GVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-VPGVSF 178

Query: 803  AHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFV 982
                +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VVEC++V
Sbjct: 179  TEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVVECAYV 238

Query: 983  QSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            +       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  EGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 271



>gb:AF004185_467373 Escherichia coli malate dehydrogenase (mdh) gene,
            partial cds.
          Length = 275

 Score =  264 bits (674), Expect = 4e-69
 Identities = 149/276 (53%), Positives = 186/276 (67%), Gaps = 2/276 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   ++K CP A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVSKTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLT 1075
            EC++V+       FF+  + LGKNGVEE   +G+L+
Sbjct: 239  ECAYVEGDGQYGRFFSQPLLLGKNGVEERKSIGTLS 274



>gb:ECU04750_132992 Escherichia coli isolate EC49 malate dehydrogenase
            (mdh) gene, partial cds.>gb:ECU04751_132993 Escherichia
            coli isolate EC50 malate dehydrogenase (mdh) gene,
            partial cds.
          Length = 288

 Score =  264 bits (674), Expect = 4e-69
 Identities = 149/278 (53%), Positives = 186/278 (66%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            +VV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAE
Sbjct: 60   NVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAK G GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKRGGGSATLSMGQAAARFGLSLVRALQGEQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:ECU04749_132991 Escherichia coli isolate EC47 malate dehydrogenase
            (mdh) gene, partial cds.
          Length = 288

 Score =  264 bits (674), Expect = 4e-69
 Identities = 149/278 (53%), Positives = 186/278 (66%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            +VV+I AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAE
Sbjct: 60   NVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-V 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAK G GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKRGGGSATLSMGQAAARFGLSLVRALQGEQGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 276



>gb:SEU04779_182282 Salmonella enterica isolate S2978 malate
            dehydrogenase (mdh) gene, partial cds.
          Length = 283

 Score =  263 bits (673), Expect = 5e-69
 Identities = 152/278 (54%), Positives = 185/278 (66%), Gaps = 2/278 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKNQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   IAK CP A V +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKLPTEVEVPVIGGHSGVTILPLLSQ-I 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +        LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEAADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEKGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            EC++V+       FF+  + LGKNGV E   +G+L+ F
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVGERKSIGTLSAF 276



>gb:AF230657_490667 Escherichia sp. Souza-207 malate dehydrogenase
            (mdh) gene, partial cds.
          Length = 275

 Score =  263 bits (672), Expect = 7e-69
 Identities = 148/276 (53%), Positives = 185/276 (67%), Gaps = 2/276 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   AL+GA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDARPALQGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   IA+ CP A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAETCPKACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPSEVEVPVIGGHSGVTILPLLSQ-I 178

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
            P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VV
Sbjct: 179  PGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEKGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLT 1075
            EC++V+       FF+  + LGKNG+EE   +G L+
Sbjct: 239  ECAYVEGDGEHARFFSQPLLLGKNGIEEHQPIGKLS 274



>gb:AF267618_494024 Escherichia coli strain 536 malate dehydrogenase
            (mdh) gene, partial cds.
          Length = 282

 Score =  262 bits (670), Expect = 1e-68
 Identities = 147/273 (53%), Positives = 183/273 (67%), Gaps = 2/273 (0%)
 Frame = +2

Query: 269  SLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVII 442
            +LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG EN   ALEGADVV+I
Sbjct: 1    ALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-ENATPALEGADVVLI 59

Query: 443  PAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKA 622
             AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAEV KKA
Sbjct: 60   SAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAEVLKKA 119

Query: 623  GTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANL 802
            G YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  P  + 
Sbjct: 120  GVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-VPGVSF 178

Query: 803  AHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFV 982
                +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   V+EC++V
Sbjct: 179  TEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVIECAYV 238

Query: 983  QSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            +       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  EGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 271



>gb:AY268631_604384 Salmonella enterica strain SARB35 malate
            dehydrogenase (mdh) gene, partial cds.
          Length = 277

 Score =  262 bits (669), Expect = 1e-68
 Identities = 147/265 (55%), Positives = 179/265 (67%), Gaps = 1/265 (0%)
 Frame = +2

Query: 290  PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKP 466
            P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E++  ALEGADVV+I AGV RKP
Sbjct: 3    PSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDVTPALEGADVVLISAGVARKP 61

Query: 467  GMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRL 646
            GM R DLFN+NAGIVK+L   IAK CP A V +I+NPVN+TV IAAEV KKAG YD+ +L
Sbjct: 62   GMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNPVNTTVAIAAEVLKKAGVYDKNKL 121

Query: 647  FGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGL 826
            FGVTTLD++R+ TF                IGGH+G+TILPL SQ  P  +        L
Sbjct: 122  FGVTTLDIIRSNTFVAELKGKLPTEVEVPVIGGHSGVTILPLLSQ-IPGVSFTEQEAAEL 180

Query: 827  TKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELP 1006
            TKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G  DVVEC++V+       
Sbjct: 181  TKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEKDVVECAYVEGDGQYAR 240

Query: 1007 FFASKVRLGKNGVEEVLGLGSLTDF 1081
            FF+  + LGKNGVEE   +G+L+ F
Sbjct: 241  FFSQPLLLGKNGVEERKSIGTLSAF 265



>sp|Q7VP41|MDH_HAEDU Malate dehydrogenase (EC
            1.1.1.37).>gb:AE017151_391850 Haemophilus ducreyi strain
            35000HP section 1 of 6 of the complete
            genome.>gb:AE017143_1026112 Haemophilus ducreyi strain
            35000HP complete genome.
          Length = 324

 Score =  262 bits (669), Expect = 1e-68
 Identities = 153/299 (51%), Positives = 196/299 (65%), Gaps = 13/299 (4%)
 Frame = +2

Query: 224  KVAILGAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGD 397
            KV +LGAAGGIGQ LSLL+KL  P  + L+L+DI+  TPG+A D+SHI T    +G++G+
Sbjct: 2    KVTVLGAAGGIGQTLSLLLKLRLPAGADLALYDISPVTPGIAVDISHIPTSVNAIGYAGE 61

Query: 398  E------NLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALV 559
            +      +   AL+  ++VII AG+ RKPGMTR DLFNINAGIVK L   +A+ CP A +
Sbjct: 62   DPSVALKDPSVALKDTNLVIITAGIARKPGMTRADLFNINAGIVKDLVEKVAEVCPMACI 121

Query: 560  NMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXI 739
             +++NPVN+ VPIAAEV +KAG YD+ +LFGVTTLDVVRAKTF                +
Sbjct: 122  GIVTNPVNTLVPIAAEVLRKAGVYDKSKLFGVTTLDVVRAKTFVSELKHKNVETVTVPVV 181

Query: 740  GGHAGITILPLFSQATPQANL---AHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYA 910
            GGH+G TILPL SQA  +  L   +   I  LT+R ++ GTEVVEAKAG GSATLSMA +
Sbjct: 182  GGHSGTTILPLLSQALAEGRLLDFSQTEIESLTQRIKNAGTEVVEAKAGGGSATLSMAES 241

Query: 911  GAIFADACLKGLNGVPDVVECSFVQSTVTE--LPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            GA FA A  K L G  D V  ++VQS        FFA  VR G  G+EE+L +  L ++
Sbjct: 242  GARFALAVFKALLG-EDCVRYAYVQSKEGSGYPEFFAHPVRFGLKGIEEILPIAPLNEY 299



>gb:AY268636_604389 Salmonella enterica strain SARB02 malate
            dehydrogenase (mdh) gene, partial cds.
          Length = 277

 Score =  261 bits (666), Expect = 3e-68
 Identities = 147/265 (55%), Positives = 178/265 (67%), Gaps = 1/265 (0%)
 Frame = +2

Query: 290  PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKP 466
            P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGADVV+I AGV RKP
Sbjct: 3    PSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGADVVLISAGVARKP 61

Query: 467  GMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRL 646
            GM R DLFN+NAGIVK+L   IAK CP A V +I+NPVN+TV IAAEV KKAG YD+ +L
Sbjct: 62   GMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNPVNTTVAIAAEVLKKAGVYDKNKL 121

Query: 647  FGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGL 826
            FGVTTLD++R+ TF                IGGH+G+TILPL SQ  P  +    V   L
Sbjct: 122  FGVTTLDIIRSNTFVAELKGKLPTEVEVPVIGGHSGVTILPLLSQ-IPGVSFTEQVAAEL 180

Query: 827  TKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELP 1006
            TKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VVEC++V+       
Sbjct: 181  TKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEKGVVECAYVEGDGQYAR 240

Query: 1007 FFASKVRLGKNGVEEVLGLGSLTDF 1081
            FF+  + LGKNGVEE   +G+L+ F
Sbjct: 241  FFSQPLLLGKNGVEERKSIGTLSAF 265



>gb:AF267607_494013 Escherichia coli strain DEC8b malate dehydrogenase
            (mdh) gene, partial cds.>gb:AF267608_494014 Escherichia
            coli strain CL-37 malate dehydrogenase (mdh) gene,
            partial cds.>gb:AF267615_494021 Escherichia coli strain
            B2F1 malate dehydrogenase (mdh) gene, partial cds.
          Length = 282

 Score =  261 bits (666), Expect = 3e-68
 Identities = 147/273 (53%), Positives = 183/273 (67%), Gaps = 2/273 (0%)
 Frame = +2

Query: 269  SLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVII 442
            +LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGADVV+I
Sbjct: 1    ALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGADVVLI 59

Query: 443  PAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKA 622
             AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAEV KKA
Sbjct: 60   SAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAEVLKKA 119

Query: 623  GTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANL 802
            G YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  P  + 
Sbjct: 120  GVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-VPGVSF 178

Query: 803  AHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFV 982
                +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VVEC++V
Sbjct: 179  TEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVVECAYV 238

Query: 983  QSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            +       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  EGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 271



>gb:AF267599_494005 Escherichia coli strain E2348/69 malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF267600_494006
            Escherichia coli strain DEC1a malate dehydrogenase (mdh)
            gene, partial cds.>gb:AF267601_494007 Escherichia coli
            strain DEC2a malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF267610_494016 Escherichia coli strain DEC11a
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF267611_494017 Escherichia coli strain DEC12a
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AF267612_494018 Escherichia coli strain B170
            malate dehydrogenase (mdh) gene, partial cds.
          Length = 282

 Score =  261 bits (666), Expect = 3e-68
 Identities = 147/273 (53%), Positives = 183/273 (67%), Gaps = 2/273 (0%)
 Frame = +2

Query: 269  SLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVII 442
            +LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGADVV+I
Sbjct: 1    ALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGADVVLI 59

Query: 443  PAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKA 622
             AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAEV KKA
Sbjct: 60   SAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAEVLKKA 119

Query: 623  GTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANL 802
            G YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  P  + 
Sbjct: 120  GVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-VPGVSF 178

Query: 803  AHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFV 982
                +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VVEC++V
Sbjct: 179  TEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVVECAYV 238

Query: 983  QSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            +       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  EGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 271



>gb:AF230658_490668 Escherichia sp. Souza-273 malate dehydrogenase
            (mdh) gene, partial cds.
          Length = 275

 Score =  261 bits (666), Expect = 3e-68
 Identities = 148/276 (53%), Positives = 185/276 (67%), Gaps = 2/276 (0%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA
Sbjct: 1    IGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTDVKIKGFSG-EDATPALEGA 59

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGM R DLFN+NAGIVK+L   IAK  P A + +I+NPVN+TV IAAE
Sbjct: 60   DVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAKTSPQACIGIITNPVNTTVAIAAE 119

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  
Sbjct: 120  VLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKSSSDVEVPVIGGHSGVTILPLLSQIA 179

Query: 788  PQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVV 967
               + +   +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ + G   VV
Sbjct: 180  -GVSFSEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRAMQGEKGVV 238

Query: 968  ECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLT 1075
            EC++V+       FF+  + LGKNGVEE   +G+L+
Sbjct: 239  ECAYVEGDGQYARFFSQPLLLGKNGVEERRSIGTLS 274



>gb:ECO287808_127276 Escherichia coli partial mdh gene for
            malatdehydrogenase, strain IHIT0608.
          Length = 270

 Score =  261 bits (666), Expect = 3e-68
 Identities = 148/272 (54%), Positives = 182/272 (66%), Gaps = 2/272 (0%)
 Frame = +2

Query: 272  LLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIP 445
            LL+K   P  S LSL+DIA  TPGVA D+SHI T  +V GFSG E+   ALEGADVV+I 
Sbjct: 1    LLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKVKGFSG-EDATPALEGADVVLIS 59

Query: 446  AGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAG 625
            AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAEV KKAG
Sbjct: 60   AGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAEVLKKAG 119

Query: 626  TYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLA 805
             YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  P  +  
Sbjct: 120  VYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-VPGVSFT 178

Query: 806  HDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQ 985
               +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VVEC++V+
Sbjct: 179  EQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVVECAYVE 238

Query: 986  STVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
                   FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  GDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 270



>gb:AF267606_494012 Escherichia coli strain DEC5d malate dehydrogenase
            (mdh) gene, partial cds.
          Length = 282

 Score =  260 bits (665), Expect = 4e-68
 Identities = 147/273 (53%), Positives = 183/273 (67%), Gaps = 2/273 (0%)
 Frame = +2

Query: 269  SLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVII 442
            +LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGADVV+I
Sbjct: 1    ALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGADVVLI 59

Query: 443  PAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKA 622
             AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAEV KKA
Sbjct: 60   SAGVRRKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAEVLKKA 119

Query: 623  GTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANL 802
            G YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  P  + 
Sbjct: 120  GVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-VPGVSF 178

Query: 803  AHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFV 982
                +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VVEC++V
Sbjct: 179  TEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVVECAYV 238

Query: 983  QSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            +       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  EGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 271



>gb:ECO287795_127263 Escherichia coli partial mdh gene for
            malatdehydrogenase, strain IHIT0067.>gb:ECO287796_127264
            Escherichia coli partial mdh gene for malatdehydrogenase,
            strain IHIT1190.>gb:ECO287797_127265 Escherichia coli
            partial mdh gene for malatdehydrogenase, strain
            IHIT1968.>gb:ECO287798_127266 Escherichia coli partial
            mdh gene for malatdehydrogenase, strain
            IHIT3000.>gb:ECO287799_127267 Escherichia coli partial
            mdh gene for malatdehydrogenase, strain
            IHIT3669.>gb:ECO287800_127268 Escherichia coli partial
            mdh gene for malatdehydrogenase, strain
            IHIT0597.>gb:ECO287801_127269 Escherichia coli partial
            mdh gene for malatdehydrogenase, strain
            IHIT0554.>gb:ECO287802_127270 Escherichia coli partial
            mdh gene for malatdehydrogenase, strain
            IHIT2115.>gb:ECO287803_127271 Escherichia coli partial
            mdh gene for malatdehydrogenase, strain
            IHIT2430.>gb:ECO287804_127272 Escherichia coli partial
            mdh gene for malatdehydrogenase, strain
            RW1372.>gb:ECO287805_127273 Escherichia coli partial mdh
            gene for malatdehydrogenase, strain
            RW1374.>gb:ECO287806_127274 Escherichia coli partial mdh
            gene for malatdehydrogenase, strain
            IHIT1703.>gb:ECO287807_127275 Escherichia coli partial
            mdh gene for malatdehydrogenase, strain
            IHIT3641.>gb:ECO287809_127277 Escherichia coli partial
            mdh gene for malatdehydrogenase, strain
            IHIT0072.>gb:ECO287810_127278 Escherichia coli partial
            mdh gene for malatdehydrogenase, strain
            IHIT0304.>gb:ECO287811_127279 Escherichia coli partial
            mdh gene for malatdehydrogenase, strain
            IHIT0084.>gb:ECO287812_127280 Escherichia coli partial
            mdh gene for malatdehydrogenase, strain
            303/89.>gb:ECO287813_127281 Escherichia coli partial mdh
            gene for malatdehydrogenase, strain
            IHIT5671.>gb:ECO287814_127282 Escherichia coli partial
            mdh gene for malatdehydrogenase, strain
            IHIT2169.>gb:ECO287815_127283 Escherichia coli partial
            mdh gene for malatdehydrogenase, strain
            RW1911.>gb:ECO287816_127284 Escherichia coli partial mdh
            gene for malatdehydrogenase, strain
            RW2297.>gb:ECO287817_127285 Escherichia coli partial mdh
            gene for malatdehydrogenase, strain
            IHIT2087.>gb:ECO287818_127286 Escherichia coli partial
            mdh gene for malatdehydrogenase, strain
            413/89-1.>gb:ECO287819_127287 Escherichia coli partial
            mdh gene for malatdehydrogenase, strain
            72/90-56.>gb:ECO287820_127288 Escherichia coli partial
            mdh gene for malatdehydrogenase, strain IHIT0578.
          Length = 270

 Score =  260 bits (665), Expect = 4e-68
 Identities = 147/272 (54%), Positives = 182/272 (66%), Gaps = 2/272 (0%)
 Frame = +2

Query: 272  LLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIP 445
            LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGADVV+I 
Sbjct: 1    LLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGADVVLIS 59

Query: 446  AGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAG 625
            AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAEV KKAG
Sbjct: 60   AGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAEVLKKAG 119

Query: 626  TYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLA 805
             YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  P  +  
Sbjct: 120  VYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-VPGVSFT 178

Query: 806  HDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQ 985
               +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VVEC++V+
Sbjct: 179  EQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVVECAYVE 238

Query: 986  STVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
                   FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  GDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 270



>gb:AE016817_1747636 Ashbya gossypii (= Eremothecium gossypii) ATCC
           10895 chromosome IV, complete sequence.
          Length = 485

 Score =  259 bits (662), Expect = 9e-68
 Identities = 142/258 (55%), Positives = 172/258 (66%), Gaps = 5/258 (1%)
 Frame = +2

Query: 224 KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGDEN 403
           +V +LGAAGGIGQPLSLL+K   LVS L+L+D+   PGVAADVSH+NT   V GF G   
Sbjct: 3   RVTVLGAAGGIGQPLSLLLKTCSLVSELNLYDLRNAPGVAADVSHVNTDCRVAGFEGPAE 62

Query: 404 LGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVN 583
           LG+AL GAD+V+IPAGVPRKPGMTRDDLF INAGIV+SL  A+AK+CP A + +ISNPVN
Sbjct: 63  LGRALRGADLVVIPAGVPRKPGMTRDDLFGINAGIVQSLVTAVAKHCPAARLLIISNPVN 122

Query: 584 STVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYX-----XXXXXXXXXXXXXXIGGH 748
           STVPIA E  K+ G  +  R+FGVTTLD+VRA++F                     +GGH
Sbjct: 123 STVPIAVETLKRLGKLNAARVFGVTTLDLVRAQSFLADALGRDAHRVADLASHVTVVGGH 182

Query: 749 AGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFAD 928
           AG TI+PL + A  +      +      R Q GG EVV+AKAG GSATLSMA AG  FA+
Sbjct: 183 AGRTIVPLLADAQLRELQRRGLYDSYVHRVQFGGDEVVKAKAGAGSATLSMALAGFHFAE 242

Query: 929 ACLKGLNGVPDVVECSFV 982
             L+ L G     E +FV
Sbjct: 243 LLLRSLAGEAVAPEPAFV 260



>gb:AY268662_604415 Salmonella enterica strain SARB43 malate
            dehydrogenase (mdh) gene, partial cds.
          Length = 277

 Score =  259 bits (662), Expect = 9e-68
 Identities = 146/265 (55%), Positives = 177/265 (66%), Gaps = 1/265 (0%)
 Frame = +2

Query: 290  PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKP 466
            P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGADVV+I AGV RKP
Sbjct: 3    PSGSELSLYDIASVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGADVVLISAGVARKP 61

Query: 467  GMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRL 646
            GM R DLFN+NAGIVK+L   IAK CP A V +I+NPVN+TV IAAEV KKAG YD+ +L
Sbjct: 62   GMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNPVNTTVAIAAEVLKKAGVYDKNKL 121

Query: 647  FGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGL 826
            FGVTTLD++R+ TF                IGGH+G+TILPL SQ  P  +        L
Sbjct: 122  FGVTTLDIIRSNTFVAELKGKLPTEVEVPVIGGHSGVTILPLLSQ-IPGVSFTEQEAAEL 180

Query: 827  TKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELP 1006
            TKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VVEC++V+       
Sbjct: 181  TKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEKGVVECAYVEGDGQYAR 240

Query: 1007 FFASKVRLGKNGVEEVLGLGSLTDF 1081
            FF+  + LGKNGVEE   +G+L+ F
Sbjct: 241  FFSQPLLLGKNGVEERKSIGTLSAF 265



>gb:AY268678_604431 Salmonella enterica strain SARB63 malate
            dehydrogenase (mdh) gene, partial cds.>gb:AY268679_604432
            Salmonella enterica strain SARB64 malate dehydrogenase
            (mdh) gene, partial cds.
          Length = 277

 Score =  259 bits (661), Expect = 1e-67
 Identities = 146/265 (55%), Positives = 177/265 (66%), Gaps = 1/265 (0%)
 Frame = +2

Query: 290  PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKP 466
            P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGADVV+I AGV RKP
Sbjct: 3    PSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGADVVLISAGVARKP 61

Query: 467  GMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRL 646
            GM R DLFN+NAGIVK+L   IAK CP A V +I+NPVN+TV IAAEV KKAG YD+ +L
Sbjct: 62   GMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNPVNTTVAIAAEVLKKAGVYDKNKL 121

Query: 647  FGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGL 826
            FGVTTLD++R+ TF                IGGH+G+TILPL SQ  P  +        L
Sbjct: 122  FGVTTLDIIRSNTFVAELKGKLPTEVEVPVIGGHSGVTILPLLSQ-IPGVSFTEQEAAEL 180

Query: 827  TKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELP 1006
            TKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VVEC++V+       
Sbjct: 181  TKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEKGVVECAYVEGDGQYAR 240

Query: 1007 FFASKVRLGKNGVEEVLGLGSLTDF 1081
            FF+  + LGKNGVEE   +G+L+ F
Sbjct: 241  FFSQPLLLGKNGVEERKSIGTLSTF 265



>gb:AY268635_604388 Salmonella enterica strain SARB58 malate
            dehydrogenase (mdh) gene, partial cds.
          Length = 277

 Score =  259 bits (661), Expect = 1e-67
 Identities = 146/265 (55%), Positives = 177/265 (66%), Gaps = 1/265 (0%)
 Frame = +2

Query: 290  PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKP 466
            P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGADVV+I AGV RKP
Sbjct: 3    PSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGADVVLISAGVARKP 61

Query: 467  GMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRL 646
            GM R DLFN+NAGIVK+L   IAK CP A V +I+NPVN+TV IAAEV KKAG YD+ +L
Sbjct: 62   GMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNPVNTTVAIAAEVLKKAGVYDKNKL 121

Query: 647  FGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGL 826
            FGVTTLD++R+ TF                IGGH+G+TILPL SQ  P  +        L
Sbjct: 122  FGVTTLDIIRSNTFVAELKSKLPTEVEVPVIGGHSGVTILPLLSQ-IPGVSFTEQEAAEL 180

Query: 827  TKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELP 1006
            TKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VVEC++V+       
Sbjct: 181  TKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEKGVVECAYVEGDGQYAR 240

Query: 1007 FFASKVRLGKNGVEEVLGLGSLTDF 1081
            FF+  + LGKNGVEE   +G+L+ F
Sbjct: 241  FFSQPLLLGKNGVEERKSIGTLSAF 265



>gb:AF267616_494022 Escherichia coli strain G5506 malate dehydrogenase
            (mdh) gene, partial cds.
          Length = 282

 Score =  259 bits (661), Expect = 1e-67
 Identities = 146/273 (53%), Positives = 182/273 (66%), Gaps = 2/273 (0%)
 Frame = +2

Query: 269  SLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVII 442
            +LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG EN   ALEGA+VV+I
Sbjct: 1    ALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-ENATPALEGANVVLI 59

Query: 443  PAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKA 622
             AGV RKPGM R DLFN+NAGIVK+L   + K CP A + +I+NPVN+TV IAAEV KKA
Sbjct: 60   SAGVARKPGMDRSDLFNVNAGIVKNLVQQVPKTCPKACIGIITNPVNTTVAIAAEVLKKA 119

Query: 623  GTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANL 802
            G YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  P  + 
Sbjct: 120  GVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-VPGVSF 178

Query: 803  AHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFV 982
                +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VVEC++V
Sbjct: 179  TEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVVECAYV 238

Query: 983  QSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            +       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  EGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 271



>gb:AF267613_494019 Escherichia coli strain 90-1787 malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF267614_494020
            Escherichia coli strain CL-3 malate dehydrogenase (mdh)
            gene, partial cds.
          Length = 282

 Score =  259 bits (661), Expect = 1e-67
 Identities = 146/273 (53%), Positives = 183/273 (67%), Gaps = 2/273 (0%)
 Frame = +2

Query: 269  SLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVII 442
            +LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA+VV+I
Sbjct: 1    ALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGANVVLI 59

Query: 443  PAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKA 622
             AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAEV KKA
Sbjct: 60   SAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAEVLKKA 119

Query: 623  GTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANL 802
            G YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  P  + 
Sbjct: 120  GVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-VPGVSF 178

Query: 803  AHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFV 982
                +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VVEC++V
Sbjct: 179  TEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVVECAYV 238

Query: 983  QSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            +       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  EGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 271



>gb:AF267609_494015 Escherichia coli strain DEC9f malate dehydrogenase
            (mdh) gene, partial cds.
          Length = 282

 Score =  259 bits (661), Expect = 1e-67
 Identities = 146/273 (53%), Positives = 182/273 (66%), Gaps = 2/273 (0%)
 Frame = +2

Query: 269  SLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVII 442
            +LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGADVV+I
Sbjct: 1    ALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGADVVLI 59

Query: 443  PAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKA 622
             AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAEV KKA
Sbjct: 60   SAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAEVLKKA 119

Query: 623  GTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANL 802
            G YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  P  + 
Sbjct: 120  GVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-VPGVSF 178

Query: 803  AHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFV 982
                +  LTKR Q+ GTEVVEAK G GSATLSM  A A F  + ++ L G   VVEC++V
Sbjct: 179  TEQEVADLTKRIQNAGTEVVEAKRGGGSATLSMGQAAARFGLSLVRALQGEQGVVECAYV 238

Query: 983  QSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            +       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  EGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 271



>gb:AY268680_604433 Salmonella enterica strain SARB61 malate
            dehydrogenase (mdh) gene, partial cds.
          Length = 277

 Score =  258 bits (660), Expect = 2e-67
 Identities = 146/265 (55%), Positives = 177/265 (66%), Gaps = 1/265 (0%)
 Frame = +2

Query: 290  PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKP 466
            P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGADVV+I AGV RKP
Sbjct: 3    PSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGADVVLISAGVARKP 61

Query: 467  GMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRL 646
            GM R DLFN+NAGIVK+L   IAK CP A V +I+NPVN+TV IAAEV KKAG YD+ +L
Sbjct: 62   GMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNPVNTTVAIAAEVLKKAGVYDKNKL 121

Query: 647  FGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGL 826
            FGVTTLD++R+ TF                IGGH+G+TILPL SQ  P  +        L
Sbjct: 122  FGVTTLDIIRSNTFVAELKGKLPTDVEVPVIGGHSGVTILPLLSQ-IPGVSFTEQEAAEL 180

Query: 827  TKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELP 1006
            TKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VVEC++V+       
Sbjct: 181  TKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEKGVVECAYVEGDGQYAR 240

Query: 1007 FFASKVRLGKNGVEEVLGLGSLTDF 1081
            FF+  + LGKNGVEE   +G+L+ F
Sbjct: 241  FFSQPLLLGKNGVEERKSIGTLSAF 265



>gb:AY268676_604429 Salmonella enterica strain SARB38 malate
            dehydrogenase (mdh) gene, partial cds.
          Length = 277

 Score =  258 bits (660), Expect = 2e-67
 Identities = 146/265 (55%), Positives = 177/265 (66%), Gaps = 1/265 (0%)
 Frame = +2

Query: 290  PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKP 466
            P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGADVV+I AGV RKP
Sbjct: 3    PSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGADVVLISAGVARKP 61

Query: 467  GMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRL 646
            GM R DLFN+NAGIVK+L   IAK CP A V +I+NPVN+TV IAAEV KKAG YD+ +L
Sbjct: 62   GMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNPVNTTVAIAAEVLKKAGVYDKNKL 121

Query: 647  FGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGL 826
            FGVTTLD++R+ TF                IGGH+G+TILPL SQ  P  +        L
Sbjct: 122  FGVTTLDIIRSNTFVAELKGKRPTEVEVPVIGGHSGVTILPLLSQ-IPGVSFTEQEAAEL 180

Query: 827  TKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELP 1006
            TKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VVEC++V+       
Sbjct: 181  TKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEKGVVECAYVEGDGQYAR 240

Query: 1007 FFASKVRLGKNGVEEVLGLGSLTDF 1081
            FF+  + LGKNGVEE   +G+L+ F
Sbjct: 241  FFSQPLLLGKNGVEERKSIGTLSAF 265



>gb:AY268655_604408 Salmonella enterica strain SARB21 malate
            dehydrogenase (mdh) gene, partial cds.
          Length = 277

 Score =  258 bits (660), Expect = 2e-67
 Identities = 146/265 (55%), Positives = 177/265 (66%), Gaps = 1/265 (0%)
 Frame = +2

Query: 290  PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKP 466
            P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGADVV+I AGV RKP
Sbjct: 3    PSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGADVVLISAGVARKP 61

Query: 467  GMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRL 646
            GM R DLFN+NAGIVK+L   IAK CP A V +I+NPVN+TV IAAEV KKAG YD+ +L
Sbjct: 62   GMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNPVNTTVAIAAEVLKKAGVYDKNKL 121

Query: 647  FGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGL 826
            FGVTTLD++R+ TF                IGGH+G+TILPL SQ  P  +        L
Sbjct: 122  FGVTTLDIIRSNTFVAELKGKLPTEVEVPVIGGHSGVTILPLLSQ-IPGVSFTEQEAAEL 180

Query: 827  TKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELP 1006
            TKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VVEC++V+       
Sbjct: 181  TKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEKGVVECAYVEGDGQYAR 240

Query: 1007 FFASKVRLGKNGVEEVLGLGSLTDF 1081
            FF+  + LGKNGVEE   +G+L+ F
Sbjct: 241  FFSQPLLLGKNGVEERKSIGTLSAF 265



>gb:AY268620_604373 Salmonella enterica strain SARB08 malate
            dehydrogenase (mdh) gene, partial cds.>gb:AY268621_604374
            Salmonella enterica strain SARB70 malate dehydrogenase
            (mdh) gene, partial cds.>gb:AY268622_604375 Salmonella
            enterica strain SARB01 malate dehydrogenase (mdh) gene,
            partial cds.>gb:AY268623_604376 Salmonella enterica
            strain SARB09 malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268624_604377 Salmonella enterica strain SARB36
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268625_604378 Salmonella enterica strain SARB04
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268626_604379 Salmonella enterica strain SARB49
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268627_604380 Salmonella enterica strain SARB48
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268629_604382 Salmonella enterica strain SARB06
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268630_604383 Salmonella enterica strain SARB32
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268632_604385 Salmonella enterica strain SARB33
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268633_604386 Salmonella enterica strain SARB25
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268634_604387 Salmonella enterica strain SARB42
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268637_604390 Salmonella enterica strain SARB19
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268638_604391 Salmonella enterica strain SARB15
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268639_604392 Salmonella enterica strain SARB03
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268640_604393 Salmonella enterica strain SARB50
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268641_604394 Salmonella enterica strain SARB27
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268642_604395 Salmonella enterica strain SARB30
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268643_604396 Salmonella enterica strain SARB31
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268644_604397 Salmonella enterica strain SARB29
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268645_604398 Salmonella enterica strain SARB57
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268646_604399 Salmonella enterica strain SARB17
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268647_604400 Salmonella enterica strain SARB71
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268648_604401 Salmonella enterica strain SARB72
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268649_604402 Salmonella enterica strain SARB45
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268650_604403 Salmonella enterica strain SARB46
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268651_604404 Salmonella enterica strain SARB26
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268652_604405 Salmonella enterica strain SARB62
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268653_604406 Salmonella enterica strain SARB14
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268654_604407 Salmonella enterica strain SARB18
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268656_604409 Salmonella enterica strain SARB52
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268657_604410 Salmonella enterica strain SARB51
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268658_604411 Salmonella enterica strain SARB16
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268659_604412 Salmonella enterica strain SARB07
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268660_604413 Salmonella enterica strain SARB59
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268661_604414 Salmonella enterica strain SARB39
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268663_604416 Salmonella enterica strain SARB44
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268664_604417 Salmonella enterica strain SARB12
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268665_604418 Salmonella enterica strain SARB55
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268666_604419 Salmonella enterica strain SARB56
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268667_604420 Salmonella enterica strain SARB60
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268668_604421 Salmonella enterica strain SARB23
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268669_604422 Salmonella enterica strain SARB24
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268670_604423 Salmonella enterica strain SARB67
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268671_604424 Salmonella enterica strain SARB68
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268672_604425 Salmonella enterica strain SARB22
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268673_604426 Salmonella enterica strain SARB65
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268674_604427 Salmonella enterica strain SARB66
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268675_604428 Salmonella enterica strain SARB34
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268677_604430 Salmonella enterica strain SARB11
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268681_604434 Salmonella enterica strain SARB47
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268682_604435 Salmonella enterica strain SARB05
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268683_604436 Salmonella enterica strain SARB10
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268684_604437 Salmonella enterica strain SARB28
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268685_604438 Salmonella enterica strain SARB41
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268686_604439 Salmonella enterica strain SARB40
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268688_604441 Salmonella enterica strain SARB53
            malate dehydrogenase (mdh) gene, partial
            cds.>gb:AY268689_604442 Salmonella enterica strain SARB20
            malate dehydrogenase (mdh) gene, partial cds.
          Length = 277

 Score =  258 bits (660), Expect = 2e-67
 Identities = 146/265 (55%), Positives = 177/265 (66%), Gaps = 1/265 (0%)
 Frame = +2

Query: 290  PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKP 466
            P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGADVV+I AGV RKP
Sbjct: 3    PSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGADVVLISAGVARKP 61

Query: 467  GMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRL 646
            GM R DLFN+NAGIVK+L   IAK CP A V +I+NPVN+TV IAAEV KKAG YD+ +L
Sbjct: 62   GMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNPVNTTVAIAAEVLKKAGVYDKNKL 121

Query: 647  FGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGL 826
            FGVTTLD++R+ TF                IGGH+G+TILPL SQ  P  +        L
Sbjct: 122  FGVTTLDIIRSNTFVAELKGKLPTEVEVPVIGGHSGVTILPLLSQ-IPGVSFTEQEAAEL 180

Query: 827  TKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELP 1006
            TKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VVEC++V+       
Sbjct: 181  TKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEKGVVECAYVEGDGQYAR 240

Query: 1007 FFASKVRLGKNGVEEVLGLGSLTDF 1081
            FF+  + LGKNGVEE   +G+L+ F
Sbjct: 241  FFSQPLLLGKNGVEERKSIGTLSAF 265



>gb:AF267602_494008 Escherichia coli strain 93-111 malate
            dehydrogenase (mdh) gene, partial cds.>gb:AF267603_494009
            Escherichia coli strain Ok-1 malate dehydrogenase (mdh)
            gene, partial cds.
          Length = 282

 Score =  258 bits (660), Expect = 2e-67
 Identities = 146/273 (53%), Positives = 183/273 (67%), Gaps = 2/273 (0%)
 Frame = +2

Query: 269  SLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVII 442
            +LL+K   P  S LSL++IA  TPGVA D+SHI T  ++ GFSG E+   ALEGADVV+I
Sbjct: 1    ALLLKTQLPSGSKLSLYNIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGADVVLI 59

Query: 443  PAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKA 622
             AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAEV KKA
Sbjct: 60   SAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAEVLKKA 119

Query: 623  GTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANL 802
            G YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  P  + 
Sbjct: 120  GVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-VPGVSF 178

Query: 803  AHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFV 982
                +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VVEC++V
Sbjct: 179  TEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVVECAYV 238

Query: 983  QSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            +       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  EGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 271



>gb:AF267604_494010 Escherichia coli strain DEC3f malate dehydrogenase
            (mdh) gene, partial cds.
          Length = 282

 Score =  258 bits (659), Expect = 2e-67
 Identities = 146/273 (53%), Positives = 182/273 (66%), Gaps = 2/273 (0%)
 Frame = +2

Query: 269  SLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVII 442
            +LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGADVV+I
Sbjct: 1    ALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGADVVLI 59

Query: 443  PAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKA 622
             AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAEV KKA
Sbjct: 60   SAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAEVLKKA 119

Query: 623  GTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANL 802
            G YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  P  + 
Sbjct: 120  GVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-VPGVSF 178

Query: 803  AHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFV 982
                +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VVEC++V
Sbjct: 179  TEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVVECAYV 238

Query: 983  QSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            +       FF+  + L KNGVEE   +G+L+ F
Sbjct: 239  EGDGQYARFFSQPLLLDKNGVEERKSIGTLSAF 271



>gb:AF267617_494023 Escherichia coli strain 921-B4 malate
            dehydrogenase (mdh) gene, partial cds.
          Length = 282

 Score =  258 bits (658), Expect = 3e-67
 Identities = 145/273 (53%), Positives = 183/273 (67%), Gaps = 2/273 (0%)
 Frame = +2

Query: 269  SLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVII 442
            +LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGA+V++I
Sbjct: 1    ALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGANVLLI 59

Query: 443  PAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKA 622
             AGV RKPGM R DLFN+NAGIVK+L   +AK CP A + +I+NPVN+TV IAAEV KKA
Sbjct: 60   SAGVARKPGMDRSDLFNVNAGIVKNLVQQVAKTCPKACIGIITNPVNTTVAIAAEVLKKA 119

Query: 623  GTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANL 802
            G YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL SQ  P  + 
Sbjct: 120  GVYDKNKLFGVTTLDIIRSNTFVAELKGKQPGEVEVPVIGGHSGVTILPLLSQ-VPGVSF 178

Query: 803  AHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFV 982
                +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VVEC++V
Sbjct: 179  TEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEQGVVECAYV 238

Query: 983  QSTVTELPFFASKVRLGKNGVEEVLGLGSLTDF 1081
            +       FF+  + LGKNGVEE   +G+L+ F
Sbjct: 239  EGDGQYARFFSQPLLLGKNGVEERKSIGTLSAF 271



>gb:AY268628_604381 Salmonella enterica strain SARB69 malate
            dehydrogenase (mdh) gene, partial cds.
          Length = 277

 Score =  257 bits (657), Expect = 4e-67
 Identities = 145/265 (54%), Positives = 177/265 (66%), Gaps = 1/265 (0%)
 Frame = +2

Query: 290  PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKP 466
            P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGADVV+I AGV RKP
Sbjct: 3    PSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGADVVLISAGVARKP 61

Query: 467  GMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRL 646
            GM R DLFN+NAGIVK+L   IAK CP A + +I+NPVN+TV IAAEV KKAG YD+ +L
Sbjct: 62   GMDRSDLFNVNAGIVKNLVQQIAKTCPKACMGIITNPVNTTVAIAAEVLKKAGVYDKNKL 121

Query: 647  FGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGL 826
            FGVTTLD++R+ TF                IGGH+G+TILPL SQ  P  +        L
Sbjct: 122  FGVTTLDIIRSNTFVAELKGKLPTEVEVPVIGGHSGVTILPLLSQ-IPGVSFTEQEAAEL 180

Query: 827  TKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELP 1006
            TKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VVEC++V+       
Sbjct: 181  TKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEKGVVECAYVEGDGQYAR 240

Query: 1007 FFASKVRLGKNGVEEVLGLGSLTDF 1081
            FF+  + LGKNGVEE   +G+L+ F
Sbjct: 241  FFSQPLLLGKNGVEERKSIGTLSAF 265



>gb:AY826857_1629163 Heterocapsa triquetra clone HTMD1 malate
            dehydrogenase mRNA, complete cds.
          Length = 402

 Score =  256 bits (654), Expect = 8e-67
 Identities = 150/324 (46%), Positives = 192/324 (59%), Gaps = 10/324 (3%)
 Frame = +2

Query: 218  ERKVAILGAAGGIGQPLSLLMKLNPLVSHLSLFD--IAGTP--GVAADVSHINTRSEVVG 385
            E KV + G AGGIGQPL LLM ++P V  L +FD  +A  P  GVA D+ H+  ++ V G
Sbjct: 80   EFKVCVCGGAGGIGQPLCLLMAMDPNVKELCVFDLNVAMVPAQGVATDLGHLEKKAAVKG 139

Query: 386  FSGD------ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCP 547
            +  +      +NL + L G  +V+IPAG+PRKPG TRDDLF INA I K +  A AKYCP
Sbjct: 140  YVMEVGQKPVDNLEECLTGCHLVLIPAGMPRKPGQTRDDLFKINADIAKGIVEACAKYCP 199

Query: 548  HALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXX 727
             A++ MI NPVNS VP  AE++KK G  D  ++ G+TTLDVVRA  F             
Sbjct: 200  DAMLGMIVNPVNSVVPAMAELYKKKG-LDPMKIVGITTLDVVRANKF-VVRLPAPPDRVN 257

Query: 728  XXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAY 907
               IGGHAG TILPLFSQ      +  + I  L K  QD GT+VV AK GKGSATLSMAY
Sbjct: 258  VPVIGGHAGTTILPLFSQDKHAKTIDAEKIPDLDKHVQDAGTDVVNAKNGKGSATLSMAY 317

Query: 908  AGAIFADACLKGLNGVPDVVECSFVQSTVTELPFFASKVRLGKNGVEEVLGLGSLTDFXX 1087
            AGA    + L GL G     EC++ +S +T+LP+FA KV  GK G+ +VL LG L ++  
Sbjct: 318  AGARLGKSVLAGLAG-QRRTECAYCKSEITDLPYFAQKVVFGKEGISKVLPLGELNEYET 376

Query: 1088 XXXXXXXXXXXXXXXXGIQFANQN 1159
                            G+++A +N
Sbjct: 377  KRLEEVKVQLKGEIESGLKYAEEN 400



>gb:AY268687_604440 Salmonella enterica strain SARB54 malate
            dehydrogenase (mdh) gene, partial cds.
          Length = 277

 Score =  255 bits (652), Expect = 1e-66
 Identities = 145/265 (54%), Positives = 176/265 (66%), Gaps = 1/265 (0%)
 Frame = +2

Query: 290  PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKP 466
            P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGADVV+I AGV RKP
Sbjct: 3    PSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATPALEGADVVLISAGVARKP 61

Query: 467  GMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRL 646
            GM R DLFN+NAGIVK+L   IAK CP A V +I+NPVN+TV IAAEV KKAG YD+ +L
Sbjct: 62   GMDRSDLFNVNAGIVKNLVQQIAKTCPKACVGIITNPVNTTVAIAAEVLKKAGVYDKNKL 121

Query: 647  FGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGL 826
            F VTTLD++R+ TF                IGGH+G+TILPL SQ  P  +        L
Sbjct: 122  FEVTTLDIIRSNTFVAELKGKLPTEVEVPVIGGHSGVTILPLLSQ-IPGVSFTEQEAAEL 180

Query: 827  TKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQSTVTELP 1006
            TKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G   VVEC++V+       
Sbjct: 181  TKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQGEKGVVECAYVEGDGQYAR 240

Query: 1007 FFASKVRLGKNGVEEVLGLGSLTDF 1081
            FF+  + LGKNGVEE   +G+L+ F
Sbjct: 241  FFSQPLLLGKNGVEERKSIGTLSAF 265



>gb:AF208608_488506 Pantoea cedenensis strain 34 malate
           dehydrogenase (mdh) gene, partial cds.
          Length = 253

 Score =  255 bits (652), Expect = 1e-66
 Identities = 140/251 (55%), Positives = 175/251 (69%), Gaps = 2/251 (0%)
 Frame = +2

Query: 239 GAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGK 412
           GAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T   + GF G E+   
Sbjct: 1   GAAGGIGQALALLLKTQLPAGSDLSLYDIAPVTPGVAVDLSHIPTAVNIKGFCG-EDATP 59

Query: 413 ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTV 592
           AL+GADVV+I AGV RKPGM R DLFN+NAGIV++L   +A  CP AL+ +I+NPVN+TV
Sbjct: 60  ALKGADVVLISAGVARKPGMDRSDLFNVNAGIVRNLIEQVANTCPKALIGVITNPVNTTV 119

Query: 593 PIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPL 772
            IAAEV KKAG YD+ RLFGVTTLD++R+ TF                +GGH+G+TILPL
Sbjct: 120 AIAAEVLKKAGVYDKNRLFGVTTLDIIRSNTFVAELKGKNPAELNVPVVGGHSGVTILPL 179

Query: 773 FSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNG 952
            SQ  P  + +   +V LTKR Q+ GTEVVEAKAG G ATLSM  A A F  + ++ +NG
Sbjct: 180 LSQ-VPGVSFSQQEVVDLTKRIQNAGTEVVEAKAGGGXATLSMGQAAAKFGLSLVRAING 238

Query: 953 VPDVVECSFVQ 985
             +VVEC++V+
Sbjct: 239 ESNVVECAYVE 249



>gb:AF208609_488507 Pantoea cedenensis strain 35 malate
           dehydrogenase (mdh) gene, partial cds.
          Length = 253

 Score =  255 bits (651), Expect = 2e-66
 Identities = 139/251 (55%), Positives = 174/251 (69%), Gaps = 2/251 (0%)
 Frame = +2

Query: 239 GAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGK 412
           GAAGGIGQ L+LL+K   P  S LSL+DIA  TPGV  D+SHI T   + GF G++    
Sbjct: 1   GAAGGIGQALALLLKTQLPAGSDLSLYDIAPVTPGVXXDLSHIPTAVNIKGFCGEDGT-P 59

Query: 413 ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTV 592
           AL+GADVV+I AGV RKPGM R DLFN+NAGIV++L   +A  CP AL+ +I+NPVN+TV
Sbjct: 60  ALKGADVVLISAGVARKPGMDRSDLFNVNAGIVRNLIEQVANTCPKALIGVITNPVNTTV 119

Query: 593 PIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPL 772
            IAAEV KKAG YD+ RLFGVTTLD++R+ TF                +GGH+G+TILPL
Sbjct: 120 AIAAEVLKKAGVYDKNRLFGVTTLDIIRSNTFVAELKGKNPAELNVPVVGGHSGVTILPL 179

Query: 773 FSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNG 952
            SQ  P    +   +V LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ +NG
Sbjct: 180 LSQ-VPGVTFSQQEVVDLTKRIQNAGTEVVEAKAGGGSATLSMGQAAAKFGLSLVRAING 238

Query: 953 VPDVVECSFVQ 985
             +VVEC++V+
Sbjct: 239 ESNVVECAYVE 249



>gb:AF208607_488505 Pantoea endophytica strain 3 malate
           dehydrogenase (mdh) gene, partial cds.
          Length = 256

 Score =  254 bits (649), Expect = 3e-66
 Identities = 142/251 (56%), Positives = 174/251 (69%), Gaps = 2/251 (0%)
 Frame = +2

Query: 239 GAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGK 412
           GAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   
Sbjct: 1   GAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDARP 59

Query: 413 ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTV 592
           AL+GADVV+I AGV RKPGM R DLFN+NAGIVK+L   IA+ CP A + +I+NPVN+TV
Sbjct: 60  ALQGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAEVCPKACIGIITNPVNTTV 119

Query: 593 PIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPL 772
            IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL
Sbjct: 120 XIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPTEVEVPVIGGHSGVTILPL 179

Query: 773 FSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNG 952
            SQ  P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G
Sbjct: 180 LSQ-IPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQG 238

Query: 953 VPDVVECSFVQ 985
              VVEC++V+
Sbjct: 239 EKGVVECAYVE 249



>gb:AF208615_488512 Pantoea endophytica strain 47 malate
           dehydrogenase (mdh) gene, partial cds.
          Length = 256

 Score =  252 bits (643), Expect = 2e-65
 Identities = 141/251 (56%), Positives = 173/251 (68%), Gaps = 2/251 (0%)
 Frame = +2

Query: 239 GAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGK 412
           GAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   
Sbjct: 1   GAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDARP 59

Query: 413 ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTV 592
           AL+GADVV+I AGV R PGM R DLFN+NAGIVK+L   IA+ CP A + +I+NPVN+TV
Sbjct: 60  ALQGADVVLISAGVARXPGMDRSDLFNVNAGIVKNLVQQIAEVCPKACIGIITNPVNTTV 119

Query: 593 PIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPL 772
            IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL
Sbjct: 120 AIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPTEVEVPVIGGHSGVTILPL 179

Query: 773 FSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNG 952
            SQ  P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G
Sbjct: 180 LSQ-IPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRXLQG 238

Query: 953 VPDVVECSFVQ 985
              VVEC++V+
Sbjct: 239 EKGVVECAYVE 249



>gb:AF208599_488497 Pantoea endophytica strain 1 malate
           dehydrogenase (mdh) gene, partial cds.
          Length = 256

 Score =  251 bits (641), Expect = 3e-65
 Identities = 140/251 (55%), Positives = 172/251 (68%), Gaps = 2/251 (0%)
 Frame = +2

Query: 239 GAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGK 412
           GAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GF G E+   
Sbjct: 1   GAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFXG-EDARP 59

Query: 413 ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTV 592
           AL+GADVV+I AGV RKPGM R DLFN+NAGIVK+L   IA+ CP A + +I+NPVN+T 
Sbjct: 60  ALQGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAEVCPKACIGIITNPVNTTX 119

Query: 593 PIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPL 772
            IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL
Sbjct: 120 XIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPTEVEVPVIGGHSGVTILPL 179

Query: 773 FSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNG 952
            SQ  P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G
Sbjct: 180 LSQ-IPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQG 238

Query: 953 VPDVVECSFVQ 985
              VVEC++V+
Sbjct: 239 XKGVVECAYVE 249



>gb:AF208604_488502 Pantoea endophytica strain 19 malate
           dehydrogenase (mdh) gene, partial cds.
          Length = 256

 Score =  251 bits (640), Expect = 3e-65
 Identities = 141/251 (56%), Positives = 172/251 (68%), Gaps = 2/251 (0%)
 Frame = +2

Query: 239 GAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGK 412
           GAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   
Sbjct: 1   GAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDARP 59

Query: 413 ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTV 592
           AL+GADVV+I AGV RKPGM R DLFN+NAGIVK+L   IA+ CP A + +I+NPVN+T 
Sbjct: 60  ALQGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAEVCPKACIGIITNPVNTTG 119

Query: 593 PIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPL 772
            IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL
Sbjct: 120 SIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPTEVEVPVIGGHSGVTILPL 179

Query: 773 FSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNG 952
            SQ  P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + +  L G
Sbjct: 180 LSQ-IPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVPALQG 238

Query: 953 VPDVVECSFVQ 985
              VVEC++V+
Sbjct: 239 EKGVVECAYVE 249



>gb:AY839664_647250 Pasteurella trehalosi strain PH246 malate
            dehydrogenase (mdh) gene, mdh3.1 allele, partial cds.
          Length = 257

 Score =  250 bits (638), Expect = 6e-65
 Identities = 147/259 (56%), Positives = 181/259 (69%), Gaps = 4/259 (1%)
 Frame = +2

Query: 251  GIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEG 424
            GIGQ L+LL+KL  P  + LSL+DIA  TPGVA DVSHI T  +V GF+G E+   AL+G
Sbjct: 1    GIGQALALLLKLQLPAGTELSLYDIAPVTPGVAVDVSHIPTAVKVKGFAG-EDPAPALQG 59

Query: 425  ADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAA 604
            AD+V+I AGV RKPGM R DLFNINAGIV++L   +A  CP A V +I+NPVN+TV IAA
Sbjct: 60   ADLVLISAGVARKPGMDRSDLFNINAGIVRNLIEKVAAVCPKACVGIITNPVNTTVAIAA 119

Query: 605  EVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQA 784
            EV KKAG YD+++LFGVT+LDV+R++TF                IGGH+G+TILPL SQA
Sbjct: 120  EVLKKAGVYDKRKLFGVTSLDVLRSETFVAELKGKDVNNVRVPVIGGHSGVTILPLLSQA 179

Query: 785  TPQANLAH--DVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVP 958
            T    +A   + +  LTKR Q+ GTEVVEAKAG GSATLSMA A A FA + LKGL+G  
Sbjct: 180  TETDKIAFTAEEVEALTKRIQNAGTEVVEAKAGGGSATLSMAQAAARFARSVLKGLSG-E 238

Query: 959  DVVECSFVQSTVTELPFFA 1015
             VVE ++V+       FFA
Sbjct: 239  HVVEFAYVEGDGKYARFFA 257



>gb:AF208612_488510 Pantoea endophytica strain 45 malate
           dehydrogenase (mdh) gene, partial cds.
          Length = 256

 Score =  250 bits (638), Expect = 6e-65
 Identities = 140/251 (55%), Positives = 172/251 (68%), Gaps = 2/251 (0%)
 Frame = +2

Query: 239 GAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGK 412
           GAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   
Sbjct: 1   GAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDARP 59

Query: 413 ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTV 592
           AL+GADVV+I AGV R PGM R DLFN+NAGIVK+L   IA+ CP A + +I+NPVN+TV
Sbjct: 60  ALQGADVVLISAGVARXPGMDRSDLFNVNAGIVKNLVQQIAEVCPKACIGIITNPVNTTV 119

Query: 593 PIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPL 772
            IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILP 
Sbjct: 120 AIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPTEVEVPVIGGHSGVTILPX 179

Query: 773 FSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNG 952
            SQ  P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G
Sbjct: 180 LSQ-IPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRXLQG 238

Query: 953 VPDVVECSFVQ 985
              VVEC++V+
Sbjct: 239 EKGVVECAYVE 249



>gb:AF208602_488500 Pantoea endophytica strain 17 malate
           dehydrogenase (mdh) gene, partial cds.
          Length = 256

 Score =  250 bits (638), Expect = 6e-65
 Identities = 140/251 (55%), Positives = 172/251 (68%), Gaps = 2/251 (0%)
 Frame = +2

Query: 239 GAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGK 412
           GAAGGIGQ L+LL+K   P  S LS +DIA  TPGVA D+SHI T  ++ GFSG E+   
Sbjct: 1   GAAGGIGQALALLLKTQLPSGSELSXYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDARP 59

Query: 413 ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTV 592
           AL+GADVV+I AGV R PGM R DLFN+NAGIVK+L   IA+ CP A + +I+NPVN+TV
Sbjct: 60  ALQGADVVLISAGVARXPGMDRSDLFNVNAGIVKNLVQQIAEVCPKACIGIITNPVNTTV 119

Query: 593 PIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPL 772
            IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL
Sbjct: 120 AIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPTEVEVPVIGGHSGVTILPL 179

Query: 773 FSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNG 952
            SQ  P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G
Sbjct: 180 LSQ-IPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRXLQG 238

Query: 953 VPDVVECSFVQ 985
              VVEC++V+
Sbjct: 239 EKGVVECAYVE 249



>gb:AF208611_488509 Pantoea toletana strain 37 malate dehydrogenase
           (mdh) gene, partial cds.
          Length = 256

 Score =  248 bits (633), Expect = 2e-64
 Identities = 138/251 (54%), Positives = 174/251 (69%), Gaps = 2/251 (0%)
 Frame = +2

Query: 239 GAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGK 412
           GAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   
Sbjct: 1   GAAGGIGQALALLLKTQLPAGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDATP 59

Query: 413 ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTV 592
           AL+GADVV+I AGV RKPGM R DLFN+NAGIV++L   +A   P AL+ +I+NPVN+T 
Sbjct: 60  ALKGADVVLISAGVARKPGMDRSDLFNVNAGIVRNLIEQVASTSPKALIGIITNPVNTTR 119

Query: 593 PIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPL 772
            IAA+V KKAG YD+ +LFGVTTLD++RA TF                +GGH+G+TILPL
Sbjct: 120 AIAADVLKKAGVYDKNKLFGVTTLDIIRANTFVAELKGKQPEDLNVPVVGGHSGVTILPL 179

Query: 773 FSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNG 952
            SQ  P  + +   +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G
Sbjct: 180 LSQ-IPGVSFSEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALKG 238

Query: 953 VPDVVECSFVQ 985
             +VVEC++V+
Sbjct: 239 ESNVVECAYVE 249



>gb:AF208603_488501 Pantoea endophytica strain 18 malate
           dehydrogenase (mdh) gene, partial cds.
          Length = 256

 Score =  248 bits (633), Expect = 2e-64
 Identities = 139/251 (55%), Positives = 170/251 (67%), Gaps = 2/251 (0%)
 Frame = +2

Query: 239 GAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGK 412
           G AGGIGQ L LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   
Sbjct: 1   GXAGGIGQALXLLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDARP 59

Query: 413 ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTV 592
           AL+GADVV+I AGV R PGM R DLFN+NAGIVK+L   IA+ CP A + +I+NPVN+TV
Sbjct: 60  ALQGADVVLISAGVARXPGMDRSDLFNVNAGIVKNLVQQIAEVCPKACIGIITNPVNTTV 119

Query: 593 PIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPL 772
            IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILP 
Sbjct: 120 AIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPTEVEVPVIGGHSGVTILPX 179

Query: 773 FSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNG 952
            SQ  P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G
Sbjct: 180 LSQ-IPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRXLQG 238

Query: 953 VPDVVECSFVQ 985
              VVEC++V+
Sbjct: 239 EKGVVECAYVE 249



>gb:AF208600_488498 Pantoea endophytica strain 11 malate
           dehydrogenase (mdh) gene, partial cds.
          Length = 256

 Score =  248 bits (633), Expect = 2e-64
 Identities = 139/251 (55%), Positives = 171/251 (68%), Gaps = 2/251 (0%)
 Frame = +2

Query: 239 GAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGK 412
           GAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   
Sbjct: 1   GAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDARP 59

Query: 413 ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTV 592
           AL+GADVV+I AGV RKPGM R DLFN+NAGIVK+L   IA+ CP A + +I+NPVN+TV
Sbjct: 60  ALQGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAEVCPKACIGIITNPVNTTV 119

Query: 593 PIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPL 772
            IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILP 
Sbjct: 120 AIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPTEVEVPVIGGHSGVTILPX 179

Query: 773 FSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNG 952
            SQ  P  +     +  LTKR Q+  TEVVEAKAG GSATLSM  A A F  + ++ L G
Sbjct: 180 LSQ-IPGVSFTEQEVADLTKRIQNAXTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQG 238

Query: 953 VPDVVECSFVQ 985
              VVEC++ +
Sbjct: 239 EKGVVECAYXE 249



>gb:AF208620_488516 Pantoea agglomerans strain ATCC27155 malate
           dehydrogenase (mdh) gene, partial cds.
          Length = 256

 Score =  247 bits (630), Expect = 5e-64
 Identities = 140/251 (55%), Positives = 172/251 (68%), Gaps = 2/251 (0%)
 Frame = +2

Query: 239 GAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGK 412
           GAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T   + GFSG E+   
Sbjct: 1   GAAGGIGQALALLLKTQLPAGSELSLYDIAPVTPGVAVDLSHIPTAVAIQGFSG-EDATP 59

Query: 413 ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTV 592
           AL+GADVV+I AGV RKPGM R DLFN+NAGIV++L   +A   P AL+ +I+NPVN+TV
Sbjct: 60  ALQGADVVLISAGVARKPGMDRADLFNVNAGIVRNLIEQVATTAPKALIGVITNPVNTTV 119

Query: 593 PIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPL 772
            IAAEV KK G YD+ RLFGVTTLD++RA TF                IGGH+G+TILPL
Sbjct: 120 AIAAEVLKKHGVYDKNRLFGVTTLDIIRANTFVAALKGKQPDQVEVPVIGGHSGVTILPL 179

Query: 773 FSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNG 952
            SQ     + +   +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G
Sbjct: 180 XSQ-VKGVSFSDQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALKG 238

Query: 953 VPDVVECSFVQ 985
             +VVEC++V+
Sbjct: 239 EANVVECAYVE 249



>gb:AF208605_488503 Pantoea agglomerans strain 22 malate
           dehydrogenase (mdh) gene, partial cds.
          Length = 256

 Score =  247 bits (630), Expect = 5e-64
 Identities = 139/251 (55%), Positives = 172/251 (68%), Gaps = 2/251 (0%)
 Frame = +2

Query: 239 GAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGK 412
           GAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T   + GFSG E+   
Sbjct: 1   GAAGGIGQALALLLKTQLPAXSELSLYDIAPVTPGVAVDLSHIPTAVAIQGFSG-EDATP 59

Query: 413 ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTV 592
           +L+GADVV+I AGV RKPGM R DLFN+NAGIV++L   +A   P AL+ +I+NPVN+TV
Sbjct: 60  SLQGADVVLISAGVARKPGMDRADLFNVNAGIVRNLIEQVATTAPKALIGVITNPVNTTV 119

Query: 593 PIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPL 772
            IAAEV KK G YD+ RLFGVTTLD++RA TF                IGGH+G+TILPL
Sbjct: 120 AIAAEVLKKHGVYDKNRLFGVTTLDIIRANTFVAALKGKQPDQVEVPVIGGHSGVTILPL 179

Query: 773 FSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNG 952
            SQ     + +   +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G
Sbjct: 180 LSQ-VKGVSFSDQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALKG 238

Query: 953 VPDVVECSFVQ 985
             +VVEC++V+
Sbjct: 239 EANVVECAYVE 249



>gb:AF208619_488515 Erwinia herbicola strain NCPPB 2971 malate
           dehydrogenase (mdh) gene, partial cds.
          Length = 256

 Score =  246 bits (629), Expect = 6e-64
 Identities = 140/251 (55%), Positives = 171/251 (68%), Gaps = 2/251 (0%)
 Frame = +2

Query: 239 GAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGK 412
           GAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T   + GFSG E+   
Sbjct: 1   GAAGGIGQALALLLKTQLPAGSELSLYDIAPVTPGVAVDLSHIPTAVAIQGFSG-EDATP 59

Query: 413 ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTV 592
           AL+GADVV+I AGV RKPGM R DLFN+NAGIV++L   +A   P AL+ +I+NPVN+TV
Sbjct: 60  ALQGADVVLISAGVARKPGMDRADLFNVNAGIVRNLIEQVATTAPKALIGVITNPVNTTV 119

Query: 593 PIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPL 772
            IAAEV KK G YD+ RLFGVTTLD++RA TF                IGGH+G+TILPL
Sbjct: 120 AIAAEVLKKHGVYDKNRLFGVTTLDIIRANTFVAALKGKQPDQVEVPVIGGHSGVTILPL 179

Query: 773 FSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNG 952
            SQ       +   +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G
Sbjct: 180 LSQ-VKGVXFSDQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALKG 238

Query: 953 VPDVVECSFVQ 985
             +VVEC++V+
Sbjct: 239 EANVVECAYVE 249



>gb:AF208601_488499 Pantoea endophytica strain 16 malate
           dehydrogenase (mdh) gene, partial cds.
          Length = 256

 Score =  246 bits (629), Expect = 6e-64
 Identities = 139/251 (55%), Positives = 171/251 (68%), Gaps = 2/251 (0%)
 Frame = +2

Query: 239 GAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGK 412
           GAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   
Sbjct: 1   GAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDARP 59

Query: 413 ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTV 592
           AL+GADVV+I AGV R PGM R DLFN+NAGIVK+L   IA+ CP A + +I+NPVN+TV
Sbjct: 60  ALQGADVVLISAGVARXPGMDRSDLFNVNAGIVKNLVQQIAEVCPKACIGIITNPVNTTV 119

Query: 593 PIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPL 772
            IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TIL  
Sbjct: 120 AIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPTEVEVPVIGGHSGVTILXF 179

Query: 773 FSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNG 952
            SQ  P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G
Sbjct: 180 XSQ-IPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRXLQG 238

Query: 953 VPDVVECSFVQ 985
              VVEC++V+
Sbjct: 239 EKGVVECAYVE 249



>gb:AF208613_488511 Pantoea endophytica strain 46 malate
           dehydrogenase (mdh) gene, partial cds.
          Length = 256

 Score =  246 bits (627), Expect = 1e-63
 Identities = 138/251 (54%), Positives = 171/251 (68%), Gaps = 2/251 (0%)
 Frame = +2

Query: 239 GAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGK 412
           G+AGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   
Sbjct: 1   GSAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDARP 59

Query: 413 ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTV 592
           AL+GADVV+I AGV R PGM R DLFN+NAGIVK+L   IA+ CP A + +I+NPVN+TV
Sbjct: 60  ALQGADVVLISAGVARXPGMDRSDLFNVNAGIVKNLVQQIAEVCPKACIGIITNPVNTTV 119

Query: 593 PIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPL 772
            IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TIL  
Sbjct: 120 AIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPTEVEVPVIGGHSGVTILXX 179

Query: 773 FSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNG 952
            SQ  P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G
Sbjct: 180 LSQ-IPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALQG 238

Query: 953 VPDVVECSFVQ 985
              VVEC++V+
Sbjct: 239 EKGVVECAYVE 249



>gb:AF208617_488513 Pantoea endophytica strain 8 malate
           dehydrogenase (mdh) gene, partial cds.
          Length = 256

 Score =  245 bits (626), Expect = 1e-63
 Identities = 140/251 (55%), Positives = 170/251 (67%), Gaps = 2/251 (0%)
 Frame = +2

Query: 239 GAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGK 412
           GAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T  ++ GFSG E+   
Sbjct: 1   GAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHIPTAVKIKGFSG-EDARX 59

Query: 413 ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTV 592
           AL+GADVV+I AGV RKPGM R DLFN+NAGIVK+L   IA+ CP A + +I+NPVN+T 
Sbjct: 60  ALQGADVVLISAGVARKPGMDRSDLFNVNAGIVKNLVQQIAEVCPKACIGIITNPVNTTX 119

Query: 593 PIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPL 772
            IAAEV KKAG YD+ +LFGVTTLD++R+ TF                IGGH+G+TILPL
Sbjct: 120 XIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKGKQPTEVEVPVIGGHSGVTILPL 179

Query: 773 FSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNG 952
            SQ  P  +     +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  +      G
Sbjct: 180 LSQ-IPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLGSRPAG 238

Query: 953 VPDVVECSFVQ 985
              VVEC++V+
Sbjct: 239 EKGVVECAYVE 249



>gb:AF208606_488504 Pantoea agglomerans strain 28 malate
           dehydrogenase (mdh) gene, partial cds.
          Length = 256

 Score =  244 bits (623), Expect = 3e-63
 Identities = 138/251 (54%), Positives = 171/251 (68%), Gaps = 2/251 (0%)
 Frame = +2

Query: 239 GAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGK 412
           GAAGGIGQ L+LL+K   P    LSL+DIA  TPGVA D+SHI T   + GFSG E+   
Sbjct: 1   GAAGGIGQALALLLKXQLPAGXELSLYDIAPVTPGVAVDLSHIPTAVAIQGFSG-EDATP 59

Query: 413 ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTV 592
           AL+GADVV+I AGV RKPGM R DLFN+NAGIV++L   +A   P AL+ +I+NPVN+TV
Sbjct: 60  ALQGADVVLISAGVARKPGMDRADLFNVNAGIVRNLIEQVATTAPKALIGVITNPVNTTV 119

Query: 593 PIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPL 772
            IAAEV KK G YD+ RLFGVTTLD++RA TF                IGGH+G+TILP+
Sbjct: 120 AIAAEVLKKHGAYDKNRLFGVTTLDIIRANTFVAALKGKQPDQVEVPVIGGHSGVTILPV 179

Query: 773 FSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNG 952
            SQ     + +   +  LTKR Q+ GTEVVEAKAG GSATLSM  A A F  + ++ L G
Sbjct: 180 XSQ-VKGVSFSDQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVRALKG 238

Query: 953 VPDVVECSFVQ 985
             +VVEC++V+
Sbjct: 239 EANVVECAYVE 249



>gb:AF208610_488508 Pantoea oleae strain 36 malate dehydrogenase
           (mdh) gene, partial cds.
          Length = 256

 Score =  241 bits (615), Expect = 3e-62
 Identities = 134/251 (53%), Positives = 169/251 (67%), Gaps = 2/251 (0%)
 Frame = +2

Query: 239 GAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGK 412
           GAAGGIGQ L+LL+K   P  S LSL+DIA  TPGVA D+SHI T   + GFSG E+   
Sbjct: 1   GAAGGIGQALALLLKTQLPAGSELSLYDIAPVTPGVAVDLSHIPTAVSIKGFSG-EDATP 59

Query: 413 ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTV 592
           AL+GA+VV+I  GV R PGM R DLFN+NAGIV++L   +A  CP AL+ +I+NPVN+TV
Sbjct: 60  ALQGANVVLIXXGVARXPGMDRSDLFNVNAGIVRNLIQQVADTCPQALIGVITNPVNTTV 119

Query: 593 PIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPL 772
            IAAEV KKAG YD+ +LFGVTTLD++RA TF                +GGH+G+TILP 
Sbjct: 120 AIAAEVLKKAGVYDKNKLFGVTTLDIIRANTFVAELKGKNPGELNVPVVGGHSGVTILPX 179

Query: 773 FSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNG 952
            SQ     + +   +  LTK  Q+ GTEVVEAKAG G  TLSM  A A F  + ++ LNG
Sbjct: 180 LSQ-IQGVSFSEQEVSDLTKHIQNAGTEVVEAKAGGGXXTLSMGQAAARFGLSLVRALNG 238

Query: 953 VPDVVECSFVQ 985
             +VVEC++V+
Sbjct: 239 ESNVVECAYVE 249



>gb:CR382138_1671085 Debaryomyces hansenii chromosome F of strain
           CBS767 of Debaryomyces hansenii.
          Length = 346

 Score =  241 bits (614), Expect = 3e-62
 Identities = 138/258 (53%), Positives = 169/258 (65%), Gaps = 15/258 (5%)
 Frame = +2

Query: 224 KVAILGAAGGIGQPLSLLMKLNPLVSHLSLFDIAGTPGVAADVSHINTRSEVVGFSGD-- 397
           KV + GAAGGIGQPLSLL+KLNP VS LSLFD+    GVAAD+SHI + ++V G+     
Sbjct: 3   KVTVCGAAGGIGQPLSLLLKLNPQVSELSLFDVVNANGVAADLSHICSPAKVTGYQPSSK 62

Query: 398 ---ENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMI 568
              + + KAL  +D+V+IPAGVPRKPGMTR DLFNINA I++ +  +I K CP+A + +I
Sbjct: 63  EDRDTIQKALVNSDLVVIPAGVPRKPGMTRADLFNINASIIRDIVGSIGKACPNAAILII 122

Query: 569 SNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFY--XXXXXXXXXXXXXXXIG 742
           SNPVNSTVPIAAEV KK G ++ K+LFGVTTLD VRA+TF                  IG
Sbjct: 123 SNPVNSTVPIAAEVLKKLGVFNPKKLFGVTTLDSVRAETFLGELIKETPTSLKGQISVIG 182

Query: 743 GHAGITILPLFSQATPQANLAHDVIVGLTK--------RTQDGGTEVVEAKAGKGSATLS 898
           GH+G TI+PL         L    + GL+K        R Q GG EVV+AK G GSATLS
Sbjct: 183 GHSGDTIVPLVHATA----LVAKKVSGLSKSQYNEFIHRVQFGGDEVVKAKNGAGSATLS 238

Query: 899 MAYAGAIFADACLKGLNG 952
           MAYAG  FA+  +  LNG
Sbjct: 239 MAYAGYRFAEKVIGSLNG 256



>gb:AY839663_647249 Mannheimia glucosida strain PH344 malate
            dehydrogenase (mdh) gene, mdh2.2 allele, partial cds.
          Length = 260

 Score =  236 bits (603), Expect = 7e-61
 Identities = 142/261 (54%), Positives = 175/261 (67%), Gaps = 7/261 (2%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+KLN P  S LSL+DI+  TPG+A D+SHI T  +V GF+G++   +AL+ A
Sbjct: 2    IGQSLALLLKLNLPAKSELSLYDISPITPGIAVDLSHIPTDVKVTGFAGEDPT-EALKDA 60

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGMTR DLFN+NA IV +L    AK CP A + +I+NPVN+ +PIAAE
Sbjct: 61   DVVVISAGVARKPGMTRADLFNVNATIVYNLVEKAAKVCPKACIAIITNPVNTIIPIAAE 120

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLDV+RA TF                IGGH+G TILPL SQAT
Sbjct: 121  VLKKAGVYDKNKLFGVTTLDVIRANTFVAEAKDVNVKYVRVPVIGGHSGTTILPLLSQAT 180

Query: 788  P---QANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVP 958
                +     + I  LT R Q+ GTEVVEAKAG GSATLSMA AGA FA   ++ L G  
Sbjct: 181  VNGLKLEFTQEQIEQLTHRIQNAGTEVVEAKAGGGSATLSMAQAGAEFALGLVRALIG-E 239

Query: 959  DVVECSFVQST--VTELPFFA 1015
            DV+  ++V +T   T   FFA
Sbjct: 240  DVIRYAYVDNTNGETSPAFFA 260



>sp|P61896|MDH_KLEVA Malate dehydrogenase (EC 1.1.1.37)
           (Fragment).>gb:AY367378_613448 Klebsiella variicola
           strain 801 Mdh gene, partial cds.
          Length = 232

 Score =  235 bits (600), Expect = 1e-60
 Identities = 128/227 (56%), Positives = 158/227 (69%), Gaps = 1/227 (0%)
 Frame = +2

Query: 308 SLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDD 484
           SL+DIA  TPGVA D+SHI T  ++ GFSG E+   ALEGADVV+I AGV RKPGM R D
Sbjct: 1   SLYDIAPVTPGVAVDLSHIPTDVKIKGFSG-EDATPALEGADVVLISAGVARKPGMDRSD 59

Query: 485 LFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTL 664
           LFN+NAGIVK+L   IAK CP A + +I+NPVN+TV IAAEV KKAG YD+ +LFGVTTL
Sbjct: 60  LFNVNAGIVKNLVQQIAKTCPQACIGVITNPVNTTVAIAAEVLKKAGVYDKNKLFGVTTL 119

Query: 665 DVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQD 844
           D++R+ TF                IGGH+G+TILPL SQ  P  + +   +  LTKR Q+
Sbjct: 120 DIIRSNTFVAELKGKSATEVEVPVIGGHSGVTILPLLSQ-IPGVSFSDQEVADLTKRIQN 178

Query: 845 GGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQ 985
            GTEVVEAKAG GSATLSM  A A F  + ++ + G   VVEC++V+
Sbjct: 179 AGTEVVEAKAGGGSATLSMGQAAARFGLSLVRAMQGEKGVVECAYVE 225



>gb:AY839662_647248 Mannheimia haemolytica strain PH196 malate
            dehydrogenase (mdh) gene, mdh1.3 allele, partial cds.
          Length = 260

 Score =  233 bits (595), Expect = 6e-60
 Identities = 141/261 (54%), Positives = 173/261 (66%), Gaps = 7/261 (2%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+KLN P  S LSL+DI+  TPG+A D+SHI T  +V GF+G++   +AL+ A
Sbjct: 2    IGQSLALLLKLNLPAKSELSLYDISPVTPGIAVDLSHIPTDVKVTGFAGEDPT-EALKDA 60

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGMTR DLFN NA IV +L    AK CP A + +I+NPVN+ +PIAAE
Sbjct: 61   DVVVISAGVARKPGMTRADLFNTNATIVHNLVEKAAKVCPKACIAIITNPVNTIIPIAAE 120

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLDV+RA TF                IGGH+G TILPL SQAT
Sbjct: 121  VLKKAGVYDKNKLFGVTTLDVIRANTFVAKAKDVNVKYVRVPVIGGHSGTTILPLLSQAT 180

Query: 788  P---QANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVP 958
                +     + I  LT R Q+ GTEVVEAKAG GSATLSMA AGA FA   ++ L G  
Sbjct: 181  VNGLKLEFTQEQIKQLTHRIQNAGTEVVEAKAGGGSATLSMAQAGAEFALGLVRALIG-E 239

Query: 959  DVVECSFVQST--VTELPFFA 1015
            DV+  ++V +    T   FFA
Sbjct: 240  DVIRYAYVDNANGETSPAFFA 260



>gb:AY839657_647243 Mannheimia haemolytica strain PH2 malate
            dehydrogenase (mdh) gene, mdh1.1 allele, partial
            cds.>gb:AY839658_647244 Mannheimia haemolytica strain
            PH66 malate dehydrogenase (mdh) gene, mdh1.4 allele,
            partial cds.>gb:AY839659_647245 Mannheimia haemolytica
            strain PH706 malate dehydrogenase (mdh) gene, mdh1.5
            allele, partial cds.>gb:AY839661_647247 Mannheimia
            haemolytica strain PH494 malate dehydrogenase (mdh) gene,
            mdh1.2 allele, partial cds.
          Length = 260

 Score =  233 bits (595), Expect = 6e-60
 Identities = 141/261 (54%), Positives = 173/261 (66%), Gaps = 7/261 (2%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+KLN P  S LSL+DI+  TPG+A D+SHI T  +V GF+G++   +AL+ A
Sbjct: 2    IGQSLALLLKLNLPAKSELSLYDISPVTPGIAVDLSHIPTDVKVTGFAGEDPT-EALKDA 60

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGMTR DLFN NA IV +L    AK CP A + +I+NPVN+ +PIAAE
Sbjct: 61   DVVVISAGVARKPGMTRADLFNTNATIVHNLVEKAAKVCPKACIAIITNPVNTIIPIAAE 120

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLDV+RA TF                IGGH+G TILPL SQAT
Sbjct: 121  VLKKAGVYDKNKLFGVTTLDVIRANTFVAEAKDVNVKYVRVPVIGGHSGTTILPLLSQAT 180

Query: 788  P---QANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVP 958
                +     + I  LT R Q+ GTEVVEAKAG GSATLSMA AGA FA   ++ L G  
Sbjct: 181  VNGLKLEFTQEQIEQLTHRIQNAGTEVVEAKAGGGSATLSMAQAGAEFALGLVRALIG-E 239

Query: 959  DVVECSFVQST--VTELPFFA 1015
            DV+  ++V +    T   FFA
Sbjct: 240  DVIRYAYVDNANGETSPAFFA 260



>gb:AY839660_647246 Mannheimia haemolytica strain PH588 malate
            dehydrogenase (mdh) gene, mdh2.1 allele, partial cds.
          Length = 260

 Score =  233 bits (594), Expect = 7e-60
 Identities = 141/261 (54%), Positives = 173/261 (66%), Gaps = 7/261 (2%)
 Frame = +2

Query: 254  IGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGKALEGA 427
            IGQ L+LL+KLN P  S LSL+DI+  TPG+A D+SHI    +V GF+G++   +AL+ A
Sbjct: 2    IGQSLALLLKLNLPAKSELSLYDISPVTPGIAVDLSHIPIDVKVTGFAGEDPT-EALKDA 60

Query: 428  DVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTVPIAAE 607
            DVV+I AGV RKPGMTR DLFN NA IV +L    AK CP A + +I+NPVN+ +PIAAE
Sbjct: 61   DVVVISAGVARKPGMTRADLFNTNATIVHNLVEKAAKVCPKACIAIITNPVNTIIPIAAE 120

Query: 608  VFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPLFSQAT 787
            V KKAG YD+ +LFGVTTLDV+RA TF                IGGH+G TILPL SQAT
Sbjct: 121  VLKKAGVYDKNKLFGVTTLDVIRANTFVAEAKDVNVKYVRVPVIGGHSGTTILPLLSQAT 180

Query: 788  P---QANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNGVP 958
                +     + I  LT R Q+ GTEVVEAKAG GSATLSMA AGA FA   ++ L G  
Sbjct: 181  VNGLKLEFTQEQIEQLTHRIQNAGTEVVEAKAGGGSATLSMAQAGAEFALGLVRALIG-E 239

Query: 959  DVVECSFVQST--VTELPFFA 1015
            DV+  ++V +T   T   FFA
Sbjct: 240  DVIRYAYVDNTNGETSPAFFA 260



>gb:AF208618_488514 Pantoea oleae strain 66 malate dehydrogenase
           (mdh) gene, partial cds.
          Length = 256

 Score =  233 bits (594), Expect = 7e-60
 Identities = 131/251 (52%), Positives = 166/251 (66%), Gaps = 2/251 (0%)
 Frame = +2

Query: 239 GAAGGIGQPLSLLMKLN-PLVSHLSLFDIAG-TPGVAADVSHINTRSEVVGFSGDENLGK 412
           GA GGI + L+LL+K   P  S LSL+DIA  TPGVA D+SHI T   + GFSG E+   
Sbjct: 1   GAXGGIXZALALLLKTQLPAGSELSLYDIAPVTPGVAVDLSHIPTAVSIKGFSG-EDATP 59

Query: 413 ALEGADVVIIPAGVPRKPGMTRDDLFNINAGIVKSLSAAIAKYCPHALVNMISNPVNSTV 592
           AL+GA+VV+I  GV R PGM R DLFN+NAGIV++L   +A  CP AL+ +I+NPVN+TV
Sbjct: 60  ALQGANVVLIXXGVARXPGMDRSDLFNVNAGIVRNLIQQVADTCPQALIGVITNPVNTTV 119

Query: 593 PIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTFYXXXXXXXXXXXXXXXIGGHAGITILPL 772
            IAAEV KKAG YD+ +LFGVTTLD++RA TF                +GGH+G+TILPL
Sbjct: 120 AIAAEVLKKAGVYDKNKLFGVTTLDIIRANTFVAELKGKNPGELNVPVVGGHSGVTILPL 179

Query: 773 FSQATPQANLAHDVIVGLTKRTQDGGTEVVEAKAGKGSATLSMAYAGAIFADACLKGLNG 952
            SQ       +   +  LTK  Q+ GTEVVEAKAG G  TLSM  A A F  + ++ LNG
Sbjct: 180 LSQ-IQGVXFSEQEVSDLTKHIQNAGTEVVEAKAGGGXXTLSMGQAAARFGLSLVRALNG 238

Query: 953 VPDVVECSFVQ 985
             +VVE ++V+
Sbjct: 239 ESNVVEXAYVE 249



>sp|P61894|MDH_KLEOX Malate dehydrogenase (EC 1.1.1.37)
           (Fragment).>gb:AY367380_613450 Klebsiella oxytoca strain
           ATCC 13182 Mdh gene, partial cds.
          Length = 223

 Score =  232 bits (591), Expect = 2e-59
 Identities = 124/219 (56%), Positives = 152/219 (69%)
 Frame = +2

Query: 329 TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGI 508
           TPGVA D+SHI T  ++ GFSG E+   ALEGADVV+I AGV RKPGM R DLFN+NAGI
Sbjct: 4   TPGVAVDLSHIPTDVKIKGFSG-EDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGI 62

Query: 509 VKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTF 688
           VK+L   IAK CP A V +I+NPVN+TV IAAEV KKAG YD+ +LFGVTTLD++R+ TF
Sbjct: 63  VKNLVQQIAKTCPQACVGIITNPVNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTF 122

Query: 689 YXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEA 868
                           IGGH+G+TILPL SQ  P  + +   +  LTKR Q+ GTEVVEA
Sbjct: 123 VAELKGKSSSDVEVPVIGGHSGVTILPLLSQ-IPGVSFSEQEVADLTKRIQNAGTEVVEA 181

Query: 869 KAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQ 985
           KAG GSATLSM  A A F  + ++ + G   VVEC++V+
Sbjct: 182 KAGGGSATLSMGQAAARFGLSLVRAMQGEKGVVECAYVE 220



>gb:AY367379_613449 Klebsiella variicola strain F2R9 Mdh gene,
           partial cds.
          Length = 228

 Score =  231 bits (589), Expect = 3e-59
 Identities = 123/219 (56%), Positives = 152/219 (69%)
 Frame = +2

Query: 329 TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGI 508
           TPGVA D+SHI T  ++ GFSG E+   ALEGADVV+I AGV RKPGM R DLFN+NAGI
Sbjct: 6   TPGVAVDLSHIPTDVKIKGFSG-EDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGI 64

Query: 509 VKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTF 688
           VK+L   IAK CP A + +I+NPVN+TV IAAEV KKAG YD+ +LFGVTTLD++R+ TF
Sbjct: 65  VKNLVQQIAKTCPQACIGVITNPVNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTF 124

Query: 689 YXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEA 868
                           IGGH+G+TILPL SQ  P  + +   +  LTKR Q+ GTEVVEA
Sbjct: 125 VAELKGKSATEVEVPVIGGHSGVTILPLLSQ-IPGVSFSDQEVADLTKRIQNAGTEVVEA 183

Query: 869 KAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQ 985
           KAG GSATLSM  A A F  + ++ + G   VVEC++V+
Sbjct: 184 KAGGGSATLSMGQAAARFGLSLVRAMQGEKGVVECAYVE 222



>gb:AY367377_613447 Klebsiella variicola strain 6A2 Mdh gene,
           partial cds.
          Length = 230

 Score =  231 bits (589), Expect = 3e-59
 Identities = 123/219 (56%), Positives = 152/219 (69%)
 Frame = +2

Query: 329 TPGVAADVSHINTRSEVVGFSGDENLGKALEGADVVIIPAGVPRKPGMTRDDLFNINAGI 508
           TPGVA D+SHI T  ++ GFSG E+   ALEGADVV+I AGV RKPGM R DLFN+NAGI
Sbjct: 6   TPGVAVDLSHIPTDVKIKGFSG-EDATPALEGADVVLISAGVARKPGMDRSDLFNVNAGI 64

Query: 509 VKSLSAAIAKYCPHALVNMISNPVNSTVPIAAEVFKKAGTYDEKRLFGVTTLDVVRAKTF 688
           VK+L   IAK CP A + +I+NPVN+TV IAAEV KKAG YD+ +LFGVTTLD++R+ TF
Sbjct: 65  VKNLVQQIAKTCPQACIGVITNPVNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTF 124

Query: 689 YXXXXXXXXXXXXXXXIGGHAGITILPLFSQATPQANLAHDVIVGLTKRTQDGGTEVVEA 868
                           IGGH+G+TILPL SQ  P  + +   +  LTKR Q+ GTEVVEA
Sbjct: 125 VAELKGKSATEVEVPVIGGHSGVTILPLLSQ-IPGVSFSDQEVADLTKRIQNAGTEVVEA 183

Query: 869 KAGKGSATLSMAYAGAIFADACLKGLNGVPDVVECSFVQ 985
           KAG GSATLSM  A A F  + ++ + G   VVEC++V+
Sbjct: 184 KAGGGSATLSMGQAAARFGLSLVRAMQGEKGVVECAYVE 222


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,456,218,922
Number of Sequences: 1806583
Number of extensions: 31186632
Number of successful extensions: 101327
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 92977
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 100150
length of database: 581,917,975
effective HSP length: 128
effective length of database: 350,675,351
effective search space used: 120281645393
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)