BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig4429
         (593 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AE012554_283703 Xylella fastidiosa Temecula1, section 2 of 9 ...    33   4.6     
gb:AE012453_282574 Xanthomonas campestris pv. campestris str. AT...    33   4.6     
pir|B82740|B82740 two-component system, sensor protein XF0973 [i...    33   4.6     Xylella fastidiosa
gb:AE013598_294816 Xanthomonas oryzae pv. oryzae KACC10331, comp...    32   5.9     
gb:AE011995_278387 Xanthomonas axonopodis pv. citri str. 306, se...    32   5.9     
gb:AF352564_2239687 Pseudorabies virus immediate-early protein I...    32   7.8     
pir|S04713|EDBEIF immediate-early protein IE180 - suid herpesvir...    32   7.8     
sp|P33479|IE18_PRVKA|IE18_PRVKA Immediate-early protein IE180.>pir|A45344|A...    32   7.8     Suid alphaherpesvirus 1
sp|P11675|IE18_PRVIF|IE18_PRVIF Immediate-early protein IE180.>gb:HEPVIE_24...    32   7.8     Suid alphaherpesvirus 1


>gb:AE012554_283703 Xylella fastidiosa Temecula1, section 2 of 9 of
           the complete genome.>gb:AE009442_960279 Xylella
           fastidiosa Temecula1, complete genome.
          Length = 545

 Score = 32.7 bits (73), Expect = 4.6
 Identities = 21/59 (35%), Positives = 30/59 (50%)
 Frame = +1

Query: 4   PTELFEIPLPSLSLYSLHAESALLGLGNPPWMTPEKRLSHLCSSKIHAPTAAAELAVVM 180
           P EL ++  P   L+  +AE  LLG G P     ++RL+HL S K H   +  E   V+
Sbjct: 62  PPELMQVGQPIEDLFRYNAERGLLGDG-PIEEAIQRRLNHLRSGKAHIRESEKEDGTVL 119



>gb:AE012453_282574 Xanthomonas campestris pv. campestris str. ATCC
           33913, section 361 of 460 of the complete
           genome.>gb:AE008922_915856 Xanthomonas campestris pv.
           campestris str. ATCC 33913, complete genome.
          Length = 881

 Score = 32.7 bits (73), Expect = 4.6
 Identities = 21/59 (35%), Positives = 29/59 (49%)
 Frame = +1

Query: 4   PTELFEIPLPSLSLYSLHAESALLGLGNPPWMTPEKRLSHLCSSKIHAPTAAAELAVVM 180
           P EL ++  P   L+  +A   LLG G P     E+RL+HL S K H   +  E   V+
Sbjct: 399 PAELLQVGRPIEDLFRFNARRGLLGPG-PIEAAIERRLNHLRSGKPHMRESEKEDGTVL 456



>pir|B82740|B82740 two-component system, sensor protein XF0973
           [imported] - Xylella fastidiosa (strain
           9a5c)>gb:AE003935_48612 Xylella fastidiosa 9a5c, section
           81 of 229 of the complete genome.>gb:AE003849_1115822
           Xylella fastidiosa 9a5c, complete genome.
          Length = 545

 Score = 32.7 bits (73), Expect = 4.6
 Identities = 21/59 (35%), Positives = 30/59 (50%)
 Frame = +1

Query: 4   PTELFEIPLPSLSLYSLHAESALLGLGNPPWMTPEKRLSHLCSSKIHAPTAAAELAVVM 180
           P EL ++  P   L+  +AE  LLG G P     ++RL+HL S K H   +  E   V+
Sbjct: 62  PPELMQVGQPIEDLFRYNAERGLLGDG-PIEEAIQRRLNHLRSGKAHIRESEKEDGTVL 119



>gb:AE013598_294816 Xanthomonas oryzae pv. oryzae KACC10331,
           complete genome.
          Length = 881

 Score = 32.3 bits (72), Expect = 5.9
 Identities = 22/59 (37%), Positives = 29/59 (49%)
 Frame = +1

Query: 4   PTELFEIPLPSLSLYSLHAESALLGLGNPPWMTPEKRLSHLCSSKIHAPTAAAELAVVM 180
           P EL +I  P   L+  +A   LLG G P     E+RL+HL S K H   +  E   V+
Sbjct: 399 PQELLKIGRPIEDLFRFNARRGLLGPG-PIEAAIERRLNHLRSGKPHMRESEKEDGTVL 456



>gb:AE011995_278387 Xanthomonas axonopodis pv. citri str. 306,
           section 373 of 469 of the complete
           genome.>gb:AE008923_920162 Xanthomonas axonopodis pv.
           citri str. 306, complete genome.
          Length = 880

 Score = 32.3 bits (72), Expect = 5.9
 Identities = 22/59 (37%), Positives = 29/59 (49%)
 Frame = +1

Query: 4   PTELFEIPLPSLSLYSLHAESALLGLGNPPWMTPEKRLSHLCSSKIHAPTAAAELAVVM 180
           P EL +I  P   L+  +A   LLG G P     E+RL+HL S K H   +  E   V+
Sbjct: 398 PPELLKIGRPIEDLFRFNARRGLLGPG-PIEAAIERRLNHLRSGKPHMRESEKEDGTVL 455



>gb:AF352564_2239687 Pseudorabies virus immediate-early protein
           IE180 gene, complete cds.
          Length = 1454

 Score = 32.0 bits (71), Expect = 7.8
 Identities = 13/36 (36%), Positives = 20/36 (55%)
 Frame = +1

Query: 43  LYSLHAESALLGLGNPPWMTPEKRLSHLCSSKIHAP 150
           +YS  A  A+  L NP    P++R +  C  ++HAP
Sbjct: 557 IYSGAAGEAMSWLQNPRMQAPDQRFNQFCQRRVHAP 592



>pir|S04713|EDBEIF immediate-early protein IE180 - suid herpesvirus
           1 (strain Indiana-Funkhauser)
          Length = 1460

 Score = 32.0 bits (71), Expect = 7.8
 Identities = 13/36 (36%), Positives = 20/36 (55%)
 Frame = +1

Query: 43  LYSLHAESALLGLGNPPWMTPEKRLSHLCSSKIHAP 150
           +YS  A  A+  L NP    P++R +  C  ++HAP
Sbjct: 560 IYSGAAGEAMSWLQNPRMQAPDQRFNQFCQRRVHAP 595



>sp|P33479|IE18_PRVKA Immediate-early protein
           IE180.>pir|A45344|A45344 immediate-early protein - suid
           herpesvirus 1 (strain Kaplan)>gb:SH1PROIE_2451279
           Pseudorabies virus with upstream and downsteam
           sequences.
          Length = 1446

 Score = 32.0 bits (71), Expect = 7.8
 Identities = 13/36 (36%), Positives = 20/36 (55%)
 Frame = +1

Query: 43  LYSLHAESALLGLGNPPWMTPEKRLSHLCSSKIHAP 150
           +YS  A  A+  L NP    P++R +  C  ++HAP
Sbjct: 549 IYSGAAGEAMSWLQNPRMQAPDQRFNQFCQRRVHAP 584



>sp|P11675|IE18_PRVIF Immediate-early protein
           IE180.>gb:HEPVIE_2409042 Pseudorabies virus
           immediate-early gene.
          Length = 1461

 Score = 32.0 bits (71), Expect = 7.8
 Identities = 13/36 (36%), Positives = 20/36 (55%)
 Frame = +1

Query: 43  LYSLHAESALLGLGNPPWMTPEKRLSHLCSSKIHAP 150
           +YS  A  A+  L NP    P++R +  C  ++HAP
Sbjct: 560 IYSGAAGEAMSWLQNPRMQAPDQRFNQFCQRRVHAP 595


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 544,929,749
Number of Sequences: 1806583
Number of extensions: 9454339
Number of successful extensions: 26994
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 26529
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26989
length of database: 581,917,975
effective HSP length: 118
effective length of database: 368,741,181
effective search space used: 29130553299
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)