BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig4447
         (549 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching.................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY048286_1561747 Arabidopsis thaliana AT4g36960/C7A10_400 mRN...    51   1e-05   
pir|E85436|E85436 RNA-binding like protein [imported] - Arabidop...    51   1e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AP004073_1837335 Oryza sativa (japonica cultivar-group) genom...    50   2e-05   
gb:AP003687_1832090 Oryza sativa (japonica cultivar-group) genom...    45   6e-04   
gb:AE014134_1127924 Drosophila melanogaster chromosome 2L, compl...    35   0.99    
sp|P48809|RB27_DROME|RB27_DROME Heterogeneous nuclear ribonucleoprotein 27C...    35   0.99    Drosophila melanogaster
gb:BC068788_2555288 Xenopus laevis hypothetical protein MGC81335...    32   4.9     
pir|T40627|T40627 probable ribonucleoprotein SPBC660.15 - fissio...    32   4.9     Schizosaccharomyces pombe
gb:BC045335_2549178 Danio rerio musashi homolog 2 (Drosophila), ...    32   6.4     
gb:AB017066_1513387 Arabidopsis thaliana genomic DNA, chromosome...    32   6.4     
gb:S51720_1396592 RNA recognition motif-type RNA-binding protein...    32   8.4     


>gb:AY048286_1561747 Arabidopsis thaliana AT4g36960/C7A10_400 mRNA,
           complete cds.>gb:BT000573_1634851 Arabidopsis thaliana
           RNA-binding like protein (At4g36960/C7A10_400) mRNA,
           complete cds.
          Length = 379

 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 22/33 (66%), Positives = 26/33 (78%)
 Frame = +3

Query: 450 DXKLVVLGIPWDIDTEGLXXYMCXFGELXXCIV 548
           + KLVVLGIPWDID++GL  YM  FG+L  CIV
Sbjct: 2   ERKLVVLGIPWDIDSDGLKDYMSKFGDLEDCIV 34



>pir|E85436|E85436 RNA-binding like protein [imported] - Arabidopsis
           thaliana>gb:ATAP21_1544001 Arabidopsis thaliana DNA
           chromosome 4, ESSA I AP2 contig fragment No.
           1.>gb:ATCHRIV86_1547651 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 86.
          Length = 306

 Score = 50.8 bits (120), Expect = 1e-05
 Identities = 22/33 (66%), Positives = 26/33 (78%)
 Frame = +3

Query: 450 DXKLVVLGIPWDIDTEGLXXYMCXFGELXXCIV 548
           + KLVVLGIPWDID++GL  YM  FG+L  CIV
Sbjct: 2   ERKLVVLGIPWDIDSDGLKDYMSKFGDLEDCIV 34



>gb:AP004073_1837335 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0614D08.
          Length = 363

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 22/31 (70%), Positives = 24/31 (77%)
 Frame = +3

Query: 456 KLVVLGIPWDIDTEGLXXYMCXFGELXXCIV 548
           KLVVLGIPWD+DTEGL  YM  FG L  C+V
Sbjct: 4   KLVVLGIPWDVDTEGLREYMGKFGPLDDCVV 34



>gb:AP003687_1832090 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0660F12.
          Length = 523

 Score = 45.4 bits (106), Expect = 6e-04
 Identities = 19/28 (67%), Positives = 21/28 (75%)
 Frame = +3

Query: 465 VLGIPWDIDTEGLXXYMCXFGELXXCIV 548
           VLGIPWD+DTEGL  YM  FG L  C+V
Sbjct: 167 VLGIPWDVDTEGLREYMGKFGPLDDCVV 194



>gb:AE014134_1127924 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE014134_1127925 Drosophila melanogaster
           chromosome 2L, complete sequence.>gb:AE014134_1127926
           Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003615_1218031 Drosophila melanogaster
           chromosome 2L, section 24 of 83 of the complete
           sequence.>gb:AE003615_1218032 Drosophila melanogaster
           chromosome 2L, section 24 of 83 of the complete
           sequence.>gb:AE003615_1218033 Drosophila melanogaster
           chromosome 2L, section 24 of 83 of the complete
           sequence.>gb:AY069699_1294429 Drosophila melanogaster
           LD46853 full length cDNA.>gb:AY128430_1302065 Drosophila
           melanogaster GH26816 full insert cDNA.
          Length = 421

 Score = 34.7 bits (78), Expect = 0.99
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +3

Query: 456 KLVVLGIPWDIDTEGLXXYMCXFGELXXCIV 548
           KL V G+ W+   E L  Y C FG++  C+V
Sbjct: 8   KLFVGGLSWETTQENLSRYFCRFGDIIDCVV 38



>sp|P48809|RB27_DROME Heterogeneous nuclear ribonucleoprotein 27C
           (hnRNP 48) (HRP48.1).>pir|D41732|D41732 heterogeneous
           nuclear RNP protein - fruit fly (Drosophila
           melanogaster)>gb:DMHRP481_1379619 D.melanogaster mRNA
           for hrp48.1.
          Length = 385

 Score = 34.7 bits (78), Expect = 0.99
 Identities = 13/31 (41%), Positives = 18/31 (58%)
 Frame = +3

Query: 456 KLVVLGIPWDIDTEGLXXYMCXFGELXXCIV 548
           KL V G+ W+   E L  Y C FG++  C+V
Sbjct: 8   KLFVGGLSWETTQENLSRYFCRFGDIIDCVV 38



>gb:BC068788_2555288 Xenopus laevis hypothetical protein MGC81335,
           mRNA (cDNA clone MGC:81335 IMAGE:6633140), complete cds.
          Length = 291

 Score = 32.3 bits (72), Expect = 4.9
 Identities = 12/39 (30%), Positives = 20/39 (51%)
 Frame = +3

Query: 432 PPFTMSDXKLVVLGIPWDIDTEGLXXYMCXFGELXXCIV 548
           P F +   K+ + G+ WD   + L  Y+  FGE+  C +
Sbjct: 27  PDFFLIRSKMFIGGLSWDTSKKDLTEYLSRFGEVLDCTI 65



>pir|T40627|T40627 probable ribonucleoprotein SPBC660.15 - fission
           yeast  (Schizosaccharomyces pombe)>gb:SPBC660_1720341
           S.pombe chromosome II cosmid c660.
          Length = 474

 Score = 32.3 bits (72), Expect = 4.9
 Identities = 13/38 (34%), Positives = 19/38 (50%)
 Frame = +3

Query: 435 PFTMSDXKLVVLGIPWDIDTEGLXXYMCXFGELXXCIV 548
           PF   D K+ + G+ W+   + L  Y   FGE+  C V
Sbjct: 157 PFNREDGKMFIGGLNWETTDDSLRDYFEQFGEVLDCTV 194



>gb:BC045335_2549178 Danio rerio musashi homolog 2 (Drosophila),
           mRNA (cDNA clone MGC:55422 IMAGE:2639351), complete cds.
          Length = 388

 Score = 32.0 bits (71), Expect = 6.4
 Identities = 11/31 (35%), Positives = 17/31 (54%)
 Frame = +3

Query: 456 KLVVLGIPWDIDTEGLXXYMCXFGELXXCIV 548
           K+ + G+ W    + L  Y C FGE+  C+V
Sbjct: 22  KMFIGGLSWQTSPDSLRDYFCKFGEIRECMV 52



>gb:AB017066_1513387 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MGN6.
          Length = 100

 Score = 32.0 bits (71), Expect = 6.4
 Identities = 13/28 (46%), Positives = 17/28 (60%)
 Frame = +3

Query: 450 DXKLVVLGIPWDIDTEGLXXYMCXFGEL 533
           + K+ V G+PW   TEGL  Y   FGE+
Sbjct: 8   ETKIYVAGLPWITRTEGLISYFERFGEI 35



>gb:S51720_1396592 RNA recognition motif-type RNA-binding protein
           {RRM7 clone} [Drosophila melanogaster, mRNA Partial, 132
           nt].
          Length = 44

 Score = 31.6 bits (70), Expect = 8.4
 Identities = 10/26 (38%), Positives = 15/26 (57%)
 Frame = +3

Query: 471 GIPWDIDTEGLXXYMCXFGELXXCIV 548
           G+ W+   E L  Y C FG++  C+V
Sbjct: 4   GLSWETTQENLSRYFCRFGDIIDCVV 29


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 449,091,099
Number of Sequences: 1806583
Number of extensions: 6579258
Number of successful extensions: 15086
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 14740
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15082
length of database: 581,917,975
effective HSP length: 117
effective length of database: 370,547,764
effective search space used: 24085604660
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)