BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig4367
         (764 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AF030879_1762513 Solanum tuberosum protein kinase CPK1 mRNA, ...   162   6e-39   
gb:AF435451_1799831 Nicotiana tabacum calcium-dependent protein ...   155   1e-36   
pir|T00835|T00835 calcium-dependent protein kinase homolog At2g1...   133   3e-30   Arabidopsis thaliana [mouse-ear cress]
gb:AY085837_1570902 Arabidopsis thaliana clone 18901 mRNA, compl...   129   6e-29   
gb:AB011474_1511365 Arabidopsis thaliana genomic DNA, chromosome...   129   6e-29   
pir|T05500|T05500 calcium-dependent protein kinase homolog T19K4...   125   6e-28   Arabidopsis thaliana [mouse-ear cress]
gb:AF194414_1775677 Oryza sativa calcium-dependent protein kinas...   125   8e-28   
gb:AP005311_1850369 Oryza sativa (japonica cultivar-group) genom...   110   4e-23   
gb:AP005311_1850368 Oryza sativa (japonica cultivar-group) genom...   110   4e-23   
gb:AF194413_1775676 Oryza sativa calcium-dependent protein kinas...   109   6e-23   
gb:AY664415_1620630 Zea mays cultivar B73 locus 9009, complete s...    70   3e-11   
gb:AY312268_1598242 Cicer arietinum calcium-dependent calmodulin...    70   6e-11   
gb:AP004309_1840019 Oryza sativa (japonica cultivar-group) genom...    69   7e-11   
gb:AF435452_1799832 Nicotiana tabacum calcium/calmodulin-depende...    69   7e-11   
gb:ATCRK_1548021 A.thaliana mRNA for CDPK-related protein kinase...    69   1e-10   
pir|D96532|D96532 probable CDPK-related protein kinase [imported...    69   1e-10   Arabidopsis thaliana [mouse-ear cress]
pir|T46084|T46084 CDPK-related protein kinase - Arabidopsis thal...    69   1e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AE016959_1023387 Oryza sativa (japonica cultivar-group) chrom...    67   3e-10   
pir|T51264|T51264 calcium-dependent protein kinase-like - Arabid...    67   3e-10   Arabidopsis thaliana [mouse-ear cress]
pir|T45842|T45842 calcium dependent protein kinase-like - Arabid...    67   3e-10   Arabidopsis thaliana [mouse-ear cress]
gb:AF368282_1791894 Oryza sativa CaMK1 (CaMK1) mRNA, complete cds.     67   4e-10   
pir|T02105|T02105 calcium-dependent protein kinase (EC 2.7.1.-) ...    67   4e-10   Arabidopsis thaliana [mouse-ear cress]
sp|P53681|CRK_DAUCA|CRK_DAUCA CDPK-related protein kinase (EC 2.7.1.-) (PK...    67   4e-10   Daucus carota [carrots]
gb:MZECDPKA_1687850 Zea mays mRNA for CDPK-related protein kinas...    67   5e-10   
pir|T02033|T02033 calcium/calmodulin-dependent protein kinase ho...    67   5e-10   Zea mays [maize]
gb:AP004678_1843224 Oryza sativa (japonica cultivar-group) genom...    66   6e-10   
gb:NTA344155_1691348 Nicotiana tabacum mRNA for calcium-dependen...    65   1e-09   
gb:AB051808_1521147 Solanum tuberosum RiCDPK1 mRNA for calcium d...    65   1e-09   
gb:AJ699161_1813475 Nicotiana plumbaginifolia mRNA for calcium-d...    65   2e-09   
gb:AC135595_1742676 Oryza sativa chromosome 3 BAC OSJNBa0028F23 ...    65   2e-09   
gb:AY312269_1598243 Cicer arietinum calcium-dependent calmodulin...    65   2e-09   
gb:AF462819_1801932 Arabidopsis thaliana At2g46700/T3A4.8 mRNA, ...    64   2e-09   
gb:AF435449_1799829 Arabidopsis thaliana calcium/calmodulin-depe...    64   2e-09   
gb:AF216527_1778089 Dunaliella tertiolecta calcium-dependent pro...    64   2e-09   
gb:AY079049_1568161 Lycopersicon esculentum serine/threonine pro...    64   2e-09   
pir|B84906|B84906 probable calcium-dependent protein kinase [imp...    64   2e-09   Arabidopsis thaliana [mouse-ear cress]
pir|T03023|T03023 calcium-dependent protein kinase-related prote...    64   2e-09   Zea mays [maize]
gb:AP004671_1843081 Oryza sativa (japonica cultivar-group) genom...    64   3e-09   
gb:SOL549109_1715810 Spirodela oligorrhiza partial mRNA for puta...    64   3e-09   
gb:SOL549108_1715809 Spirodela oligorrhiza mRNA for calcium-depe...    64   3e-09   
gb:AP003866_1834557 Oryza sativa (japonica cultivar-group) genom...    64   4e-09   
gb:AP004082_1837423 Oryza sativa (japonica cultivar-group) genom...    63   5e-09   
gb:AF289237_1783537 Zea mays calcium/calmodulin dependent protei...    63   5e-09   
gb:ATT2L20_1555752 Arabidopsis thaliana DNA chromosome 5, BAC cl...    63   7e-09   
gb:AC011560_1537233 Arabidopsis thaliana chromosome 3 BAC F13M14...    63   7e-09   
pir|T05476|T05476 calcium-dependent protein kinase (EC 2.7.1.-) ...    63   7e-09   Arabidopsis thaliana [mouse-ear cress]
sp|Q06850|CDP1_ARATH|CDP1_ARATH Calcium-dependent protein kinase, isoform A...    63   7e-09   Arabidopsis thaliana [mouse-ear cress]
gb:AC084296_1733477 Oryza sativa chromosome 3 BAC OSJNBb0024J04 ...    62   9e-09   
gb:AY072126_1567020 Arabidopsis thaliana putative calcium-depend...    62   9e-09   
pir|G96543|G96543 calcium-dependent protein kinase [imported] - ...    62   9e-09   Arabidopsis thaliana [mouse-ear cress]
gb:BT011630_1641152 Arabidopsis thaliana At3g57530 mRNA, complet...    62   1e-08   
gb:AY247756_1592604 Glycine max seed calcium dependent protein k...    62   1e-08   
pir|T46189|T46189 calcium-dependent protein kinase - Arabidopsis...    62   1e-08   Arabidopsis thaliana [mouse-ear cress]
pir|T01989|T01989 calcium-dependent protein kinase (EC 2.7.1.-) ...    62   1e-08   Nicotiana tabacum [American tobacco]
gb:AF363784_1791547 Lycopersicon esculentum calcium-dependent pr...    62   1e-08   
gb:AF090835_1767408 Mesembryanthemum crystallinum Ca2+-dependent...    62   1e-08   
gb:AE005173_895138 Arabidopsis thaliana chromosome 1, bottom arm...    62   1e-08   
pir|C84774|C84774 probable calcium-dependent protein kinase [imp...    62   1e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AF153352_1772831 Arabidopsis thaliana CDPK-related kinase 2 (...    61   2e-08   
gb:AC137608_1743475 Oryza sativa (japonica cultivar-group) chrom...    61   2e-08   
gb:NBE344156_1688165 Nicotiana benthamiana mRNA for calcium-depe...    61   2e-08   
gb:AY395701_1604823 Malus x domestica calcium-dependent protein ...    61   2e-08   
gb:AY058851_1564388 Arabidopsis thaliana AT3g19100/MVI11_1 mRNA,...    61   2e-08   
gb:AB024036_1515856 Arabidopsis thaliana genomic DNA, chromosome...    61   2e-08   
gb:AB007727_1510289 Arabidopsis thaliana genomic DNA, chromosome...    61   2e-08   
gb:AF435450_1799830 Nicotiana tabacum calcium/calmodulin-depende...    61   3e-08   
gb:AC129718_1740648 Oryza sativa (japonica cultivar-group) chrom...    61   3e-08   
gb:NTA344154_1691347 Nicotiana tabacum mRNA for calcium-dependen...    61   3e-08   
pir|H84810|H84810 probable calcium-dependent protein kinase [imp...    61   3e-08   Arabidopsis thaliana [mouse-ear cress]
gb:AJ621356_1812338 Triticum aestivum mRNA for putative calcium-...    60   3e-08   
pir|T09940|T09940 calcium-dependent protein kinase (EC 2.7.1.-) ...    60   3e-08   Cucurbita pepo
gb:AF035944_1762929 Fragaria x ananassa calcium-dependent protei...    60   4e-08   
gb:LES308296_1684562 Lycopersicon esculentum mRNA for calcium-de...    60   4e-08   
pir|T08874|T08874 calcium-dependent protein kinase (EC 2.7.1.-) ...    60   4e-08   Glycine max [soybeans]
sp|P28582|CDPK_DAUCA|CDPK_DAUCA Calcium-dependent protein kinase (EC 2.7.1....    60   4e-08   Daucus carota [carrots]
gb:AP002819_1822897 Oryza sativa (japonica cultivar-group) genom...    60   6e-08   
gb:AJ699160_1813474 Nicotiana plumbaginifolia mRNA for calcium-d...    60   6e-08   
gb:AF319480_1785774 Oryza sativa calcium-dependent calmodulin-in...    60   6e-08   
gb:AY072801_1567397 Cucurbita maxima phloem calmodulin-like-doma...    60   6e-08   
pir|S71770|S71770 calcium-dependent protein kinase (EC 2.7.1.-) ...    60   6e-08   Vigna radiata var. radiata [golden gram]
gb:AP003073_1824565 Oryza sativa (japonica cultivar-group) genom...    59   7e-08   
gb:MSCDPK_1687079 M.sativa mRNA for protein kinase.                    59   7e-08   
gb:AY138479_1582322 Ceratopteris richardii calmodulin domain pro...    59   7e-08   
gb:AP003847_1834203 Oryza sativa (japonica cultivar-group) genom...    59   1e-07   
gb:AF048691_1763986 Oryza sativa calcium dependent protein kinas...    59   1e-07   
gb:AC099739_1737221 Oryza sativa (japonica cultivar-group) chrom...    59   1e-07   
gb:AY158077_1585533 Oryza sativa (japonica cultivar-group) calci...    59   1e-07   
gb:AB078634_1523749 Oryza sativa OsCDPK13 mRNA for calcium depen...    59   1e-07   
pir|S71778|S71778 calcium-dependent protein kinase (EC 2.7.1.-) ...    59   1e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AF276999_1782715 Funaria hygrometrica calcium-dependent prote...    59   1e-07   
gb:AY050891_1562384 Arabidopsis thaliana putative calcium depend...    59   1e-07   
pir|D85059|D85059 probable calcium dependent protein kinase [imp...    59   1e-07   Arabidopsis thaliana [mouse-ear cress]
gb:MZECDPKX_1687852 Zea mays calcium-dependent protein kinase (C...    58   2e-07   
gb:AY072802_1567398 Cucurbita maxima calmodulin-like-domain prot...    58   2e-07   
pir|F96776|F96776 hypothetical protein F25A4.29 [imported] - Ara...    58   2e-07   Arabidopsis thaliana [mouse-ear cress]
pir|T03024|T03024 calcium-dependent protein kinase (EC 2.7.1.-),...    58   2e-07   Zea mays [maize]
gb:OSJN00087_1694657 Oryza sativa genomic DNA, chromosome 4, BAC...    57   3e-07   
gb:AY562224_1614996 Nicotiana tabacum calcium/calmodulin protein...    57   3e-07   
pir|S54788|S54788 calcium-stimulated protein kinase - Chlamydomo...    57   3e-07   Chlamydomonas moewusii
gb:AP004269_1839496 Oryza sativa (japonica cultivar-group) genom...    57   4e-07   
gb:D38452_1674556 Zea mays mRNA for calcium-dependent protein ki...    57   4e-07   
gb:AB042550_1519891 Oryza sativa (japonica cultivar-group) mRNA ...    57   4e-07   
gb:AB017515_1513644 Marchantia polymorpha gene for calcium-depen...    57   4e-07   
gb:AB017515_1513643 Marchantia polymorpha gene for calcium-depen...    57   4e-07   
pir|T10938|T10938 calcium-dependent protein kinase (EC 2.7.1.-) ...    57   4e-07   Ipomoea batatas [batate]
sp|P53683|CDP2_ORYSA|CDP2_ORYSA Calcium-dependent protein kinase, isoform 2...    57   4e-07   Oryza sativa [red rice]
gb:AF115406_1769295 Solanum tuberosum calcium-dependent protein ...    57   5e-07   
gb:BT004566_1637600 Arabidopsis thaliana At1g18890 gene, complet...    57   5e-07   
gb:ATHATCDPK_1553023 Arabidopsis thaliana mRNA for calcium-depen...    57   5e-07   
gb:AC068602_1540375 Genomic sequence for Arabidopsis thaliana BA...    57   5e-07   
pir|D84550|D84550 probable calmodulin-domain protein kinase CPK6...    57   5e-07   Arabidopsis thaliana [mouse-ear cress]
pir|H86322|H86322 calcium-dependent protein kinase 1 [imported] ...    57   5e-07   Arabidopsis thaliana [mouse-ear cress]
sp|P53684|CDP3_ORYSA|CDP3_ORYSA Calcium-dependent protein kinase, isoform 1...    57   5e-07   Oryza sativa [red rice]
gb:AC084296_1733470 Oryza sativa chromosome 3 BAC OSJNBb0024J04 ...    56   6e-07   
gb:ATU73610_1557223 Arabidopsis thaliana ATCDPK1a (cpk1a) mRNA, ...    56   6e-07   
pir|A84847|A84847 probable Ca2+ dependent protein kinase [import...    56   6e-07   Arabidopsis thaliana [mouse-ear cress]
pir|T02993|T02993 calcium-dependent protein kinase (EC 2.7.1.-) ...    56   6e-07   Zea mays [maize]
pir|T02139|T02139 calcium-dependent protein kinase (EC 2.7.1.-) ...    56   6e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AY062539_1565195 Arabidopsis thaliana calcium-dependent prote...    56   8e-07   
pir|T51156|T51156 calcium dependent protein kinase [imported] - ...    56   8e-07   Arabidopsis thaliana [mouse-ear cress]
pir|S46283|S46283 calcium-dependent protein kinase (EC 2.7.1.-) ...    56   8e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AY704444_1623723 Triticum aestivum calcium-dependent protein ...    55   1e-06   
gb:AY632360_1618715 Gossypium hirsutum BAC 106I22, complete sequ...    55   1e-06   
gb:AY394009_1604751 Vitis labrusca x Vitis vinifera calcium-depe...    55   1e-06   
gb:AY295081_1596151 Capsicum annuum calcium-dependent protein ki...    55   1e-06   
gb:AB025633_1516595 Arabidopsis thaliana genomic DNA, chromosome...    55   1e-06   
pir|G86414|G86414 probable protein kinase [imported] - Arabidops...    55   1e-06   Arabidopsis thaliana [mouse-ear cress]
pir|T03271|T03271 calcium-dependent protein kinase (EC 2.7.1.-) ...    55   1e-06   Zea mays [maize]
pir|S71776|S71776 calcium-dependent protein kinase (EC 2.7.1.-) ...    55   1e-06   Arabidopsis thaliana [mouse-ear cress]
sp|P49101|CDP2_MAIZE|CDP2_MAIZE Calcium-dependent protein kinase 2 (EC 2.7....    55   1e-06   Zea mays [maize]
gb:AK117892_1815900 Arabidopsis thaliana At2g31500 mRNA for puta...    55   1e-06   
pir|E84721|E84721 probable calcium-dependent protein kinase [imp...    55   1e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AC097277_1736528 Oryza sativa chromosome 3 BAC OSJNBa0022C08 ...    55   2e-06   
gb:AC092779_1735694 Oryza sativa chromosome 3 BAC OSJNBb0024N19 ...    55   2e-06   
gb:AY144497_1583548 Oryza sativa (japonica cultivar-group) OsCDP...    55   2e-06   
gb:AP004702_1843654 Oryza sativa (japonica cultivar-group) genom...    54   2e-06   
gb:AF130252_1770794 Arabidopsis thaliana calcium dependent prote...    54   2e-06   
gb:AC108503_1738535 Oryza sativa (japonica cultivar-group) chrom...    54   2e-06   
gb:TRU82087_1725870 Tortula ruralis calmodulin-like domain prote...    54   2e-06   
gb:AB051809_1521148 Solanum tuberosum RiCDPK2 mRNA for calcium d...    54   2e-06   
gb:AE016959_1023655 Oryza sativa (japonica cultivar-group) chrom...    54   2e-06   
pir|T06126|T06126 calcium-dependent protein kinase (EC 2.7.1.-) ...    54   2e-06   Arabidopsis thaliana [mouse-ear cress]
pir|T05650|T05650 calcium-dependent protein kinase (EC 2.7.1.-) ...    54   2e-06   Arabidopsis thaliana [mouse-ear cress]
sp|P53682|CDP1_ORYSA|CDP1_ORYSA Calcium-dependent protein kinase, isoform 1...    54   2e-06   Oryza sativa [red rice]
pir|T03263|T03263 calcium-dependent protein kinase (EC 2.7.1.-) ...    54   4e-06   Zea mays [maize]
gb:AP004366_1840839 Oryza sativa (japonica cultivar-group) genom...    53   5e-06   
pir|T02784|T02784 calcium-dependent protein kinase (EC 2.7.1.-) ...    53   5e-06   Zea mays [maize]
gb:T4B21_1724066 Arabidopsis thaliana BAC T4B21.                       53   7e-06   
gb:AY753552_1626906 Vicia faba calcium-dependent protein kinase ...    53   7e-06   
gb:AY052319_1562692 Arabidopsis thaliana AT4g23650/F9D16_120 mRN...    53   7e-06   
gb:AY050981_1562461 Arabidopsis thaliana putative calcium-depend...    53   7e-06   
gb:ATCHRIV13_1544314 Arabidopsis thaliana DNA chromosome 4, cont...    53   7e-06   
gb:AE005172_892352 Arabidopsis thaliana chromosome 1, top arm co...    53   7e-06   
pir|T05597|S71774 calcium-dependent protein kinase (EC 2.7.1.-) ...    53   7e-06   
pir|S46284|S46284 calcium-dependent protein kinase (EC 2.7.1.-) ...    53   7e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AB016870_1512872 Arabidopsis thaliana genomic DNA, chromosome...    52   9e-06   
pir|T04862|T04862 probable serine/threonine-specific protein kin...    52   9e-06   Arabidopsis thaliana [mouse-ear cress]
gb:AP003948_1835627 Oryza sativa (japonica cultivar-group) genom...    52   1e-05   
pir|G85097|G85097 hypothetical protein AT4g09570 [imported] - Ar...    52   1e-05   Arabidopsis thaliana [mouse-ear cress]
gb:BAC221D7_2088756 Mus musculus BAC22107 partial stk33 gene.          51   2e-05   
gb:AY247755_1592603 Glycine max seed calcium dependent protein k...    51   2e-05   
pir|T08873|T08873 calcium-dependent protein kinase (EC 2.7.1.-) ...    51   2e-05   Glycine max [soybeans]
gb:AC144743_1744253 Oryza sativa (japonica cultivar-group) chrom...    51   3e-05   
gb:MZECDPK_1687848 Zea mays calcium dependent protein kinase (CD...    51   3e-05   
gb:AY301062_1597321 Zea mays calcium-dependent protein kinase Zm...    51   3e-05   
gb:AY191840_1588655 Pisum sativum calcineurin B-like-interacting...    51   3e-05   
pir|T02306|T02306 probable protein kinase [imported] - Arabidops...    51   3e-05   Arabidopsis thaliana [mouse-ear cress]
pir|S56717|S56717 calcium-dependent protein kinase (EC 2.7.1.-) ...    51   3e-05   Zea mays [maize]
gb:AP003757_1832984 Oryza sativa (japonica cultivar-group) genom...    50   3e-05   
gb:AF428398_1799328 Arabidopsis thaliana At2g30360/T9D9.17 mRNA,...    50   3e-05   
gb:T4B21_1724070 Arabidopsis thaliana BAC T4B21.                       50   3e-05   
pir|E84707|E84707 probable protein kinase [imported] - Arabidops...    50   3e-05   Arabidopsis thaliana [mouse-ear cress]
pir|F85059|F85059 probable calcium dependent protein kinase [imp...    50   3e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AY222455_1590589 Lycopersicon esculentum SNF1-related protein...    50   5e-05   
pir|T07415|T07415 probable serine/threonine-specific protein kin...    50   5e-05   Solanum tuberosum [potatoes]
gb:AF141378_1771583 Zea mays protein kinase PK4 mRNA, complete cds.    50   6e-05   
gb:AY247754_1592602 Glycine max seed calcium dependent protein k...    50   6e-05   
sp|P28583|CDPK_SOYBN|CDPK_SOYBN Calcium-dependent protein kinase SK5 (EC 2....    50   6e-05   Glycine max [soybeans]
gb:AP005429_1851700 Oryza sativa (japonica cultivar-group) genom...    49   8e-05   
gb:CSA318078_1673818 Cucumis sativus partial mRNA for calcium-de...    49   8e-05   
gb:AB011967_1511593 Oryza sativa OsPK4 gene, complete cds.>gb:AC...    49   8e-05   
pir|G86259|G86259 protein T12C24.12 [imported] - Arabidopsis tha...    49   8e-05   Arabidopsis thaliana [mouse-ear cress]
gb:D30622_1674523 Arabidopsis thaliana mRNA for novel serine/thr...    49   1e-04   
pir|T48202|T48202 protein kinase AK22 (EC 2.7.1.-) - Arabidopsis...    49   1e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AP003230_1825761 Oryza sativa (japonica cultivar-group) genom...    49   1e-04   
gb:AF319169_1785756 Brassica napus CBL-interacting protein kinas...    49   1e-04   
gb:CSA318076_1673816 Cucumis sativus partial mRNA for calcium-de...    49   1e-04   
gb:AY027885_1559053 Cucumis sativus calcium-dependent calmodulin...    49   1e-04   
gb:AY098940_1576504 Solanum tuberosum CDPK-like protein mRNA, co...    48   2e-04   
gb:CR548612_1375514 Paramecium tetraurelia macronuclear largest ...    48   2e-04   
gb:AC104427_1737588 Oryza sativa (japonica cultivar-group) chrom...    48   2e-04   
pir|E85362|E85362 hypothetical protein AT4g30960 [imported] - Ar...    48   2e-04   Arabidopsis thaliana [mouse-ear cress]
gb:AP006756_1862895 Oryza sativa (japonica cultivar-group) genom...    47   3e-04   
gb:AP003608_1831264 Oryza sativa (japonica cultivar-group) genom...    47   3e-04   
gb:AP001551_1821334 Oryza sativa (japonica cultivar-group) genom...    47   3e-04   
gb:HVU7990_1682841 Hordeum vulgare mRNA for SnRK1-type protein k...    47   3e-04   
pir|S60303|S60303 serine/threonine-specific protein kinase (EC 2...    47   3e-04   Hordeum vulgare [barley]
gb:AB101657_1526324 Oryza sativa (japonica cultivar-group) OSK35...    47   4e-04   
gb:AB101656_1526323 Oryza sativa (japonica cultivar-group) OSK24...    47   4e-04   
gb:AB016870_1512873 Arabidopsis thaliana genomic DNA, chromosome...    47   4e-04   
pir|T04145|T04145 serine/threonine protein kinase homolog - rice...    47   4e-04   Oryza sativa [red rice]
gb:BC045836_2549357 Danio rerio pim-1 oncogene, mRNA (cDNA clone...    47   5e-04   
gb:AL590148_2503668 Zebrafish DNA sequence from clone RP71-30I22...    47   5e-04   
gb:CSA312239_1673811 Cucumis sativus partial mRNA for calcium-de...    47   5e-04   
sp|Q02723|RKI1_SECCE|RKI1_SECCE Carbon catabolite derepressing protein kina...    47   5e-04   Secale cereale
sp|Q9YHZ5|PIM1_BRARE|PIM1_BRARE Serine/threonine-protein kinase Pim-1 (EC 2...    47   5e-04   Danio rerio [leopard danio]
gb:T19J18_1723566 Arabidopsis thaliana BAC T19J18.                     46   7e-04   
gb:AP003409_1828997 Oryza sativa (japonica cultivar-group) genom...    46   9e-04   
gb:AP003256_1826448 Oryza sativa (japonica cultivar-group) genom...    46   9e-04   
gb:AP001551_1821337 Oryza sativa (japonica cultivar-group) genom...    46   9e-04   
gb:AP001168_1820888 Oryza sativa (japonica cultivar-group) genom...    46   9e-04   
gb:CSA318077_1673817 Cucumis sativus partial mRNA for calcium-de...    46   9e-04   
gb:AB052663_1521218 Arabidopsis thaliana AtC401 gene for SNF1-li...    46   9e-04   
gb:AB050965_1521053 Arabidopsis thaliana AtC401 mRNA for PnC401 ...    46   9e-04   
gb:BC031231_1980093 Homo sapiens serine/threonine kinase 33, mRN...    45   0.001   
gb:AF448226_1800641 Arabidopsis thaliana CBL-interacting protein...    45   0.001   
gb:AC140977_1744070 Arabidopsis thaliana chromosome 5 BAC F13M11...    45   0.001   
gb:AY347743_1601398 Physcomitrella patens Snf1 related kinase 1 ...    45   0.001   
gb:AY050360_1562139 Arabidopsis thaliana AT5g25110/T11H3_120 mRN...    45   0.001   
gb:AX455758_1468850 Sequence 4 from Patent WO0220800.>gb:AK09325...    45   0.001   
pir|T14735|T14735 probable serine/threonine kinase (EC 2.7.1.-) ...    45   0.001   Sorghum bicolor [broomcorn]
gb:AP004126_1837992 Oryza sativa (japonica cultivar-group) genom...    45   0.001   
gb:HVBKIN12M_1682285 H.vulgare BKIN12 mRNA for protein kinase (p...    45   0.001   
pir|B84644|B84644 probable protein kinase [imported] - Arabidops...    45   0.001   Arabidopsis thaliana [mouse-ear cress]
pir|A56009|A56009 serine/threonine-specific protein kinase (EC 2...    45   0.001   Nicotiana tabacum [American tobacco]
gb:AC105320_1737944 Oryza sativa (japonica cultivar-group) chrom...    45   0.002   
gb:AC104280_1737459 Oryza sativa (japonica cultivar-group) chrom...    45   0.002   
gb:STU83797_1723160 Solanum tuberosum StubSNF1 protein (SNF1) mR...    45   0.002   
gb:AY462018_1607502 Nicotiana attenuata SNF1-related protein kin...    45   0.002   
gb:AY094414_1575716 Arabidopsis thaliana AT5g07070/T28J14_10 mRN...    45   0.002   
gb:AB019228_1514112 Arabidopsis thaliana genomic DNA, chromosome...    45   0.002   
pir|T48478|T48478 serine/threonine protein kinase-like protein -...    45   0.002   Arabidopsis thaliana [mouse-ear cress]
pir|T14736|T14736 probable serine/threonine kinase (EC 2.7.1.-) ...    45   0.002   Sorghum bicolor [broomcorn]
pir|T14822|T14822 probable serine/threonine protein kinase (EC 2...    45   0.002   Sorghum bicolor [broomcorn]
pir|T07788|T07788 probable serine/threonine-specific protein kin...    45   0.002   Solanum tuberosum [potatoes]
gb:AF286050_1783185 Arabidopsis thaliana CBL-interacting protein...    44   0.002   
gb:AF143743_1771824 Lycopersicon esculentum SNF1 (SNF1) mRNA, co...    44   0.002   
gb:AY035226_1559968 Arabidopsis thaliana CBL-interacting protein...    44   0.002   
gb:AB101655_1526322 Oryza sativa (japonica cultivar-group) OSK1 ...    44   0.002   
pir|A86427|A86427 probable serine/threonine kinase [imported] - ...    44   0.002   Arabidopsis thaliana [mouse-ear cress]
gb:AF525402_1808309 Glycine max SOS2-like protein kinase mRNA, c...    44   0.003   
gb:AY486125_1608545 Zea mays SNF1-related protein kinase mRNA, c...    44   0.003   
gb:AB011670_1511574 Triticum aestivum mRNA for wpk4 protein kina...    44   0.003   
pir|A53467|A53467 protein kinase SNF1 homolog wpk4-p58 - wheat         44   0.003   Triticum aestivum [Canadian hard winter wheat]
pir|T38052|T38052 probable protein kinase - fission yeast (Schiz...    44   0.003   Schizosaccharomyces pombe
pir|S60304|S60304 serine/threonine-specific protein kinase (EC 2...    44   0.003   Hordeum vulgare [barley]
sp|Q10156|LKH1_SCHPO|LKH1_SCHPO Protein kinase lkh1 (EC 2.7.1.37) (EC 2.7.1...    44   0.003   Schizosaccharomyces pombe
gb:BC075737_2558702 Danio rerio pim-1 oncogene, mRNA (cDNA clone...    44   0.004   
gb:F6I13_1678488 Arabidopsis thaliana BAC F6I13.                       44   0.004   
gb:ENU59214_1676798 Emericella nidulans MAP protein kinase MPKA ...    44   0.004   
gb:AB025611_1516348 Arabidopsis thaliana genomic DNA, chromosome...    44   0.004   
gb:AP003703_1832131 Oryza sativa (japonica cultivar-group) genom...    43   0.006   
gb:AF128443_1770606 Glycine max SNF-1-like serine/threonine prot...    43   0.006   
gb:AY551333_1613335 Vigna radiata CDPK-related protein kinase mR...    43   0.006   
gb:AY347745_1601400 Physcomitrella patens Snf1 related kinase 1 ...    43   0.006   
gb:AY057407_1563886 Persea americana serine/threonine kinase mRN...    43   0.006   
pir|T41298|T41298 ser/thr protein kinase - fission yeast (Schizo...    43   0.006   Schizosaccharomyces pombe
sp|O59790|ARK1_SCHPO|ARK1_SCHPO Serine/threonine-protein kinase ark1 (EC 2....    43   0.006   Schizosaccharomyces pombe
gb:AF145482_1772027 Mesembryanthemum crystallinum putative serin...    43   0.007   
gb:AE017346_1757598 Cryptococcus neoformans var. neoformans JEC2...    43   0.007   
gb:AC116305_1206184 Dictyostelium discoideum chromosome 2 map 10...    43   0.007   
gb:PFMAL7P1_1191888 Plasmodium falciparum 3D7 chromosome 7, *** ...    43   0.007   
sp|Q8IBS5|CDP4_PLAF7|CDP4_PLAF7 Calcium-dependent protein kinase 4 (EC 2.7....    43   0.007   Plasmodium falciparum
gb:AP005429_1851696 Oryza sativa (japonica cultivar-group) genom...    42   0.009   
gb:AP004838_1845768 Oryza sativa (japonica cultivar-group) genom...    42   0.009   
gb:ATU83177_1557322 Arabidopsis thaliana SNF1 family protein kin...    42   0.009   
gb:ATSKIN1_1554159 A.thaliana mRNA for SNF1-related ser/thr prot...    42   0.009   
gb:AB009054_1510718 Arabidopsis thaliana genomic DNA, chromosome...    42   0.009   
pir|T52633|T52633 serine/threonine-specific protein kinase (EC 2...    42   0.009   Arabidopsis thaliana [mouse-ear cress]
gb:AF204951_2214207 Ectocarpus siliculosus virus, complete genome.     42   0.012   
gb:CR382131_1664895 Yarrowia lipolytica chromosome E of strain C...    42   0.012   
gb:AY349155_1601433 Phaeosphaeria nodorum SNF1 (snf1) gene, comp...    42   0.012   
gb:CR548612_1375337 Paramecium tetraurelia macronuclear largest ...    42   0.012   
gb:AF333958_1263449 Toxoplasma gondii calmodulin-domain protein ...    42   0.012   
pir|T02496|T02496 probable protein kinase [imported] - Arabidops...    42   0.012   Arabidopsis thaliana [mouse-ear cress]
pir|T10449|T10449 probable serine/threonine-specific protein kin...    42   0.012   Cucumis sativus [cucumbers]
gb:HSSTPKSAK_2020561 Homo sapiens mRNA for serine/threonine prot...    42   0.016   
gb:AP003813_1833728 Oryza sativa (japonica cultivar-group) genom...    42   0.016   
gb:AP003629_1831742 Oryza sativa (japonica cultivar-group) genom...    42   0.016   
gb:AF339147_1787717 Arabidopsis thaliana SOS2-like protein kinas...    42   0.016   
gb:AF295664_1783963 Arabidopsis thaliana CBL-interacting protein...    42   0.016   
gb:AF062479_1765304 Oryza sativa protein kinase SNF1 (Snf1) mRNA...    42   0.016   
gb:HVBKIN9P_1682287 H.vulgare BKIN9 gene for protein kinase, exo...    42   0.016   
gb:AY128408_1580707 Arabidopsis thaliana calcium dependent prote...    42   0.016   
gb:AY093242_1575196 Arabidopsis thaliana similar to wpk4 protein...    42   0.016   
gb:AC005623_1532846 Arabidopsis thaliana chromosome 2 clone T20P...    42   0.016   
gb:AC005623_1532845 Arabidopsis thaliana chromosome 2 clone T20P...    42   0.016   
gb:AB167718_1528761 Aspergillus oryzae mRNA for mitogen-activate...    42   0.016   
gb:AY555067_1335209 Plasmodium berghei calcium dependent protein...    42   0.016   
pir|C84667|C84667 probable protein kinase [imported] - Arabidops...    42   0.016   
pir|G86141|G86141 protein T25K16.13 [imported] - Arabidopsis tha...    42   0.016   
pir|S60305|S24580 protein kinase KIN9 (EC 2.7.1.-) - barley (fra...    42   0.016   
pir|B90100|B90100 SNF-related kinase [imported] - Guillardia the...    42   0.016   
pir|JC1446|JC1446 serine/threonine-specific protein kinase (EC 2...    42   0.016   
sp|Q38997|KI10_ARATH|KI10_ARATH SNF1-related protein kinase KIN10 (EC 2.7.1...    42   0.016   
sp|Q7RJG2|CDP4_PLAYO|CDP4_PLAYO Calcium-dependent protein kinase 4 (EC 2.7....    42   0.016   
sp|P62345|CDP4_PLABA|CDP4_PLABA Calcium-dependent protein kinase 4 (EC 2.7....    42   0.016   
gb:AP003749_1832850 Oryza sativa (japonica cultivar-group) genom...    41   0.021   
gb:AC098571_1736748 Oryza sativa (japonica cultivar-group) chrom...    41   0.021   
gb:BT001234_1635489 Arabidopsis thaliana serine/threonine protei...    41   0.021   
gb:AY705975_1623753 Alternaria brassicicola MAP kinase mRNA, com...    41   0.021   
pir|T50802|T50802 serine/threonine protein kinase-like protein -...    41   0.021   
pir|T03444|T03444 protein kinase homolog - rice>gb:AF004947_1760...    41   0.021   
pir|T27522|T27522 hypothetical protein ZC373.4 - Caenorhabditis ...    41   0.021   
gb:BC070744_2555714 Xenopus laevis hypothetical protein MGC83745...    41   0.027   
gb:AF492766_1804979 Gibberella zeae MAP kinase (MGV1) gene, comp...    41   0.027   
gb:AF159253_1773216 Cochliobolus carbonum serine threonine prote...    41   0.027   
gb:AY452722_1606806 Podospora anserina MAP kinase 1 (MPK1) gene,...    41   0.027   
pir|T23710|T23710 hypothetical protein M04C9.5 - Caenorhabditis ...    41   0.027   
gb:AF326574_2487768 Xenopus laevis protein kinase Cds1 (Cds1) mR...    40   0.036   
gb:AF174295_2478560 Xenopus laevis protein kinase Cds1 (Cds1) mR...    40   0.036   
gb:AP003409_1828998 Oryza sativa (japonica cultivar-group) genom...    40   0.036   
gb:AF301166_1784230 Blumeria graminis MAP kinase-II (MAPII) gene...    40   0.036   
gb:AF020316_1761628 Magnaporthe grisea MAP kinase Mps1 (MPS1) ge...    40   0.036   
gb:NCB23I4_1689791 Neurospora crassa DNA linkage group II BAC co...    40   0.036   
gb:HVBKIN2_1682286 H.vulgare mRNA for SNF1-related protein kinase.     40   0.036   
gb:CR380958_1653222 Candida glabrata strain CBS138 chromosome L ...    40   0.036   
gb:CPU320496_1648892 Claviceps purpurea mk2 gene for MAP kinase,...    40   0.036   
gb:AB011968_1511594 Oryza sativa OsPK7 gene, complete cds.>gb:AP...    40   0.036   
gb:CNS07EGE_1373623 chromosome VII of strain GB-M1 of Encephalit...    40   0.036   
gb:AK016890_1158931 Mus musculus adult male testis cDNA, RIKEN f...    40   0.036   
gb:AK006144_1153419 Mus musculus adult male testis cDNA, RIKEN f...    40   0.036   
pir|T09903|T09903 serine/threonine-specific protein kinase homol...    40   0.036   
gb:MUSSAKB_2129957 Mus musculus serine/threonine kinase (sak-b) ...    40   0.047   
gb:BC079202_2107329 Rattus norvegicus cDNA clone MGC:94261 IMAGE...    40   0.047   
gb:BC057940_2102972 Mus musculus polo-like kinase 4 (Drosophila)...    40   0.047   
gb:BC026785_2095548 Mus musculus polo-like kinase 4 (Drosophila)...    40   0.047   
gb:HSU79240_2026225 Human serine/threonine kinase mRNA, partial ...    40   0.047   
gb:D50925_1994790 Human mRNA for KIAA0135 gene, partial cds.           40   0.047   
gb:BC063585_1986271 Homo sapiens PAS domain containing serine/th...    40   0.047   
gb:BC043495_1983423 Homo sapiens PAS domain containing serine/th...    40   0.047   
gb:BC036023_1981801 Homo sapiens polo-like kinase 4 (Drosophila)...    40   0.047   
gb:AF387103_1900428 Homo sapiens PAS-kinase (PASK) mRNA, complet...    40   0.047   
gb:AP002482_1822179 Oryza sativa (japonica cultivar-group) genom...    40   0.047   
gb:AF291845_1783721 Hypocrea jecorina serine threonine protein k...    40   0.047   
gb:CR382135_1667906 Debaryomyces hansenii chromosome C of strain...    40   0.047   
gb:AY279002_1594571 Trichoderma atroviride MAP kinase (tmk2) gen...    40   0.047   
gb:AY064246_1566060 Colletotrichum lagenarium mitogen-activated ...    40   0.047   
gb:PFMAL13_1191233 Plasmodium falciparum 3D7 chromosome 13, *** ...    40   0.047   
gb:HSM801008_1186020 Homo sapiens mRNA; cDNA DKFZp434O051 (from ...    40   0.047   
gb:CR859233_1183358 Pongo pygmaeus mRNA; cDNA DKFZp459C1225 (fro...    40   0.047   
gb:CR749231_1180862 Homo sapiens mRNA; cDNA DKFZp686P2031 (from ...    40   0.047   
gb:AK006827_1153736 Mus musculus adult male testis cDNA, RIKEN f...    40   0.047   
gb:AE014186_938110 Plasmodium falciparum 3D7 chromosome 11 compl...    40   0.047   
pir|A55748|A55748 protein kinase (EC 2.7.1.37) Sak-a - mouse>gb:...    40   0.047   
pir|B55748|B55748 protein kinase (EC 2.7.1.37) Sak-b - mouse           40   0.047   
pir|T17211|T17211 hypothetical protein DKFZp434O051.1 - human          40   0.047   
sp|Q96RG2|PASK_HUMAN|PASK_HUMAN PAS domain containing serine/threonine-prot...    40   0.047   
gb:AP003449_1829589 Oryza sativa (japonica cultivar-group) genom...    40   0.061   
gb:YSCELM1A_1728857 Yeast protein kinase homolog (ELM1) gene, co...    40   0.061   
gb:CR380951_1650182 Candida glabrata strain CBS138 chromosome E ...    40   0.061   
gb:AY366480_1602913 Oryza sativa (japonica cultivar-group) MAPK6...    40   0.061   
gb:AY035049_1559826 Arabidopsis thaliana putative serine/threoni...    40   0.061   
gb:BT010033_1357399 Drosophila melanogaster LP05937 full insert ...    40   0.061   
gb:AE014297_1138836 Drosophila melanogaster chromosome 3R, compl...    40   0.061   
gb:AE014297_1138833 Drosophila melanogaster chromosome 3R, compl...    40   0.061   
pir|T47988|T47988 serine/threonine-protein kinase-like protein -...    40   0.061   
sp|P32801|ELM1_YEAST|ELM1_YEAST Protein kinase ELM1 (EC 2.7.1.-).>pir|S3786...    40   0.061   
gb:AY648752_2541580 Danio rerio polo-like kinase mRNA, complete ...    39   0.080   
gb:MMU318757_2120811 Mus musculus Paskin gene for PAS-serine/thr...    39   0.080   
gb:AK129063_2069294 Mus musculus mRNA for mKIAA0135 protein.           39   0.080   
gb:AB006972_1863904 Homo sapiens mRNA for Sak, complete cds.           39   0.080   
gb:AP002743_1822694 Oryza sativa (japonica cultivar-group) genom...    39   0.080   
gb:NC80A10_1688725 Neurospora crassa DNA linkage group V Cosmid ...    39   0.080   
gb:AY086942_1571980 Arabidopsis thaliana clone 2982 mRNA, comple...    39   0.080   
gb:ETCDPK_1384939 E.tenella mRNA for calmodulin-domain protein k...    39   0.080   
gb:AY660551_1344359 Eimeria tenella strain GS calmodulin-domain ...    39   0.080   
gb:AY389513_1324997 Eimeria tenella calmodulin-domain protein ki...    39   0.080   
gb:AF043629_1235900 Toxoplasma gondii protein kinase 4 (tpk4) mR...    39   0.080   
gb:PFMAL13_1191442 Plasmodium falciparum 3D7 chromosome 13, *** ...    39   0.080   
gb:AK028435_1160994 Mus musculus 14 days embryo liver cDNA, RIKE...    39   0.080   
pir|T10690|T10690 serine/threonine-specific protein kinase homol...    39   0.080   
pir|A56042|A56042 mitogen-activated protein kinase (EC 2.7.1.-) ...    39   0.080   
sp|Q8CEE6|PASK_MOUSE|PASK_MOUSE PAS domain containing serine/threonine-prot...    39   0.080   
sp|P42525|ERK1_DICDI|ERK1_DICDI Extracellular signal-regulated kinase 1 (EC...    39   0.080   
gb:AY335558_2144776 Synthetic construct Homo sapiens serine/thre...    39   0.10    
gb:AB015801_2043856 Mus musculus mRNA for LKB1, complete cds.>gb...    39   0.10    
gb:AK131042_1917739 Homo sapiens cDNA FLJ29008 fis, clone TST06032.    39   0.10    
gb:AF217978_1890589 Homo sapiens clone PP1471 unknown mRNA.            39   0.10    
gb:YSCSSP31_1730695 Saccharomyces cerevisiae gene for Ssp31 prot...    39   0.10    
gb:SOYSPK2_1716106 Glycine max protein kinase 2 (SPK-2) mRNA, co...    39   0.10    
gb:SCBCK1_1706549 S.cerevisiae BCK1 gene for protein kinase.           39   0.10    
gb:OSA512643_1692651 Oryza sativa (japonica cultivar-group) mRNA...    39   0.10    
gb:CR382137_1670476 Debaryomyces hansenii chromosome E of strain...    39   0.10    
gb:CR382123_1655783 Kluyveromyces lactis strain NRRL Y-1140 chro...    39   0.10    
gb:CR382122_1654897 Kluyveromyces lactis strain NRRL Y-1140 chro...    39   0.10    
gb:AY093051_1575005 Arabidopsis thaliana unknown protein (At5g57...    39   0.10    
gb:AY062529_1565185 Arabidopsis thaliana Unknown protein mRNA, c...    39   0.10    
gb:AY034100_1559581 Arabidopsis thaliana CBL-interacting protein...    39   0.10    
gb:AB011482_1511487 Arabidopsis thaliana genomic DNA, chromosome...    39   0.10    
gb:AX327170_1465780 Sequence 1 from Patent WO0181558.>gb:AY46166...    39   0.10    
gb:AY532162_1333600 Eimeria tenella casein kinase I alpha isofor...    39   0.10    
sp|Q15831|STKB_HUMAN|STKB_HUMAN Serine/threonine-protein kinase 11 (EC 2.7....    39   0.10    
sp|Q9H4B4|PLK3_HUMAN|PLK3_HUMAN Serine/threonine-protein kinase PLK3 (EC 2....    39   0.10    
sp|Q9UV50|HOG1_DEBHA|HOG1_DEBHA Mitogen-activated protein kinase HOG1 (EC 2...    39   0.10    
sp|Q01389|BCK1_YEAST|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/S...    39   0.10    
gb:BC063953_2553654 Danio rerio casein kinase 1, delta, mRNA (cD...    39   0.14    
gb:AF486831_2497295 Raja erinacea Ser/Thr kinase STK mRNA, compl...    39   0.14    
gb:BT007780_2150712 Synthetic construct Homo sapiens death-assoc...    39   0.14    
gb:MMU21392_2118920 Mus musculus putative serine/threonine kinas...    39   0.14    
gb:MMDAPK_2114700 M.musculus mRNA for death associated protein k...    39   0.14    
gb:BC063051_2105125 Mus musculus polo-like kinase 3 (Drosophila)...    39   0.14    
gb:BC057317_2102698 Mus musculus death associated protein kinase...    39   0.14    
gb:BC031180_2097000 Mus musculus polo-like kinase 3 (Drosophila)...    39   0.14    
gb:AY245541_2080557 Mus musculus death-associated protein kinase...    39   0.14    
gb:AY245540_2080556 Mus musculus death-associated protein kinase...    39   0.14    
gb:HSDAPK_2011832 H.sapiens DAP-kinase mRNA.                           39   0.14    
gb:BT006935_1990373 Homo sapiens death-associated protein kinase...    39   0.14    
gb:AL160279_1921864 Human DNA sequence from clone RP11-65B23 on ...    39   0.14    
gb:AK175188_1817176 Arabidopsis thaliana mRNA for putative prote...    39   0.14    
gb:AF302112_1784288 Arabidopsis thaliana CBL-interacting protein...    39   0.14    
gb:AY093177_1575131 Arabidopsis thaliana unknown protein (At3g17...    39   0.14    
gb:AB022219_1515106 Arabidopsis thaliana genomic DNA, chromosome...    39   0.14    
gb:TBBCHR1A2_1398604 Trypanosoma brucei DNA chromosome 1, segmen...    39   0.14    
gb:CR548612_1375452 Paramecium tetraurelia macronuclear largest ...    39   0.14    
gb:AF391294_1267452 Branchiostoma floridae cosmid MPMGc117K0348,...    39   0.14    
gb:AF071408_1238807 Plasmodium falciparum MAP2 kinase (map2) gen...    39   0.14    
gb:CR749834_1181292 Homo sapiens mRNA; cDNA DKFZp781I035 (from c...    39   0.14    
pir|C71408|C71408 probable protein kinase - Arabidopsis thaliana...    39   0.14    
pir|H84653|H84653 probable protein kinase [imported] - Arabidops...    39   0.14    
sp|Q91604|STKB_XENLA|STKB_XENLA Serine/threonine-protein kinase 11 (EC 2.7....    39   0.14    
sp|Q60806|PLK3_MOUSE|PLK3_MOUSE Serine/threonine-protein kinase PLK3 (EC 2....    39   0.14    
sp|Q80YE7|DAK1_MOUSE|DAK1_MOUSE Death-associated protein kinase 1 (EC 2.7.1...    39   0.14    
sp|P53355|DAK1_HUMAN|DAK1_HUMAN Death-associated protein kinase 1 (EC 2.7.1...    39   0.14    
gb:BC077802_2560455 Xenopus laevis MGC80412 protein, mRNA (cDNA ...    38   0.18    
gb:BC082328_2108377 Mus musculus RIKEN cDNA B230104P22 gene, mRN...    38   0.18    
gb:HSU56998_2024977 Human putative serine/threonine protein kina...    38   0.18    
gb:BC013899_1974247 Homo sapiens polo-like kinase 3 (Drosophila)...    38   0.18    
gb:AL592166_1930369 Human DNA sequence from clone RP11-269F19 on...    38   0.18    
gb:BX842682_1644269 Neurospora crassa DNA linkage group I BAC co...    38   0.18    
gb:AY603493_1617462 Candida glabrata protein kinase MAPKKK (STE1...    38   0.18    
gb:AB020749_1514638 Arabidopsis thaliana genomic DNA, chromosome...    38   0.18    
gb:DMBR7C10_1378245 Drosophila melanogaster BAC clone BACR7C10.>...    38   0.18    
gb:CNS07EGF_1373798 chromosome VIII of strain GB-M1 of Encephali...    38   0.18    
gb:CEF32D8_1363276 Caenorhabditis elegans cosmid F32D8, complete...    38   0.18    
gb:AE014298_1124087 Drosophila melanogaster chromosome X, comple...    38   0.18    
sp|P18431|SGG_DROME|SGG_DROME Protein kinase shaggy (EC 2.7.1.37) (Protein...    38   0.18    
gb:BC087047_2109946 Rattus norvegicus PAS domain containing seri...    38   0.23    
gb:AL591136_2070541 Mouse DNA sequence from clone RP23-273P3 on ...    38   0.23    
gb:AF263312_1893701 Homo sapiens STE20-like kinase mRNA, partial...    38   0.23    
gb:AB037782_1866573 Homo sapiens mRNA for KIAA1361 protein, part...    38   0.23    
gb:AP003621_1831592 Oryza sativa (japonica cultivar-group) genom...    38   0.23    
gb:AE017356_1760398 Cryptococcus neoformans var. neoformans JEC2...    38   0.23    
gb:AE016816_1746501 Ashbya gossypii (= Eremothecium gossypii) AT...    38   0.23    
gb:PPA428950_1701233 Physcomitrella patens mRNA for putative cyc...    38   0.23    
gb:CR382132_1666069 Yarrowia lipolytica chromosome F of strain C...    38   0.23    
gb:CR380952_1650390 Candida glabrata strain CBS138 chromosome F ...    38   0.23    
gb:BX649606_1643412 Aspergillus fumigatus BAC pilot project supe...    38   0.23    
gb:AB185922_1529347 Aspergillus oryzae hogA gene for mitogen-act...    38   0.23    
gb:CQ834802_1454067 Sequence 673 from Patent WO2004058805.>gb:AX...    38   0.23    
pir|T17365|T17365 serine/threonine protein kinase TAO1 - rat>gb:...    38   0.23    
pir|S58882|S58882 protein kinase Cds1 (EC 2.7.1.-) [validated] -...    38   0.23    
sp|Q9PK92|PKN1_CHLMU|PKN1_CHLMU Probable serine/threonine-protein kinase 1 ...    38   0.23    
sp|Q9V3D5|DYR2_DROME|DYR2_DROME Dual-specificity tyrosine-phosphorylation r...    38   0.23    
gb:BC065959_2554213 Danio rerio zgc:77318, mRNA (cDNA clone MGC:...    37   0.30    
gb:AK131198_1917782 Homo sapiens cDNA FLJ16039 fis, clone ADRGL2...    37   0.30    
gb:AB011109_1864269 Homo sapiens mRNA for KIAA0537 protein, part...    37   0.30    
gb:AC087552_1734103 Oryza sativa (japonica cultivar-group) chrom...    37   0.30    
gb:SPRNASTPK_1722062 S.pombe mRNA for serine/threonine protein k...    37   0.30    
gb:CR382136_1669170 Debaryomyces hansenii chromosome D of strain...    37   0.30    
gb:CR382132_1665311 Yarrowia lipolytica chromosome F of strain C...    37   0.30    
gb:CAC38F10_1644790 C.albicans cosmid Ca38F10.                         37   0.30    
gb:AY045931_1561429 Arabidopsis thaliana putative mitogen-activa...    37   0.30    
gb:AB038693_1519266 Arabidopsis thaliana mRNA for ATMPK8, comple...    37   0.30    
gb:AB012088_1511631 Zygosaccharomyces rouxii gene for Zhog2p, co...    37   0.30    
gb:AF061281_1237277 Dictyostelium discoideum kinase responsive t...    37   0.30    
gb:AE005172_890779 Arabidopsis thaliana chromosome 1, top arm co...    37   0.30    
pir|A96764|A96764 cell division protein kinase, 43057-44962 [imp...    37   0.30    
pir|S10932|S10932 probable protein kinase zeste-white3 (EC 2.7.1...    37   0.30    
pir|S56719|S56719 serine/threonine-specific protein kinase SPK-1...    37   0.30    
sp|Q09170|CDS1_SCHPO|CDS1_SCHPO Serine/threonine-protein kinase cds1 (EC 2....    37   0.30    
sp|O60285|ARK5_HUMAN|ARK5_HUMAN AMPK-related protein kinase 5 (EC 2.7.1.37)...    37   0.30    
gb:BX571705_2567669 Zebrafish DNA sequence from clone DKEY-261E2...    37   0.40    
gb:BC077360_2560073 Xenopus laevis death-associated protein kina...    37   0.40    
gb:RNU12149_2136858 Rattus norvegicus 5'-AMP-activated protein k...    37   0.40    
gb:BC020189_2093323 Mus musculus SNF related kinase, mRNA (cDNA ...    37   0.40    
gb:AF387809_2064662 Mus musculus strain BALB/c SNF-1 related kin...    37   0.40    
gb:HUMKIAAQ_2033917 Human mRNA for KIAA0096 gene, partial cds.         37   0.40    
gb:HSU06454_2021628 Human AMP-activated protein kinase (hAMPK) m...    37   0.40    
gb:BC071567_1988657 Homo sapiens SNF-1 related kinase, mRNA (cDN...    37   0.40    
gb:AK000231_1907770 Homo sapiens cDNA FLJ20224 fis, clone COLF5039.    37   0.40    
gb:AF226044_1891448 Homo sapiens HSNFRK (HSNFRK) mRNA, complete ...    37   0.40    
gb:AF420488_1798640 Fusarium oxysporum protein kinase SNF1 (SNF1...    37   0.40    
gb:AF194416_1775679 Oryza sativa MAP kinase homolog (MAPK2) mRNA...    37   0.40    
gb:AF034090_1762739 Neurospora crassa MAPKK kinase (nrc-1) gene,...    37   0.40    
gb:AC104277_1737417 Oryza sativa (japonica cultivar-group) chrom...    37   0.40    
gb:YSCFUS3_1728914 S.cerevisiae FUS3 gene, complete cds.               37   0.40    
gb:NCB1D14_1689569 Neurospora crassa genomic DNA, BAC contig B1D14.    37   0.40    
gb:NCB16M17_1689402 Neurospora crassa DNA linkage group V BAC cl...    37   0.40    
gb:CR382139_1672962 Debaryomyces hansenii chromosome G of strain...    37   0.40    
gb:CR382138_1671095 Debaryomyces hansenii chromosome F of strain...    37   0.40    
gb:BNA9609_1633373 Brassica napus mRNA for MAP4K alpha2 protein.       37   0.40    
gb:AY524973_1611543 Oryza sativa (indica cultivar-group) benzoth...    37   0.40    
gb:AY220480_1590514 Nicotiana tabacum Avr9/Cf-9 rapidly elicited...    37   0.40    
gb:AB074116_1523240 Arabidopsis thaliana cak4At mRNA for cdk-act...    37   0.40    
gb:AX875845_1476272 Sequence 10750 from Patent EP1074617.>gb:AK0...    37   0.40    
gb:AY159788_1425924 Sus scrofa AMP-activated protein kinase alph...    37   0.40    
gb:U11280_1401739 Caenorhabditis elegans cosmid T17E9, complete ...    37   0.40    
gb:U00034_1401396 Caenorhabditis elegans cosmid C06E8, complete ...    37   0.40    
gb:U00034_1401395 Caenorhabditis elegans cosmid C06E8, complete ...    37   0.40    


>gb:AF030879_1762513 Solanum tuberosum protein kinase CPK1 mRNA,
           complete cds.
          Length = 564

 Score =  162 bits (410), Expect = 6e-39
 Identities = 86/123 (69%), Positives = 96/123 (78%), Gaps = 8/123 (6%)
 Frame = +3

Query: 414 TTATSAQDEERSRCNRRKA--------KEPCEKYKNLNVKPSHRSQTVVIPCGKRTDFGY 569
           TT  +++++E S  NR K         K+P  +    NVKPS R Q  VIPCGKRTDFGY
Sbjct: 46  TTVVNSRNQEGSNYNRGKGNINQKNQQKQP--RNSQQNVKPSSRRQGGVIPCGKRTDFGY 103

Query: 570 DKDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKIL 749
           DKDF+KRYTIGKLLGHGQFGYTYVATDKS GDRVAVKRIEK KM+LP+AVEDVKREVKIL
Sbjct: 104 DKDFEKRYTIGKLLGHGQFGYTYVATDKSSGDRVAVKRIEKNKMVLPIAVEDVKREVKIL 163

Query: 750 KAL 758
           KAL
Sbjct: 164 KAL 166



>gb:AF435451_1799831 Nicotiana tabacum calcium-dependent protein
           kinase CPK4 mRNA, complete cds.
          Length = 572

 Score =  155 bits (391), Expect = 1e-36
 Identities = 85/135 (62%), Positives = 99/135 (73%), Gaps = 12/135 (8%)
 Frame = +3

Query: 396 AKPRSDTTATSAQDEERSRCNRRKAKEPCEKYKNLNVKPSHRSQTV------------VI 539
           A P S +T TS + +E S CN++K K+   K ++   +P +  Q V            VI
Sbjct: 35  ANPPSTSTITSTK-QEGSHCNKQKVKDN-HKSQHQKQQPRNSQQNVKKHNNGRRQKSGVI 92

Query: 540 PCGKRTDFGYDKDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAV 719
            CGKRTDFGYDKDFDKR+TIGKLLGHGQFGYTYVAT KS GDRVAVKRIEK KM+LP+AV
Sbjct: 93  ACGKRTDFGYDKDFDKRFTIGKLLGHGQFGYTYVATHKSNGDRVAVKRIEKNKMVLPIAV 152

Query: 720 EDVKREVKILKALTG 764
           EDVKREVKILKAL+G
Sbjct: 153 EDVKREVKILKALSG 167



>pir|T00835|T00835 calcium-dependent protein kinase homolog
           At2g17890 - Arabidopsis thaliana>gb:AC003952_1531213
           Arabidopsis thaliana chromosome II section 104 of 255 of
           the complete sequence. Sequence from clones T13L16.
          Length = 571

 Score =  133 bits (335), Expect = 3e-30
 Identities = 73/132 (55%), Positives = 83/132 (62%), Gaps = 7/132 (5%)
 Frame = +3

Query: 390 PTAKPRSDTTATSAQDEERSRCNRRKAKE-------PCEKYKNLNVKPSHRSQTVVIPCG 548
           P   P S    T  +D          AK+       P  K +   +  + R     IP G
Sbjct: 34  PPRSPCSFMAVTIQKDHRTQPRRNATAKKTPTRHTPPHGKVREKVISNNGRRHGETIPYG 93

Query: 549 KRTDFGYDKDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDV 728
           KR DFGY KDFD RYTIGKLLGHGQFGYTYVATDK  GDRVAVK+I+K KM +P+AVEDV
Sbjct: 94  KRVDFGYAKDFDHRYTIGKLLGHGQFGYTYVATDKKTGDRVAVKKIDKAKMTIPIAVEDV 153

Query: 729 KREVKILKALTG 764
           KREVKIL+ALTG
Sbjct: 154 KREVKILQALTG 165



>gb:AY085837_1570902 Arabidopsis thaliana clone 18901 mRNA, complete
           sequence.
          Length = 523

 Score =  129 bits (324), Expect = 6e-29
 Identities = 68/114 (59%), Positives = 80/114 (70%)
 Frame = +3

Query: 423 TSAQDEERSRCNRRKAKEPCEKYKNLNVKPSHRSQTVVIPCGKRTDFGYDKDFDKRYTIG 602
           T A    RS   + KA         ++ K S + +T  IPCGKRTDFGY KDF   YTIG
Sbjct: 11  TGASSSRRSSQTKSKAAPT-----PIDTKASTKRRTGSIPCGKRTDFGYSKDFHDHYTIG 65

Query: 603 KLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           KLLGHGQFGYTYVA  +  GDRVAVKR++K KM+LP+AVEDVKREV+IL AL+G
Sbjct: 66  KLLGHGQFGYTYVAIHRPNGDRVAVKRLDKSKMVLPIAVEDVKREVQILIALSG 119



>gb:AB011474_1511365 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K2A18.>gb:AY139991_1582432 Arabidopsis
           thaliana calcium-dependent protein kinase (At5g66210)
           mRNA, complete cds.>gb:BT010380_1640326 Arabidopsis
           thaliana At5g66210 mRNA, complete cds.
          Length = 523

 Score =  129 bits (324), Expect = 6e-29
 Identities = 68/114 (59%), Positives = 80/114 (70%)
 Frame = +3

Query: 423 TSAQDEERSRCNRRKAKEPCEKYKNLNVKPSHRSQTVVIPCGKRTDFGYDKDFDKRYTIG 602
           T A    RS   + KA         ++ K S + +T  IPCGKRTDFGY KDF   YTIG
Sbjct: 11  TGASSSRRSSQTKSKAAPT-----PIDTKASTKRRTGSIPCGKRTDFGYSKDFHDHYTIG 65

Query: 603 KLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           KLLGHGQFGYTYVA  +  GDRVAVKR++K KM+LP+AVEDVKREV+IL AL+G
Sbjct: 66  KLLGHGQFGYTYVAIHRPNGDRVAVKRLDKSKMVLPIAVEDVKREVQILIALSG 119



>pir|T05500|T05500 calcium-dependent protein kinase homolog
           T19K4.200 - Arabidopsis thaliana>gb:ATCHRIV84_1547567
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 84.>gb:ATT19K4_1554828 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T19K4 (ESSAII project).
          Length = 536

 Score =  125 bits (315), Expect = 6e-28
 Identities = 66/123 (53%), Positives = 79/123 (64%)
 Frame = +3

Query: 396 AKPRSDTTATSAQDEERSRCNRRKAKEPCEKYKNLNVKPSHRSQTVVIPCGKRTDFGYDK 575
           + P++    T +++       + KA E        N K         IP GKR DFGY K
Sbjct: 6   SSPKATRRGTGSRNPNPDSPTQGKASEKVSNKNKKNTKKIQLRHQGGIPYGKRIDFGYAK 65

Query: 576 DFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKA 755
           DFD RYTIGKLLGHGQFG+TYVATD + G+RVAVKRI+K KM  P+ VEDVKREVKIL+A
Sbjct: 66  DFDNRYTIGKLLGHGQFGFTYVATDNNNGNRVAVKRIDKAKMTQPIEVEDVKREVKILQA 125

Query: 756 LTG 764
           L G
Sbjct: 126 LGG 128



>gb:AF194414_1775677 Oryza sativa calcium-dependent protein kinase
           (CDPK5) mRNA, complete cds.
          Length = 512

 Score =  125 bits (314), Expect = 8e-28
 Identities = 57/77 (74%), Positives = 67/77 (87%)
 Frame = +3

Query: 534 VIPCGKRTDFGYDKDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPM 713
           ++ CGKRTDFGYDKDF+ RY +GKLLGHGQFGYT+ A D+   +RVAVKRI+K KM+LP+
Sbjct: 33  IVACGKRTDFGYDKDFEARYALGKLLGHGQFGYTFAAVDRRSSERVAVKRIDKNKMVLPV 92

Query: 714 AVEDVKREVKILKALTG 764
           AVEDVKREVKILKAL G
Sbjct: 93  AVEDVKREVKILKALQG 109



>gb:AP005311_1850369 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0482F12.
          Length = 520

 Score =  110 bits (274), Expect = 4e-23
 Identities = 50/71 (70%), Positives = 62/71 (87%)
 Frame = +3

Query: 552 RTDFGYDKDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVK 731
           R +FGY++DF+ RY +G+LLGHGQFGYT+ ATD++ GDRVAVKRI+K KM+ P+AVEDVK
Sbjct: 46  RVEFGYERDFEGRYQVGRLLGHGQFGYTFAATDRASGDRVAVKRIDKAKMVRPVAVEDVK 105

Query: 732 REVKILKALTG 764
           REVKILK L G
Sbjct: 106 REVKILKELKG 116



>gb:AP005311_1850368 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, PAC clone:P0482F12.
          Length = 522

 Score =  110 bits (274), Expect = 4e-23
 Identities = 50/71 (70%), Positives = 62/71 (87%)
 Frame = +3

Query: 552 RTDFGYDKDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVK 731
           R +FGY++DF+ RY +G+LLGHGQFGYT+ ATD++ GDRVAVKRI+K KM+ P+AVEDVK
Sbjct: 46  RVEFGYERDFEGRYQVGRLLGHGQFGYTFAATDRASGDRVAVKRIDKAKMVRPVAVEDVK 105

Query: 732 REVKILKALTG 764
           REVKILK L G
Sbjct: 106 REVKILKELKG 116



>gb:AF194413_1775676 Oryza sativa calcium-dependent protein kinase
           (CDPK1) mRNA, complete cds.
          Length = 523

 Score =  109 bits (272), Expect = 6e-23
 Identities = 50/71 (70%), Positives = 61/71 (85%)
 Frame = +3

Query: 552 RTDFGYDKDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVK 731
           R +FGY +DF+ RY +G+LLGHGQFGYT+ ATD++ GDRVAVKRI+K KM+ P+AVEDVK
Sbjct: 46  RVEFGYQRDFEGRYQVGRLLGHGQFGYTFAATDRASGDRVAVKRIDKAKMVRPVAVEDVK 105

Query: 732 REVKILKALTG 764
           REVKILK L G
Sbjct: 106 REVKILKELKG 116



>gb:AY664415_1620630 Zea mays cultivar B73 locus 9009, complete
           sequence.>gb:AY664419_1620668 Zea mays cultivar Mo17
           locus 9009, complete sequence.
          Length = 602

 Score = 70.5 bits (171), Expect = 3e-11
 Identities = 38/71 (53%), Positives = 47/71 (66%), Gaps = 3/71 (4%)
 Frame = +3

Query: 561 FGYDKDFDKRYTIGKLLGHGQFGYTYVATDKS---VGDRVAVKRIEKKKMLLPMAVEDVK 731
           FG++K F  +Y +G  +G G FGYT  AT K     G+ VAVK I K KM   +A+EDV+
Sbjct: 138 FGFNKGFAAKYDLGDEVGRGHFGYTCAATVKKGARKGESVAVKVIPKAKMTTSIAIEDVR 197

Query: 732 REVKILKALTG 764
           REVKILKAL G
Sbjct: 198 REVKILKALAG 208



>gb:AY312268_1598242 Cicer arietinum calcium-dependent
           calmodulin-independent protein kinase isoform 1 (CDPK1)
           mRNA, complete cds.
          Length = 556

 Score = 69.7 bits (169), Expect = 6e-11
 Identities = 38/88 (43%), Positives = 54/88 (61%)
 Frame = +3

Query: 501 NVKPSHRSQTVVIPCGKRTDFGYDKDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVK 680
           NVK  H++ T ++  GK  D     D  K YT+G+ LG GQFG TY  T+ S G+  A K
Sbjct: 69  NVKTVHKTDTTIL--GKPFD-----DIKKHYTLGQELGRGQFGITYFCTENSTGNTYACK 121

Query: 681 RIEKKKMLLPMAVEDVKREVKILKALTG 764
            I K+K++     ED+KRE++IL+ L+G
Sbjct: 122 SILKRKLVSKSDREDIKREIQILQHLSG 149



>gb:AP004309_1840019 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC
           clone:P0560B08.>gb:AP004380_1841020 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, PAC
           clone:P0594D10.
          Length = 599

 Score = 69.3 bits (168), Expect = 7e-11
 Identities = 38/71 (53%), Positives = 46/71 (64%), Gaps = 3/71 (4%)
 Frame = +3

Query: 561 FGYDKDFDKRYTIGKLLGHGQFGYTYVATDKS---VGDRVAVKRIEKKKMLLPMAVEDVK 731
           FG++K F  +Y +G  +G G FGYT  A  K     GD VAVK I K KM   +A+EDV+
Sbjct: 135 FGFNKGFAAKYDMGDEVGRGHFGYTCAAKIKKGARKGDAVAVKVIPKAKMTTSIAIEDVR 194

Query: 732 REVKILKALTG 764
           REVKILKAL G
Sbjct: 195 REVKILKALAG 205



>gb:AF435452_1799832 Nicotiana tabacum calcium/calmodulin-dependent
           protein kinase CaMK3 mRNA, complete cds.
          Length = 602

 Score = 69.3 bits (168), Expect = 7e-11
 Identities = 38/76 (50%), Positives = 48/76 (63%), Gaps = 3/76 (3%)
 Frame = +3

Query: 546 GKRTDFGYDKDFDKRYTIGKLLGHGQFGYTYVATDKS---VGDRVAVKRIEKKKMLLPMA 716
           G    FG+ K+F  +Y +G+ +G G FGYT  A  K     G  VAVK I K KM   +A
Sbjct: 133 GLDKSFGFSKNFVNKYEMGEEVGRGHFGYTCKAKFKKGEVKGQEVAVKVIPKSKMTTAIA 192

Query: 717 VEDVKREVKILKALTG 764
           +EDV+REVKIL+ALTG
Sbjct: 193 IEDVRREVKILRALTG 208



>gb:ATCRK_1548021 A.thaliana mRNA for CDPK-related protein
           kinase.>gb:AF435446_1799826 Arabidopsis thaliana
           calcium/calmodulin-dependent protein kinase CaMK1 mRNA,
           complete cds.
          Length = 601

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 37/76 (48%), Positives = 48/76 (63%), Gaps = 3/76 (3%)
 Frame = +3

Query: 546 GKRTDFGYDKDFDKRYTIGKLLGHGQFGYTYVATDK---SVGDRVAVKRIEKKKMLLPMA 716
           G    FG+ K F  +Y +G  +G G FGYT  A  K   + G +VAVK I K KM   +A
Sbjct: 133 GLDKSFGFSKSFASKYELGDEVGRGHFGYTCAAKFKKGDNKGQQVAVKVIPKAKMTTAIA 192

Query: 717 VEDVKREVKILKALTG 764
           +EDV+REVKIL+AL+G
Sbjct: 193 IEDVRREVKILRALSG 208



>pir|D96532|D96532 probable CDPK-related protein kinase [imported] -
           Arabidopsis thaliana>gb:AE005173_892891 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AC011807_1537461 Arabidopsis thaliana
           chromosome I BAC F14J22 genomic sequence, complete
           sequence.>gb:BT010597_1640543 Arabidopsis thaliana
           At1g49580 gene, complete cds.
          Length = 606

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 45/112 (40%), Positives = 60/112 (53%), Gaps = 5/112 (4%)
 Frame = +3

Query: 444 RSRCNRRKAKEPC--EKYKNLNVKPSHRSQTVVIPCGKRTDFGYDKDFDKRYTIGKLLGH 617
           R+   RRK K+         L  +   R +   +   KR  FG+ K+F  R  +G+ +G 
Sbjct: 101 RAALRRRKGKKEAALSGVTQLTTEVPQREEEEEVGLDKR--FGFSKEFHSRVELGEEIGR 158

Query: 618 GQFGYTYVATDKS---VGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           G FGYT  A  K     G  VAVK I K KM   +A+EDV+REVKIL+AL+G
Sbjct: 159 GHFGYTCSAKFKKGELKGQVVAVKIIPKSKMTTAIAIEDVRREVKILQALSG 210



>pir|T46084|T46084 CDPK-related protein kinase - Arabidopsis
           thaliana>gb:ATT20E23_1554940 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T20E23.
          Length = 601

 Score = 68.6 bits (166), Expect = 1e-10
 Identities = 37/76 (48%), Positives = 48/76 (63%), Gaps = 3/76 (3%)
 Frame = +3

Query: 546 GKRTDFGYDKDFDKRYTIGKLLGHGQFGYTYVATDK---SVGDRVAVKRIEKKKMLLPMA 716
           G    FG+ K F  +Y +G  +G G FGYT  A  K   + G +VAVK I K KM   +A
Sbjct: 133 GLDKSFGFSKSFASKYELGDEVGRGHFGYTCAAKFKKGDNKGQQVAVKVIPKAKMTTAIA 192

Query: 717 VEDVKREVKILKALTG 764
           +EDV+REVKIL+AL+G
Sbjct: 193 IEDVRREVKILRALSG 208



>gb:AE016959_1023387 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC087192_1734003
           Oryza sativa chromosome 10 BAC OSJNBa0005K07 genomic
           sequence, complete sequence.>gb:AE017111_1753206 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           65 of 77 of the complete sequence.
          Length = 632

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 35/71 (49%), Positives = 48/71 (67%), Gaps = 3/71 (4%)
 Frame = +3

Query: 561 FGYDKDFDKRYTIGKLLGHGQFGYTYVATDKSV---GDRVAVKRIEKKKMLLPMAVEDVK 731
           FGYD+ F  +Y +GK +G G FG+T +A  +     G  +AVK I K KM   +++EDV+
Sbjct: 168 FGYDRHFAAKYELGKEVGRGHFGHTCLARARKGDMRGQLLAVKVISKAKMTTAISIEDVR 227

Query: 732 REVKILKALTG 764
           REVKILKAL+G
Sbjct: 228 REVKILKALSG 238



>pir|T51264|T51264 calcium-dependent protein kinase-like -
           Arabidopsis thaliana>gb:ATT8M16_1556490 Arabidopsis
           thaliana DNA chromosome 3, BAC clone T8M16.
          Length = 577

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 43/93 (46%), Positives = 51/93 (54%), Gaps = 5/93 (5%)
 Frame = +3

Query: 501 NVKPSHRSQTVVIPC--GKRTDFGYDKDFDKRYTIGKLLGHGQFGYTYVATDKS---VGD 665
           +VKP+  S      C  G    FG+ K F   Y I   +G G FGYT  A  K     G 
Sbjct: 92  SVKPNEASIPEGSECEVGLDKKFGFSKQFASHYEIDGEVGRGHFGYTCSAKGKKGSLKGQ 151

Query: 666 RVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
            VAVK I K KM   +A+EDV+REVKIL+ALTG
Sbjct: 152 DVAVKVIPKSKMTTAIAIEDVRREVKILRALTG 184



>pir|T45842|T45842 calcium dependent protein kinase-like -
           Arabidopsis thaliana>gb:AC012329_1537571 Arabidopsis
           thaliana chromosome 1 BAC T1G12 genomic sequence,
           complete sequence.>gb:ATF2K15_1550543 Arabidopsis
           thaliana DNA chromosome 3, BAC clone F2K15.
          Length = 594

 Score = 67.4 bits (163), Expect = 3e-10
 Identities = 37/78 (47%), Positives = 52/78 (66%), Gaps = 5/78 (6%)
 Frame = +3

Query: 546 GKRTD--FGYDKDFDKRYTIGKLLGHGQFGYTYVATDKS---VGDRVAVKRIEKKKMLLP 710
           G+R D  FG+ K+F+ +Y +G+ +G G FG+T  A  K     G  VAVK I K KM   
Sbjct: 125 GERLDKNFGFAKNFEGKYELGREVGRGHFGHTCWAKAKKGKIKGQTVAVKIISKSKMTSA 184

Query: 711 MAVEDVKREVKILKALTG 764
           +++EDV+REVK+LKAL+G
Sbjct: 185 LSIEDVRREVKLLKALSG 202



>gb:AF368282_1791894 Oryza sativa CaMK1 (CaMK1) mRNA, complete cds.
          Length = 597

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 35/71 (49%), Positives = 46/71 (64%), Gaps = 3/71 (4%)
 Frame = +3

Query: 561 FGYDKDFDKRYTIGKLLGHGQFGYTYVATDKS---VGDRVAVKRIEKKKMLLPMAVEDVK 731
           FG+ + F  +Y +G+ +G G FGYT  AT K     GD VAVK I K KM   +A+EDV+
Sbjct: 134 FGFSRHFAAKYELGREVGRGHFGYTCAATCKKGELKGDDVAVKVIPKAKMTTAIAIEDVR 193

Query: 732 REVKILKALTG 764
           REV+IL +L G
Sbjct: 194 REVRILSSLAG 204



>pir|T02105|T02105 calcium-dependent protein kinase (EC 2.7.1.-)
           T3K9.9 - Arabidopsis thaliana>gb:AC004261_1531624
           Arabidopsis thaliana chromosome 2 clone T3K9 map
           CIC11C08, complete sequence.>gb:AF153351_1772830
           Arabidopsis thaliana CDPK-related kinase 1 (CRK1) mRNA,
           complete cds.>gb:AF435448_1799828 Arabidopsis thaliana
           calcium/calmodulin-dependent protein kinase CaMK3 mRNA,
           complete cds.
          Length = 576

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 44/97 (45%), Positives = 53/97 (54%), Gaps = 9/97 (9%)
 Frame = +3

Query: 501 NVKPSHRSQTVVIPCGKRTD------FGYDKDFDKRYTIGKLLGHGQFGYTYVATDKS-- 656
           +VKP+     V IP GK  +      FG+ K F   Y I   +G G FGYT  A  K   
Sbjct: 91  SVKPNE----VSIPEGKECEIGLDKSFGFSKQFASHYEIDGEVGRGHFGYTCSAKGKKGS 146

Query: 657 -VGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
             G  VAVK I K KM   +A+EDV REVK+L+ALTG
Sbjct: 147 LKGQEVAVKVIPKSKMTTAIAIEDVSREVKMLRALTG 183



>sp|P53681|CRK_DAUCA CDPK-related protein kinase (EC 2.7.1.-)
           (PK421).>pir|S60052|S60052 calcium-dependent protein
           kinase homolog - carrot>gb:DCCRK_1675663 D.carota mRNA
           for CDPK-related protein kinase.
          Length = 602

 Score = 67.0 bits (162), Expect = 4e-10
 Identities = 37/76 (48%), Positives = 47/76 (61%), Gaps = 3/76 (3%)
 Frame = +3

Query: 546 GKRTDFGYDKDFDKRYTIGKLLGHGQFGYTYVATDKS---VGDRVAVKRIEKKKMLLPMA 716
           G    FG+ K F  ++ +G+ +G G FGYT  A  K     G  VAVK I K KM   +A
Sbjct: 133 GLDKSFGFSKKFGSKFEVGEEVGRGHFGYTCRAKFKKGEFKGQDVAVKVIPKAKMTTAIA 192

Query: 717 VEDVKREVKILKALTG 764
           +EDV+REVKIL+ALTG
Sbjct: 193 IEDVRREVKILRALTG 208



>gb:MZECDPKA_1687850 Zea mays mRNA for CDPK-related protein kinase,
           partial cds, clone ZmCRK1.
          Length = 599

 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 36/71 (50%), Positives = 47/71 (66%), Gaps = 3/71 (4%)
 Frame = +3

Query: 561 FGYDKDFDKRYTIGKLLGHGQFGYTYVATDKS---VGDRVAVKRIEKKKMLLPMAVEDVK 731
           FG+ K+F  +Y +GK +G G FG+T  A  K     G  VAVK I K KM   +++EDV+
Sbjct: 138 FGFAKNFGAKYDLGKEVGRGHFGHTCSAVVKKGEHKGHTVAVKIISKAKMTTAISIEDVR 197

Query: 732 REVKILKALTG 764
           REVKILKAL+G
Sbjct: 198 REVKILKALSG 208



>pir|T02033|T02033 calcium/calmodulin-dependent protein kinase
           homolog - maize>gb:S82324_1704627
           calcium/calmodulin-dependent protein kinase homolog|CaM
           kinase homolog|MCK1 [Zea mays=maize, cv. Merit, root
           caps, mRNA, 2483 nt].
          Length = 625

 Score = 66.6 bits (161), Expect = 5e-10
 Identities = 36/71 (50%), Positives = 47/71 (66%), Gaps = 3/71 (4%)
 Frame = +3

Query: 561 FGYDKDFDKRYTIGKLLGHGQFGYTYVATDKS---VGDRVAVKRIEKKKMLLPMAVEDVK 731
           FG+ K+F  +Y +GK +G G FG+T  A  K     G  VAVK I K KM   +++EDV+
Sbjct: 164 FGFAKNFGAKYDLGKEVGRGHFGHTCSAVVKKGEHKGHTVAVKIISKAKMTTAISIEDVR 223

Query: 732 REVKILKALTG 764
           REVKILKAL+G
Sbjct: 224 REVKILKALSG 234



>gb:AP004678_1843224 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, BAC clone:OJ1136_F03.
          Length = 623

 Score = 66.2 bits (160), Expect = 6e-10
 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 3/71 (4%)
 Frame = +3

Query: 561 FGYDKDFDKRYTIGKLLGHGQFGYTYVATDKS---VGDRVAVKRIEKKKMLLPMAVEDVK 731
           FG+ K+F  +Y +GK +G G FG+T  A  K     G  VAVK I K KM   +++EDV+
Sbjct: 162 FGFSKNFGAKYELGKEVGRGHFGHTCSAVVKKGEYKGQTVAVKIIAKAKMTTAISIEDVR 221

Query: 732 REVKILKALTG 764
           REVKIL+AL+G
Sbjct: 222 REVKILRALSG 232



>gb:NTA344155_1691348 Nicotiana tabacum mRNA for calcium-dependent
           protein kinase 3 (cdpk3 gene).
          Length = 578

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 42/128 (32%), Positives = 62/128 (48%), Gaps = 3/128 (2%)
 Frame = +3

Query: 390 PTAKPRSDTTATSAQDEERSRCNRRKAKEPCEKYKNLNVKPSHRSQTVVIPCGKRTDFGY 569
           P  +P    T   ++ +E  +   +K K+P E  +             V   G RTD   
Sbjct: 57  PVQEPPEQMTMPKSEKKEEEKEQPKKPKKPAEMKR-------------VSSAGLRTDSVL 103

Query: 570 DK---DFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREV 740
            K   +  + ++IGK LG GQFG T+   +K+ G   A K I K+K+L    VEDV+REV
Sbjct: 104 QKKTGNLKEFFSIGKKLGQGQFGTTFKCVEKATGKEYACKSIAKRKLLTDDDVEDVRREV 163

Query: 741 KILKALTG 764
           +I+  L G
Sbjct: 164 QIMHHLAG 171



>gb:AB051808_1521147 Solanum tuberosum RiCDPK1 mRNA for calcium
           dependent protein kinase, complete cds.
          Length = 578

 Score = 65.1 bits (157), Expect = 1e-09
 Identities = 42/128 (32%), Positives = 62/128 (48%), Gaps = 3/128 (2%)
 Frame = +3

Query: 390 PTAKPRSDTTATSAQDEERSRCNRRKAKEPCEKYKNLNVKPSHRSQTVVIPCGKRTDFGY 569
           P  +P    T   ++ +E  +   +K K+P E  +             V   G RTD   
Sbjct: 57  PVQEPPEQMTMPKSEKKEEEKEQPKKPKKPAEMKR-------------VSSAGLRTDSVL 103

Query: 570 DK---DFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREV 740
            K   +  + ++IGK LG GQFG T+   +K+ G   A K I K+K+L    VEDV+REV
Sbjct: 104 QKKTGNLKEFFSIGKKLGQGQFGTTFKCVEKATGKEYACKSIAKRKLLTDDDVEDVRREV 163

Query: 741 KILKALTG 764
           +I+  L G
Sbjct: 164 QIMHHLAG 171



>gb:AJ699161_1813475 Nicotiana plumbaginifolia mRNA for
           calcium-dependent protein kinase 17 (cpk17 gene).
          Length = 534

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 32/64 (50%), Positives = 44/64 (68%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D  K Y+IGK LG GQFG T++ T K  G++ A K I K+K++    +EDVKREV+I+ 
Sbjct: 71  EDVRKTYSIGKELGRGQFGITHLCTHKQSGEQFACKTIAKRKLVNKEDIEDVKREVQIMH 130

Query: 753 ALTG 764
            LTG
Sbjct: 131 HLTG 134



>gb:AC135595_1742676 Oryza sativa chromosome 3 BAC OSJNBa0028F23
           genomic sequence, complete sequence.>gb:AC145384_1744401
           Oryza sativa chromosome 3 BAC OSJNBa0060M17 genomic
           sequence, complete sequence.
          Length = 538

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 29/60 (48%), Positives = 41/60 (68%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D   RY +G  LG G+FG TY+ T+   GDR A K I K+K+  P+ VEDV+REV+I++
Sbjct: 58  RDLGARYELGGELGRGEFGITYLCTEAETGDRYACKSISKRKLRTPVDVEDVRREVEIMR 117



>gb:AY312269_1598243 Cicer arietinum calcium-dependent
           calmodulin-independent protein kinase isoform 2 (CDPK2)
           mRNA, complete cds.
          Length = 540

 Score = 64.7 bits (156), Expect = 2e-09
 Identities = 37/113 (32%), Positives = 60/113 (53%), Gaps = 1/113 (0%)
 Frame = +3

Query: 417 TATSAQDEERSRCNRRKAKEPCEKYKNLNVKPSHRSQTVVI-PCGKRTDFGYDKDFDKRY 593
           T     + ++    + K + P     N N   ++   TV+  P G+        + + RY
Sbjct: 11  TGEETNNNKKKNNKKPKKENPFAIDYNFNANNTNSKLTVLKDPTGR--------EIEVRY 62

Query: 594 TIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
            +G+ LG G+FG TY+ TDK  G+ +A K I KKK+   + +EDV+REV+I+K
Sbjct: 63  ELGRELGRGEFGITYLCTDKENGEELACKSISKKKLRTLVDIEDVRREVEIMK 115



>gb:AF462819_1801932 Arabidopsis thaliana At2g46700/T3A4.8 mRNA,
           complete cds.
          Length = 595

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 35/72 (48%), Positives = 47/72 (65%), Gaps = 4/72 (5%)
 Frame = +3

Query: 561 FGYDKDFDKRYTIGKLLGHGQFGYTYVATDKSVGD----RVAVKRIEKKKMLLPMAVEDV 728
           FGY K+F  +Y +GK +G G FG+T     K  GD     +AVK I K KM   +A+EDV
Sbjct: 133 FGYGKNFGAKYELGKEVGRGHFGHTCSGRGKK-GDIKDHPIAVKIISKAKMTTAIAIEDV 191

Query: 729 KREVKILKALTG 764
           +REVK+LK+L+G
Sbjct: 192 RREVKLLKSLSG 203



>gb:AF435449_1799829 Arabidopsis thaliana
           calcium/calmodulin-dependent protein kinase CaMK4 mRNA,
           complete cds.
          Length = 595

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 35/72 (48%), Positives = 47/72 (65%), Gaps = 4/72 (5%)
 Frame = +3

Query: 561 FGYDKDFDKRYTIGKLLGHGQFGYTYVATDKSVGD----RVAVKRIEKKKMLLPMAVEDV 728
           FGY K+F  +Y +GK +G G FG+T     K  GD     +AVK I K KM   +A+EDV
Sbjct: 133 FGYGKNFGAKYELGKEVGRGHFGHTCSGRGKK-GDIKDHPIAVKIISKAKMTTAIAIEDV 191

Query: 729 KREVKILKALTG 764
           +REVK+LK+L+G
Sbjct: 192 RREVKLLKSLSG 203



>gb:AF216527_1778089 Dunaliella tertiolecta calcium-dependent
           protein kinase mRNA, complete cds.
          Length = 595

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 44/128 (34%), Positives = 62/128 (48%), Gaps = 6/128 (4%)
 Frame = +3

Query: 399 KPRSDTTATSAQDEERSRCNRRKAKEPCEKYKNLNVKPSHRSQTVVIPCGKRTDFGY--- 569
           K   D   ++ +DE       +K K   E    L +KP    Q V     ++    +   
Sbjct: 85  KAPMDKALSAGKDELTLPIITKKGKPHGEVKLILTLKPDATKQMVTSHKTRKAAGAWILP 144

Query: 570 ---DKDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREV 740
              + D  K Y  G LLG G FG TY+AT+K  G + AVK I K+K+  P  V+DVK+EV
Sbjct: 145 TYGNTDCWKDYEPGTLLGKGTFGTTYLATEKKTGQKCAVKVISKRKLTTPDEVDDVKKEV 204

Query: 741 KILKALTG 764
           +I+  L G
Sbjct: 205 QIMHHLAG 212



>gb:AY079049_1568161 Lycopersicon esculentum serine/threonine
           protein kinase pk23 mRNA, complete cds.
          Length = 598

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 3/71 (4%)
 Frame = +3

Query: 561 FGYDKDFDKRYTIGKLLGHGQFGYTYVATDKS---VGDRVAVKRIEKKKMLLPMAVEDVK 731
           FGY K+   +Y +GK +G G FG+T  A  K        VAVK I K KM   +++EDV+
Sbjct: 136 FGYPKNLTSKYELGKEVGRGHFGHTCWAKGKKGELKNQPVAVKIISKAKMTTAISIEDVR 195

Query: 732 REVKILKALTG 764
           REVKILKAL+G
Sbjct: 196 REVKILKALSG 206



>pir|B84906|B84906 probable calcium-dependent protein kinase
           [imported] - Arabidopsis thaliana>gb:AC005819_1533022
           Arabidopsis thaliana chromosome 2 clone T3A4 map
           CIC06C03, complete sequence.
          Length = 595

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 35/72 (48%), Positives = 47/72 (65%), Gaps = 4/72 (5%)
 Frame = +3

Query: 561 FGYDKDFDKRYTIGKLLGHGQFGYTYVATDKSVGD----RVAVKRIEKKKMLLPMAVEDV 728
           FGY K+F  +Y +GK +G G FG+T     K  GD     +AVK I K KM   +A+EDV
Sbjct: 133 FGYGKNFGAKYELGKEVGRGHFGHTCSGRGKK-GDIKDHPIAVKIISKAKMTTAIAIEDV 191

Query: 729 KREVKILKALTG 764
           +REVK+LK+L+G
Sbjct: 192 RREVKLLKSLSG 203



>pir|T03023|T03023 calcium-dependent protein kinase-related protein
           kinase - maize>gb:MZECDPKB_1687851 Zea mays mRNA for
           CDPK-related protein kinase, complete cds, clone ZmCRK3.
          Length = 607

 Score = 64.3 bits (155), Expect = 2e-09
 Identities = 35/71 (49%), Positives = 46/71 (64%), Gaps = 3/71 (4%)
 Frame = +3

Query: 561 FGYDKDFDKRYTIGKLLGHGQFGYTYVATDKS---VGDRVAVKRIEKKKMLLPMAVEDVK 731
           FG+  +F  +Y +GK +G G FG+T  A  K     G  VAVK I K KM   +++EDV+
Sbjct: 146 FGFANNFGAKYDLGKEVGRGHFGHTCSALVKKGEYKGHAVAVKIISKAKMTTAISIEDVR 205

Query: 732 REVKILKALTG 764
           REVKILKAL+G
Sbjct: 206 REVKILKALSG 216



>gb:AP004671_1843081 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC
           clone:P0524G08.>gb:AP005292_1850019 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 7, BAC
           clone:OJ1340_C08.
          Length = 594

 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 42/97 (43%), Positives = 54/97 (55%), Gaps = 9/97 (9%)
 Frame = +3

Query: 501 NVKPSHRSQTVVIPCGKRTD------FGYDKDFDKRYTIGKLLGHGQFGYTYVATDKS-- 656
           +VKP+       IP G  T+      FG+ K F  +Y +G  +G G FGYT  A  K   
Sbjct: 109 SVKPNEAP----IPEGGETEVGLDKGFGFSKHFFAKYELGDEVGRGHFGYTCSAKAKKGD 164

Query: 657 -VGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
             G  VAVK I K KM   +A+EDV+REV+IL +LTG
Sbjct: 165 HKGHDVAVKVIPKAKMTTAIAIEDVRREVRILSSLTG 201



>gb:SOL549109_1715810 Spirodela oligorrhiza partial mRNA for
           putative calcium-dependent protein kinase (cdpk2 gene).
          Length = 182

 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 42/122 (34%), Positives = 60/122 (49%)
 Frame = +3

Query: 399 KPRSDTTATSAQDEERSRCNRRKAKEPCEKYKNLNVKPSHRSQTVVIPCGKRTDFGYDKD 578
           KP      ++ Q +     N    K P      L   P+  S  V    G+R +     D
Sbjct: 19  KPDPLDEPSTRQAQNGGSANAPPQKPPGAVTGVLRQPPAKGSAAVGPVLGRRME-----D 73

Query: 579 FDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
             + Y IGK LG GQFG T++ TD+  G + A K I K+K++    +EDV+REV+I+  L
Sbjct: 74  VRQTYAIGKELGRGQFGVTHLCTDRVTGKQFACKTIAKRKLVNKEDIEDVRREVQIMHHL 133

Query: 759 TG 764
           TG
Sbjct: 134 TG 135



>gb:SOL549108_1715809 Spirodela oligorrhiza mRNA for
           calcium-dependent protein kinase (cdpk1 gene).
          Length = 548

 Score = 63.9 bits (154), Expect = 3e-09
 Identities = 31/64 (48%), Positives = 44/64 (68%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D   +YTIGK+LG GQFG TY+ T  S G + A K I K+K++     EDVKRE++I++
Sbjct: 95  EDVKAKYTIGKVLGRGQFGVTYLCTCNSTGAKYACKSISKRKLVNRNDREDVKREIQIMQ 154

Query: 753 ALTG 764
            L+G
Sbjct: 155 HLSG 158



>gb:AP003866_1834557 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1092_A07.
          Length = 550

 Score = 63.5 bits (153), Expect = 4e-09
 Identities = 36/112 (32%), Positives = 59/112 (52%), Gaps = 3/112 (2%)
 Frame = +3

Query: 432 QDEERSRCNRRKAKEPCE---KYKNLNVKPSHRSQTVVIPCGKRTDFGYDKDFDKRYTIG 602
           ++ ++ +  ++K K+P     +Y   +    HR   +  P G+        D   RY +G
Sbjct: 27  KEPKQQQQQQKKGKKPNPFSIEYNRSSAPSGHRLVVLREPTGR--------DIAARYELG 78

Query: 603 KLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
             LG G+FG TY+ T++  GD  A K I KKK+   + +EDV+REV I++ L
Sbjct: 79  GELGRGEFGVTYLCTERETGDAYACKSISKKKLRTAVDIEDVRREVDIMRHL 130



>gb:AP004082_1837423 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC clone:OJ1149_C12.
          Length = 545

 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 30/58 (51%), Positives = 39/58 (67%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           YT+G+ LG GQFG TY+ T  S G   A K I K+K+L P  VEDV+RE++I+  L G
Sbjct: 74  YTVGRKLGQGQFGTTYLCTQVSTGAEYACKSIAKRKLLSPEDVEDVRREIQIMHHLAG 131



>gb:AF289237_1783537 Zea mays calcium/calmodulin dependent protein
           kinase MCK2 (MCK2) gene, complete cds.
          Length = 607

 Score = 63.2 bits (152), Expect = 5e-09
 Identities = 34/71 (47%), Positives = 46/71 (64%), Gaps = 3/71 (4%)
 Frame = +3

Query: 561 FGYDKDFDKRYTIGKLLGHGQFGYTYVATDKS---VGDRVAVKRIEKKKMLLPMAVEDVK 731
           FG+  +F  +Y +GK +G G FG+T  A  K     G  VAVK I K KM   +++EDV+
Sbjct: 146 FGFANNFGAKYDLGKEVGRGHFGHTCSALVKKGEYKGHAVAVKIISKAKMTTAISIEDVR 205

Query: 732 REVKILKALTG 764
           REV+ILKAL+G
Sbjct: 206 REVRILKALSG 216



>gb:ATT2L20_1555752 Arabidopsis thaliana DNA chromosome 5, BAC clone
           T2L20 (ESSA project).>gb:ATU31836_1556905 Arabidopsis
           thaliana calmodulin-domain protein kinase CDPK isoform 7
           (CPK7) mRNA, complete cds.>gb:AF361634_1791380
           Arabidopsis thaliana AT5g19450/F7K24_200 mRNA, complete
           cds.
          Length = 535

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 27/59 (45%), Positives = 41/59 (69%)
 Frame = +3

Query: 576 DFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           D   +Y +G+ +G G+FG TY+ TDK  G++ A K I KKK+   + +EDV+REV+I+K
Sbjct: 54  DISLQYDLGREVGRGEFGITYLCTDKETGEKYACKSISKKKLRTAVDIEDVRREVEIMK 112



>gb:AC011560_1537233 Arabidopsis thaliana chromosome 3 BAC F13M14
           genomic sequence, complete
           sequence.>gb:ATAC013428_1543512 Arabidopsis thaliana
           chromosome III BAC F18K10 genomic sequence, complete
           sequence.>gb:ATU31833_1556902 Arabidopsis thaliana
           calmodulin-domain protein kinase CDPK isoform 2 (CPK2)
           mRNA, complete cds.>gb:AF286222_1783198 Arabidopsis
           thaliana calcium-dependent protein kinase isoform 2
           (CPK2) gene, complete cds.
          Length = 646

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 42/129 (32%), Positives = 66/129 (51%), Gaps = 5/129 (3%)
 Frame = +3

Query: 393 TAKP--RSDTTATSAQDEERSRCNRRKAKEPCEKYKNLNVKPSHRSQTVVIPCGKRTDFG 566
           +AKP  +S++   + + E  S        EP         KP H  +  V   G RT+  
Sbjct: 125 SAKPETKSESKPETTKPETTSETKPETKAEP--------QKPKHMRR--VSSAGLRTESV 174

Query: 567 YDK---DFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKRE 737
             +   +F + Y++G+ LG GQFG T++  +K  G+  A K I K+K+L    VEDV+RE
Sbjct: 175 LQRKTENFKEFYSLGRKLGQGQFGTTFLCLEKGTGNEYACKSISKRKLLTDEDVEDVRRE 234

Query: 738 VKILKALTG 764
           ++I+  L G
Sbjct: 235 IQIMHHLAG 243



>pir|T05476|T05476 calcium-dependent protein kinase (EC 2.7.1.-)
           T8O5.150 - Arabidopsis thaliana>gb:ATCHRIV56_1546031
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 56.>gb:ATT8O5_1556521 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T8O5 (ESSAII
           project).>gb:AY034995_1559774 Arabidopsis thaliana
           putative calcium-dependent protein kinase (At4g21940)
           mRNA, complete cds.>gb:AY063004_1565590 Arabidopsis
           thaliana putative calcium-dependent protein kinase
           (At4g21940) mRNA, complete cds.
          Length = 554

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 42/124 (33%), Positives = 62/124 (50%), Gaps = 2/124 (1%)
 Frame = +3

Query: 399 KPRSDTTATSAQDEERSRCNRRKAKEPCEKYKNLN--VKPSHRSQTVVIPCGKRTDFGYD 572
           KP S    T+ Q     +   +   +  EK   L   +KP    +T  I  GK  +    
Sbjct: 42  KPPSPQIPTTTQSNHHHQQESKPVNQQIEKKHVLTQPLKPIVFRETETI-LGKPFE---- 96

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
            +  K YT+GK LG GQFG TY   + S G+  A K I K+K+     ++DVKRE++I++
Sbjct: 97  -EIRKLYTLGKELGRGQFGITYTCKENSTGNTYACKSILKRKLTRKQDIDDVKREIQIMQ 155

Query: 753 ALTG 764
            L+G
Sbjct: 156 YLSG 159



>sp|Q06850|CDP1_ARATH Calcium-dependent protein kinase, isoform AK1
           (EC 2.7.1.-) (CDPK).>pir|A49082|A49082 calcium-dependent
           protein kinase (EC 2.7.1.-) AK1 - Arabidopsis
           thaliana>gb:AB008271_1510511 Arabidopsis thaliana
           genomic DNA, chromosome 5, P1
           clone:MUK11.>gb:ATHCALLIPR_1553087 Arabidopsis thaliana
           calcium dependent protein kinase (AK1 isoform) mRNA,
           complete cds.>gb:BT005932_1638854 Arabidopsis thaliana
           At5g04870 gene, complete cds.>gb:AK118706_1816669
           Arabidopsis thaliana At5g04870 mRNA for putative
           calcium-dependent protein kinase, complete cds, clone:
           RAFL21-01-N11.
          Length = 610

 Score = 62.8 bits (151), Expect = 7e-09
 Identities = 39/114 (34%), Positives = 60/114 (52%), Gaps = 3/114 (2%)
 Frame = +3

Query: 432 QDEERSRCNRRKAKEPCEKYKNLNVKPSHRSQTVVIPCGKRTDFGYDK---DFDKRYTIG 602
           + E +S        +P  K K    KP H  +  V   G RT+    +   +F + Y++G
Sbjct: 100 KQETKSETKPESKPDPPAKPK----KPKHMKR--VSSAGLRTESVLQRKTENFKEFYSLG 153

Query: 603 KLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           + LG GQFG T++  +K+ G   A K I K+K+L    VEDV+RE++I+  L G
Sbjct: 154 RKLGQGQFGTTFLCVEKTTGKEFACKSIAKRKLLTDEDVEDVRREIQIMHHLAG 207



>gb:AC084296_1733477 Oryza sativa chromosome 3 BAC OSJNBb0024J04
           genomic sequence, complete sequence.>gb:AC087096_1733916
           Oryza sativa chromosome 3 BAC OSJNBa0087O09 genomic
           sequence, complete sequence.
          Length = 576

 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 30/58 (51%), Positives = 39/58 (67%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           YTIGK LG GQFG TY+  +K+ G   A K I K+K+L    VEDV+RE++I+  L G
Sbjct: 113 YTIGKKLGQGQFGTTYLCVEKATGREFACKSIAKRKLLTQEDVEDVRREIQIMHHLAG 170



>gb:AY072126_1567020 Arabidopsis thaliana putative calcium-dependent
           protein kinase (At5g12180) mRNA, complete cds.
          Length = 528

 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 30/64 (46%), Positives = 43/64 (67%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D    Y++GK LG GQFG T++ T KS G + A K I K+K++    +EDV+REV+I+ 
Sbjct: 67  EDVKASYSLGKELGRGQFGVTHLCTQKSTGHQFACKTIAKRKLVNKEDIEDVRREVQIMH 126

Query: 753 ALTG 764
            LTG
Sbjct: 127 HLTG 130



>pir|G96543|G96543 calcium-dependent protein kinase [imported] -
           Arabidopsis thaliana>gb:AE005173_892987 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:BT012659_1641729 Arabidopsis thaliana
           At1g50700 gene, complete cds.>gb:AC079279_1732414
           Arabidopsis thaliana chromosome 1 BAC F17J6 genomic
           sequence, complete sequence.>gb:AK175623_1817611
           Arabidopsis thaliana mRNA for hypothetical protein,
           complete cds, clone: RAFL22-10-I02.
          Length = 521

 Score = 62.4 bits (150), Expect = 9e-09
 Identities = 29/58 (50%), Positives = 41/58 (70%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           YT+ K LG GQFG TY+ T+KS G R A K I KKK++     ED++RE++I++ L+G
Sbjct: 73  YTLSKELGRGQFGVTYLCTEKSTGKRFACKSISKKKLVTKGDKEDMRREIQIMQHLSG 130



>gb:BT011630_1641152 Arabidopsis thaliana At3g57530 mRNA, complete
           cds.>gb:BT012274_1641480 Arabidopsis thaliana At3g57530
           gene, complete cds.
          Length = 538

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 27/60 (45%), Positives = 42/60 (70%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           ++ + +YT+G+ LG G+FG TY+ TDK   D  A K I KKK+   + +EDV+REV+I++
Sbjct: 57  REIESKYTLGRELGRGEFGVTYLCTDKETDDVFACKSILKKKLRTAVDIEDVRREVEIMR 116



>gb:AY247756_1592604 Glycine max seed calcium dependent protein
           kinase c mRNA, complete cds.
          Length = 537

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 36/94 (38%), Positives = 54/94 (57%), Gaps = 3/94 (3%)
 Frame = +3

Query: 492 KNLNVKPSHRSQTVVIPCGKRTDFGYDKDFD---KRYTIGKLLGHGQFGYTYVATDKSVG 662
           +N+  KP   + +     G R D    K F+   + YT+GK LG GQFG TY+ T+ S G
Sbjct: 48  QNMPWKPPGPALSPKPVVGVRQDTILGKQFEDVKQFYTLGKELGRGQFGVTYLCTENSTG 107

Query: 663 DRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
            + A K I K+K+      ED+KRE++I++ L+G
Sbjct: 108 LQYACKSISKRKLASKSDKEDIKREIQIMQHLSG 141



>pir|T46189|T46189 calcium-dependent protein kinase - Arabidopsis
           thaliana>gb:ATT8H10_1556477 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T8H10.
          Length = 560

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 27/60 (45%), Positives = 42/60 (70%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           ++ + +YT+G+ LG G+FG TY+ TDK   D  A K I KKK+   + +EDV+REV+I++
Sbjct: 57  REIESKYTLGRELGRGEFGVTYLCTDKETDDVFACKSILKKKLRTAVDIEDVRREVEIMR 116



>pir|T01989|T01989 calcium-dependent protein kinase (EC 2.7.1.-) 1 -
           common tobacco>gb:AF072908_1765913 Nicotiana tabacum
           calcium-dependent protein kinase (CDPK1) mRNA, complete
           cds.
          Length = 540

 Score = 62.0 bits (149), Expect = 1e-08
 Identities = 30/64 (46%), Positives = 44/64 (68%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D  K+YT+GK LG GQFG TY  T+ S G+  A K I K+K++     ED+KRE++I++
Sbjct: 87  EDIRKQYTLGKELGRGQFGVTYHCTENSTGNPYACKSILKRKLVRKNDREDMKREIQIMQ 146

Query: 753 ALTG 764
            L+G
Sbjct: 147 HLSG 150



>gb:AF363784_1791547 Lycopersicon esculentum calcium-dependent
           protein kinase CDPK1 mRNA, complete cds.
          Length = 521

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 28/64 (43%), Positives = 43/64 (67%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D    YT+GK LG GQFG TY+ T+ + G + A K I KKK++     +D++RE+KI++
Sbjct: 67  EDVKLHYTLGKELGRGQFGVTYLCTEIATGQQYACKSISKKKLVTKADKDDMRREIKIMQ 126

Query: 753 ALTG 764
            L+G
Sbjct: 127 HLSG 130



>gb:AF090835_1767408 Mesembryanthemum crystallinum Ca2+-dependent
           protein kinase (CPK1) mRNA, complete cds.
          Length = 534

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 27/64 (42%), Positives = 43/64 (67%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D    YT+G+ LG GQFG TY+ TDK  G + A K I KKK++     +D++RE++I++
Sbjct: 80  EDVKVYYTLGRELGRGQFGVTYLCTDKKTGQQYACKSISKKKLVTKADKDDMRREIQIMQ 139

Query: 753 ALTG 764
            ++G
Sbjct: 140 HMSG 143



>gb:AE005173_895138 Arabidopsis thaliana chromosome 1, bottom arm
           complete sequence.>gb:AC007396_1535843 Genomic sequence
           for Arabidopsis thaliana BAC T4O12 from chromosome I,
           complete sequence.
          Length = 980

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 32/63 (50%), Positives = 39/63 (61%)
 Frame = +3

Query: 576 DFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKA 755
           D    Y + K LG GQFG TY  TDKS G   A K I K+K++    +EDV+REV IL+ 
Sbjct: 107 DLSALYDLHKELGRGQFGITYKCTDKSNGREYACKSISKRKLIRRKDIEDVRREVMILQH 166

Query: 756 LTG 764
           LTG
Sbjct: 167 LTG 169



>pir|C84774|C84774 probable calcium-dependent protein kinase
           [imported] - Arabidopsis thaliana>gb:AC007017_1534964
           Arabidopsis thaliana chromosome 2 clone F11F19 map
           g6825, complete sequence.
          Length = 520

 Score = 61.6 bits (148), Expect = 1e-08
 Identities = 31/71 (43%), Positives = 45/71 (63%)
 Frame = +3

Query: 552 RTDFGYDKDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVK 731
           +T  G+ K++   Y +G  LGHGQFG T+V  +K  G+  A K I K+K+     VEDV+
Sbjct: 122 KTKTGHLKEY---YNLGSKLGHGQFGTTFVCVEKGTGEEYACKSIPKRKLENEEDVEDVR 178

Query: 732 REVKILKALTG 764
           RE++I+K L G
Sbjct: 179 REIEIMKHLLG 189



>gb:AF153352_1772831 Arabidopsis thaliana CDPK-related kinase 2
           (CRK2) mRNA, partial cds.
          Length = 594

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 33/71 (46%), Positives = 44/71 (61%), Gaps = 3/71 (4%)
 Frame = +3

Query: 561 FGYDKDFDKRYTIGKLLGHGQFGYTYVATDKS---VGDRVAVKRIEKKKMLLPMAVEDVK 731
           FG+ K+   R  +G+ +G G FGYT  A  K        VAVK I K KM   +++EDV+
Sbjct: 129 FGFSKELQSRIELGEEIGRGHFGYTCSAKFKKGELKDQEVAVKVIPKSKMTSAISIEDVR 188

Query: 732 REVKILKALTG 764
           REVKIL+AL+G
Sbjct: 189 REVKILRALSG 199



>gb:AC137608_1743475 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0009C07, complete sequence.
          Length = 542

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 31/64 (48%), Positives = 40/64 (62%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D    YT G+ LG GQFG TY+AT K  G R A K I  +K+  P  ++DV+REV I+ 
Sbjct: 84  EDVRATYTFGRELGRGQFGVTYLATHKPTGRRYACKSIAARKLARPDDLDDVRREVHIMH 143

Query: 753 ALTG 764
            LTG
Sbjct: 144 HLTG 147



>gb:NBE344156_1688165 Nicotiana benthamiana mRNA for
           calcium-dependent protein kinase 2 (cdpk2 gene).
          Length = 581

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 47/128 (36%), Positives = 63/128 (49%), Gaps = 3/128 (2%)
 Frame = +3

Query: 390 PTAKPRSDTTATSAQDEERSRCNRRKAKEPCEKYKNLNVKPSHRSQTVVIPCGKRTDFGY 569
           P+  P   T   S Q EE       K +E  EK K    KP    +  V   G RTD   
Sbjct: 57  PSKPPEQITMPKSDQKEEEPA----KKEEGPEKPK----KPVQMKR--VGSAGLRTDSVL 106

Query: 570 DK---DFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREV 740
            K   +  + ++IGK LG GQFG T+   +K+ G   A K I K+K+L    VEDV+RE+
Sbjct: 107 QKKTGNLKEFFSIGKKLGQGQFGTTFKCVEKATGKEYACKSIAKRKLLTDDDVEDVRREI 166

Query: 741 KILKALTG 764
           +I+  L G
Sbjct: 167 QIMHHLAG 174



>gb:AY395701_1604823 Malus x domestica calcium-dependent protein
           kinase (MdCPK1) mRNA, complete cds.
          Length = 543

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 38/122 (31%), Positives = 64/122 (52%)
 Frame = +3

Query: 399 KPRSDTTATSAQDEERSRCNRRKAKEPCEKYKNLNVKPSHRSQTVVIPCGKRTDFGYDKD 578
           +P +       Q ++R++     A +P  +Y+  +  P+  +       GK  D     D
Sbjct: 40  QPHNPPPPPRPQPQQRAQ----PAPQPRAQYQQPSPPPAKPAPQPNSILGKPFD-----D 90

Query: 579 FDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
             + YT+GK LG GQFG TY+ T+ S G   A K I K+K++     +D+KRE++I++ L
Sbjct: 91  IKQYYTLGKELGRGQFGITYLCTENSTGHSYACKSILKRKLVSKNDRDDIKREIQIMQHL 150

Query: 759 TG 764
           +G
Sbjct: 151 SG 152



>gb:AY058851_1564388 Arabidopsis thaliana AT3g19100/MVI11_1 mRNA,
           complete cds.>gb:AY079035_1568148 Arabidopsis thaliana
           AT3g19100/MVI11_1 mRNA, complete
           cds.>gb:AF435447_1799827 Arabidopsis thaliana
           calcium/calmodulin-dependent protein kinase CaMK2 mRNA,
           complete cds.>gb:AP000419_1820131 Arabidopsis thaliana
           genomic DNA, chromosome 3, P1 clone: MVI11.
          Length = 599

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 33/71 (46%), Positives = 44/71 (61%), Gaps = 3/71 (4%)
 Frame = +3

Query: 561 FGYDKDFDKRYTIGKLLGHGQFGYTYVATDKS---VGDRVAVKRIEKKKMLLPMAVEDVK 731
           FG+ K+   R  +G+ +G G FGYT  A  K        VAVK I K KM   +++EDV+
Sbjct: 134 FGFSKELQSRIELGEEIGRGHFGYTCSAKFKKGELKDQEVAVKVIPKSKMTSAISIEDVR 193

Query: 732 REVKILKALTG 764
           REVKIL+AL+G
Sbjct: 194 REVKILRALSG 204



>gb:AB024036_1515856 Arabidopsis thaliana genomic DNA, chromosome 3,
           P1 clone: MQC12.>gb:ATU31751_1556899 Arabidopsis
           thaliana calmodulin-domain protein kinase CDPK isoform 9
           (CPK9) mRNA, complete cds.>gb:AY120727_1579609
           Arabidopsis thaliana calmodulin-domain protein kinase
           CDPK isoform 9 (At3g20410) mRNA, complete
           cds.>gb:BT008898_1640094 Arabidopsis thaliana At3g20410
           mRNA, complete cds.
          Length = 541

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 27/58 (46%), Positives = 41/58 (70%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           YT+GK LG GQFG TY+ T+ S G + A K I KKK++     +D++RE++I++ L+G
Sbjct: 91  YTLGKELGRGQFGVTYLCTENSTGKKYACKSISKKKLVTKADKDDMRREIQIMQHLSG 148



>gb:AB007727_1510289 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MXC9.>gb:BT015921_1642539 Arabidopsis thaliana
           At5g12180 gene, complete cds.
          Length = 528

 Score = 61.2 bits (147), Expect = 2e-08
 Identities = 29/64 (45%), Positives = 43/64 (67%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D    Y++GK LG GQFG T++ T K+ G + A K I K+K++    +EDV+REV+I+ 
Sbjct: 67  EDVKASYSLGKELGRGQFGVTHLCTQKATGHQFACKTIAKRKLVNKEDIEDVRREVQIMH 126

Query: 753 ALTG 764
            LTG
Sbjct: 127 HLTG 130



>gb:AF435450_1799830 Nicotiana tabacum calcium/calmodulin-dependent
           protein kinase CaMK1 mRNA, complete cds.
          Length = 599

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 34/71 (47%), Positives = 44/71 (61%), Gaps = 3/71 (4%)
 Frame = +3

Query: 561 FGYDKDFDKRYTIGKLLGHGQFGYTYVATDKS---VGDRVAVKRIEKKKMLLPMAVEDVK 731
           FGY K+   +  +GK +G G FG+T  A  K        VAVK I K KM   +++EDV+
Sbjct: 137 FGYPKNLTAKIELGKEVGRGHFGHTCWAKGKKGELKNQPVAVKIISKAKMTTAISIEDVR 196

Query: 732 REVKILKALTG 764
           REVKILKAL+G
Sbjct: 197 REVKILKALSG 207



>gb:AC129718_1740648 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OSJNBa0088I06, complete sequence.
          Length = 528

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 31/64 (48%), Positives = 40/64 (62%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D    YT+GK LG GQFG T + T K+ G R A K I K+K+     VEDV+REV+I+ 
Sbjct: 62  EDVKSIYTVGKELGRGQFGVTSLCTHKATGQRFACKTISKRKLSTKEDVEDVRREVQIMY 121

Query: 753 ALTG 764
            L G
Sbjct: 122 HLAG 125



>gb:NTA344154_1691347 Nicotiana tabacum mRNA for calcium-dependent
           protein kinase 2 (cdpk2 gene).
          Length = 581

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 40/107 (37%), Positives = 59/107 (55%), Gaps = 4/107 (3%)
 Frame = +3

Query: 456 NRRKAKEPCEKYKNLNVKPSHRSQTVVI-PCGKRTDFGYDK---DFDKRYTIGKLLGHGQ 623
           + +K +EP +K +   VKP    +   +   G RTD    K   +  + ++IGK LG GQ
Sbjct: 69  SEQKEEEPAKKEEG-PVKPKKPVEMKRVGSAGLRTDSVLQKKTGNLKEFFSIGKKLGQGQ 127

Query: 624 FGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           FG T+   +K+ G   A K I K+K+L    VEDV+REV+I+  L G
Sbjct: 128 FGTTFKCVEKATGKEYACKSIAKRKLLTDDDVEDVRREVQIMHHLAG 174



>pir|H84810|H84810 probable calcium-dependent protein kinase
           [imported] - Arabidopsis thaliana>gb:AC005770_1532993
           Arabidopsis thaliana chromosome 2 clone T7F6 map
           CIC10A06, complete sequence.
          Length = 583

 Score = 60.8 bits (146), Expect = 3e-08
 Identities = 27/58 (46%), Positives = 39/58 (67%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           Y++G+ LG GQFG T++  DK  G   A K I K+K+  P  VEDV+RE++I+  L+G
Sbjct: 134 YSVGRKLGQGQFGTTFLCVDKKTGKEFACKTIAKRKLTTPEDVEDVRREIQIMHHLSG 191



>gb:AJ621356_1812338 Triticum aestivum mRNA for putative
           calcium-dependent protein kinase (cdpk1 gene).
          Length = 518

 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 30/64 (46%), Positives = 41/64 (64%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D    YT G+ LG GQFG TY+ T K+ G R A K I  +K++    +EDV+REV+I+ 
Sbjct: 60  EDVRATYTFGRELGRGQFGVTYLVTHKATGQRFACKSIATRKLVHRDDIEDVQREVQIMH 119

Query: 753 ALTG 764
            LTG
Sbjct: 120 HLTG 123



>pir|T09940|T09940 calcium-dependent protein kinase (EC 2.7.1.-)
           CDPK - pumpkin>gb:CPU90262_1648932 Cucurbita pepo
           calcium-dependent calmodulin-independent protein kinase
           CDPK (cpCPK1) mRNA, complete cds.
          Length = 573

 Score = 60.5 bits (145), Expect = 3e-08
 Identities = 28/63 (44%), Positives = 43/63 (68%)
 Frame = +3

Query: 576 DFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKA 755
           +F + Y++GK LG GQFG TY+  +K+ G   A K I K+K++    VEDV+RE++I+  
Sbjct: 105 NFKEYYSLGKKLGQGQFGTTYMCVEKATGKEYACKSIAKRKLVNEDDVEDVRREIQIMHH 164

Query: 756 LTG 764
           L+G
Sbjct: 165 LSG 167



>gb:AF035944_1762929 Fragaria x ananassa calcium-dependent protein
           kinase (MAX17) mRNA, complete cds.
          Length = 529

 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 26/61 (42%), Positives = 42/61 (68%)
 Frame = +3

Query: 576 DFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKA 755
           + ++ Y +G+ LG G+FG TY+ TDK+  +  A K I K+K+   + +EDV+REV+I+K 
Sbjct: 47  EIEQTYELGRELGRGEFGITYLCTDKATNENYACKSISKQKLRTAVDIEDVRREVEIMKH 106

Query: 756 L 758
           L
Sbjct: 107 L 107



>gb:LES308296_1684562 Lycopersicon esculentum mRNA for
           calcium-dependent protein kinase (cpk1 gene).
          Length = 553

 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 29/64 (45%), Positives = 43/64 (67%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           ++  K YT+GK LG GQFG TY  T+ S G+  A K I K+K++     ED+KRE++I++
Sbjct: 99  EEIRKLYTLGKELGRGQFGVTYYCTENSTGNPYACKSILKRKLVSKNDREDMKREIQIMQ 158

Query: 753 ALTG 764
            L+G
Sbjct: 159 HLSG 162



>pir|T08874|T08874 calcium-dependent protein kinase (EC 2.7.1.-)
           gamma - soybean>gb:GMU69174_1680736 Glycine max
           calmodulin-like domain protein kinase isoenzyme gamma
           mRNA, complete cds.
          Length = 538

 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 35/94 (37%), Positives = 54/94 (57%), Gaps = 3/94 (3%)
 Frame = +3

Query: 492 KNLNVKPSHRSQTVVIPCGKRTDFGYDKDFD---KRYTIGKLLGHGQFGYTYVATDKSVG 662
           +N+  KP   + +     G R D    K F+   + +T+GK LG GQFG TY+ T+ S G
Sbjct: 48  QNMPWKPPGPALSPKPVVGVRQDTILGKQFEDVKQFHTLGKELGRGQFGVTYLCTENSTG 107

Query: 663 DRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
            + A K I K+K+      ED+KRE++I++ L+G
Sbjct: 108 LQYACKSISKRKLASKSDKEDIKREIQIMQHLSG 141



>sp|P28582|CDPK_DAUCA Calcium-dependent protein kinase (EC 2.7.1.-)
           (CDPK).>pir|T14335|T14335 protein kinase,
           calcium-dependent (EC 2.7.1.-) -
           carrot>gb:DCPK431_1675715 D. carota DcPK431 mRNA for
           calcium-dependent protein kinase.
          Length = 532

 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 43/124 (34%), Positives = 68/124 (54%), Gaps = 3/124 (2%)
 Frame = +3

Query: 402 PRSDTTATSAQDEERSRCNRRKAK-EPCEKYKNLNVKPS--HRSQTVVIPCGKRTDFGYD 572
           P +  T T    E+ S+ ++ +A+ +P  +    ++KP   HR ++  I  GK  +    
Sbjct: 21  PTAYHTVTDQSYEKSSQRSQPQAQPQPQVQQTGPSLKPRQVHRPESNTI-LGKPFE---- 75

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
            D   +YT+GK LG GQFG  Y  T+ S G   A K I K+K++     ED+KRE++IL+
Sbjct: 76  -DIRGKYTLGKELGRGQFGCVYQCTENSSGQLYACKSILKRKLVSKNDKEDIKREIQILQ 134

Query: 753 ALTG 764
            L+G
Sbjct: 135 HLSG 138



>gb:AP002819_1822897 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0501G01.
          Length = 713

 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 30/64 (46%), Positives = 40/64 (62%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D    YT G+ LG GQFG TY+ T K+ G R A K I  +K+     +EDV+REV+I+ 
Sbjct: 255 EDVRATYTFGRELGRGQFGVTYLVTHKATGKRFACKSIATRKLAHRDDIEDVRREVQIMH 314

Query: 753 ALTG 764
            LTG
Sbjct: 315 HLTG 318



>gb:AJ699160_1813474 Nicotiana plumbaginifolia mRNA for
           calcium-dependent protein kinase 8 (cpk8 gene).
          Length = 528

 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 26/57 (45%), Positives = 40/57 (70%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
           +Y +G+ LG G+FG TY+ T+   GD+ A K I KKK+   + ++DV+REV+I+K L
Sbjct: 52  KYDLGRELGRGEFGVTYLCTEVDTGDKYACKSISKKKLRTAVDIDDVRREVEIMKHL 108



>gb:AF319480_1785774 Oryza sativa calcium-dependent
           calmodulin-independent protein kinase (CK1) mRNA,
           complete cds.>gb:AF319481_1785775 Oryza sativa
           calcium-dependent calmodulin-independent protein kinase
           (CK1) gene, complete cds.
          Length = 541

 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 28/58 (48%), Positives = 42/58 (72%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           Y+IGK LG GQFG T++ T K+ G+++A K I K+K+     V+DV+REV+I+  L+G
Sbjct: 83  YSIGKELGRGQFGVTHLCTHKATGEKLACKTIAKRKLANKEDVDDVRREVQIMHHLSG 140



>gb:AY072801_1567397 Cucurbita maxima phloem calmodulin-like-domain
           protein kinase PCPK1 mRNA, complete cds.
          Length = 571

 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 41/132 (31%), Positives = 69/132 (52%), Gaps = 8/132 (6%)
 Frame = +3

Query: 393 TAKPRSDTTATSAQD-----EERSRCNRRKAKEPCEKYKNLNVKPSHRSQTVVIPCGKRT 557
           +A+  SD + TS        +E S+ N+ K+K+    Y    + P+ +  T+      + 
Sbjct: 36  SARSNSDISPTSINTHNLIAQEFSKENKTKSKD--NDYNQAFLSPTKKDFTMRKSAENQA 93

Query: 558 DF--GYDK-DFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDV 728
            +  G+   +    YT+G+ LG GQFG TY+ T+ + G   A K I K+K++    VEDV
Sbjct: 94  YYVLGHKTANIRDLYTLGRKLGQGQFGTTYLCTEITTGIEYACKSISKRKLIAKEDVEDV 153

Query: 729 KREVKILKALTG 764
           +RE++I+  L G
Sbjct: 154 RREIQIMHHLAG 165



>pir|S71770|S71770 calcium-dependent protein kinase (EC 2.7.1.-) -
           mung bean>gb:VRU08140_1727368 Vigna radiata Rwilcz
           calcium dependent protein kinase (CDPK) mRNA, complete
           cds.
          Length = 487

 Score = 59.7 bits (143), Expect = 6e-08
 Identities = 27/58 (46%), Positives = 39/58 (67%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           YT+G+ LG GQFG TY+ T+ S  +  A K I K+K++    VEDV+RE++I+  L G
Sbjct: 24  YTLGRKLGQGQFGTTYLCTENSTSNEYACKSISKRKLISKEDVEDVRREIQIMHHLAG 81



>gb:AP003073_1824565 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0702B09.>gb:AP003260_1826543 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, PAC
           clone:P0468B07.
          Length = 515

 Score = 59.3 bits (142), Expect = 7e-08
 Identities = 31/64 (48%), Positives = 40/64 (62%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D    YTIGK LG GQFG T + T K+ G + A K I K+K+     VEDV+REV+I+ 
Sbjct: 55  EDVRSIYTIGKELGRGQFGVTSLCTHKATGQKFACKTIAKRKLSTKEDVEDVRREVQIMY 114

Query: 753 ALTG 764
            L G
Sbjct: 115 HLAG 118



>gb:MSCDPK_1687079 M.sativa mRNA for protein kinase.
          Length = 542

 Score = 59.3 bits (142), Expect = 7e-08
 Identities = 28/64 (43%), Positives = 43/64 (67%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D  + YT+GK LG GQFG T++ T+ S G   A K I K+K++     ED+KRE++I++
Sbjct: 82  EDVKQFYTLGKELGRGQFGVTFLCTENSTGLLYACKSISKRKLVSKSDREDIKREIQIMQ 141

Query: 753 ALTG 764
            L+G
Sbjct: 142 HLSG 145



>gb:AY138479_1582322 Ceratopteris richardii calmodulin domain
           protein kinase 1 (CPK1) mRNA, complete cds.
          Length = 522

 Score = 59.3 bits (142), Expect = 7e-08
 Identities = 30/83 (36%), Positives = 50/83 (60%)
 Frame = +3

Query: 510 PSHRSQTVVIPCGKRTDFGYDKDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIE 689
           P   S T +  CG+++        +++Y +G+ LG G+FG TY+ TD+   + +A K I 
Sbjct: 31  PKVISHTKLSSCGEQS-------VNEKYHLGRELGRGEFGITYLCTDRETDEVLACKSIS 83

Query: 690 KKKMLLPMAVEDVKREVKILKAL 758
           K K+  P+ +EDV+REV I++ L
Sbjct: 84  KGKLRTPIDIEDVRREVDIMRHL 106



>gb:AP003847_1834203 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1714_H10.
          Length = 568

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 28/58 (48%), Positives = 39/58 (67%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           YT+GK LG GQFG TY   +K+ G  +A K I K+K++    VEDV+RE++I+  L G
Sbjct: 106 YTLGKKLGQGQFGTTYQCVEKATGKVLACKSIAKRKLVSEEDVEDVRREIQIMHHLAG 163



>gb:AF048691_1763986 Oryza sativa calcium dependent protein kinase
           (CDPK12) mRNA, complete cds.
          Length = 542

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 28/63 (44%), Positives = 41/63 (65%)
 Frame = +3

Query: 576 DFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKA 755
           D  + Y IG+ LG GQFG TY+ T+ + G   A K I K+K++    VEDV+RE++I+  
Sbjct: 74  DLREHYIIGRKLGQGQFGTTYLCTEINTGCEYACKTIPKRKLITKEDVEDVRREIQIMHH 133

Query: 756 LTG 764
           L+G
Sbjct: 134 LSG 136



>gb:AC099739_1737221 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1528D07, complete sequence.
          Length = 570

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 28/63 (44%), Positives = 41/63 (65%)
 Frame = +3

Query: 576 DFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKA 755
           D  + Y IG+ LG GQFG TY+ T+ + G   A K I K+K++    VEDV+RE++I+  
Sbjct: 74  DLREHYIIGRKLGQGQFGTTYLCTEINTGCEYACKTIPKRKLITKEDVEDVRREIQIMHH 133

Query: 756 LTG 764
           L+G
Sbjct: 134 LSG 136



>gb:AY158077_1585533 Oryza sativa (japonica cultivar-group)
           calcium-dependent protein kinase (CDPK1) mRNA, complete
           cds.>gb:AP000615_1820471 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 3,
           clone:P0043E01.
          Length = 542

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 28/63 (44%), Positives = 41/63 (65%)
 Frame = +3

Query: 576 DFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKA 755
           D  + Y IG+ LG GQFG TY+ T+ + G   A K I K+K++    VEDV+RE++I+  
Sbjct: 74  DLREHYIIGRKLGQGQFGTTYLCTEINTGCEYACKTIPKRKLITKEDVEDVRREIQIMHH 133

Query: 756 LTG 764
           L+G
Sbjct: 134 LSG 136



>gb:AB078634_1523749 Oryza sativa OsCDPK13 mRNA for calcium
           dependent protein kinase 13, partial cds.
          Length = 542

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 28/63 (44%), Positives = 41/63 (65%)
 Frame = +3

Query: 576 DFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKA 755
           D  + Y IG+ LG GQFG TY+ T+ + G   A K I K+K++    VEDV+RE++I+  
Sbjct: 74  DLREHYIIGRKLGQGQFGTTYLCTEINTGCEYACKTIPKRKLITKEDVEDVRREIQIMHH 133

Query: 756 LTG 764
           L+G
Sbjct: 134 LSG 136



>pir|S71778|S71778 calcium-dependent protein kinase (EC 2.7.1.-) 19
           - Arabidopsis thaliana>gb:ATU20624_1556826 Arabidopsis
           thaliana calcium-dependent protein kinase (CDPK19) mRNA,
           complete cds.>gb:ATU20627_1556829 Arabidopsis thaliana
           calcium-dependent protein kinase (CDPK19) gene, complete
           cds.
          Length = 533

 Score = 58.9 bits (141), Expect = 1e-07
 Identities = 26/59 (44%), Positives = 39/59 (66%)
 Frame = +3

Query: 576 DFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           D    Y +G+ +G G+FG TY+ TD   G++ A K I KKK+   + +EDV+REV+I+K
Sbjct: 52  DISLMYDLGREVGRGEFGITYLCTDIKTGEKYACKSISKKKLRTAVDIEDVRREVEIMK 110



>gb:AF276999_1782715 Funaria hygrometrica calcium-dependent protein
           kinase gene, partial cds.
          Length = 518

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 28/57 (49%), Positives = 38/57 (66%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
           +Y +G+ LG G+FG TY+ TDK   +  A K I KKK+   + VEDV+REV I+K L
Sbjct: 39  KYVLGRELGRGEFGITYLCTDKETQEIFACKSISKKKLRTAVDVEDVRREVAIMKHL 95



>gb:AY050891_1562384 Arabidopsis thaliana putative calcium dependent
           protein kinase (At4g04720) mRNA, complete cds.
          Length = 531

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 28/64 (43%), Positives = 42/64 (65%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D  K Y++GK LG GQFG TY+  +   G+  A K I K+K++     EDVKRE++I++
Sbjct: 74  EDIRKFYSLGKELGRGQFGITYMCKEIGTGNTYACKSILKRKLISKQDKEDVKREIQIMQ 133

Query: 753 ALTG 764
            L+G
Sbjct: 134 YLSG 137



>pir|D85059|D85059 probable calcium dependent protein kinase
           [imported] - Arabidopsis thaliana>gb:ATCHRIV13_1544316
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 13.>gb:AY150502_1585067 Arabidopsis thaliana
           putative calcium-dependent protein kinase (At4g04720)
           mRNA, complete cds.>gb:T4B21_1724068 Arabidopsis
           thaliana BAC T4B21.
          Length = 531

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 28/64 (43%), Positives = 42/64 (65%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D  K Y++GK LG GQFG TY+  +   G+  A K I K+K++     EDVKRE++I++
Sbjct: 74  EDIRKFYSLGKELGRGQFGITYMCKEIGTGNTYACKSILKRKLISKQDKEDVKREIQIMQ 133

Query: 753 ALTG 764
            L+G
Sbjct: 134 YLSG 137



>gb:MZECDPKX_1687852 Zea mays calcium-dependent protein kinase
           (CDPK) gene, exons 1-7 and partial cds.
          Length = 465

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 27/64 (42%), Positives = 44/64 (68%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D    Y++GK LG GQFG T++ T ++ G+++A K I K+K+     V+DV+REV+I+ 
Sbjct: 2   EDVRATYSMGKELGRGQFGVTHLCTHRTSGEKLACKTIAKRKLAAREDVDDVRREVQIMH 61

Query: 753 ALTG 764
            L+G
Sbjct: 62  HLSG 65



>gb:AY072802_1567398 Cucurbita maxima calmodulin-like-domain protein
           kinase CPK2 mRNA, complete cds.
          Length = 558

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 27/58 (46%), Positives = 38/58 (65%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           YT+G+ LG GQFG TY+ T+   G   A K I K+K++    VEDV+RE++I+  L G
Sbjct: 95  YTLGRKLGQGQFGTTYLCTEIMTGIEYACKSISKRKLIAKEDVEDVRREIQIMHHLAG 152



>pir|F96776|F96776 hypothetical protein F25A4.29 [imported] -
           Arabidopsis thaliana>gb:AE005173_895016 Arabidopsis
           thaliana chromosome 1, bottom arm complete
           sequence.>gb:AY140016_1582457 Arabidopsis thaliana
           calcium-dependent protein kinase, putative (At1g74740)
           mRNA, complete cds.>gb:BT008900_1640096 Arabidopsis
           thaliana At1g74740 mRNA, complete cds.>gb:F25A4_1678039
           Arabidopsis thaliana chromosome 1 BAC F25A4 sequence,
           complete sequence.
          Length = 541

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 36/111 (32%), Positives = 57/111 (51%), Gaps = 3/111 (2%)
 Frame = +3

Query: 435 DEERSRCNRRKAKEPCEKYKNLNVKPSH---RSQTVVIPCGKRTDFGYDKDFDKRYTIGK 605
           D + S+ N++K K P  + +N    P      +   VIP        +      +Y +G+
Sbjct: 11  DPDNSKPNQKK-KPPRGRQRNPYDDPDGLRTHAPLRVIP------MSHQSQISDKYILGR 63

Query: 606 LLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
            LG G+FG TY+ TD+   + +A K I K+K+   + VEDV+REV I+  L
Sbjct: 64  ELGRGEFGITYLCTDRETREALACKSISKRKLRTAVDVEDVRREVTIMSTL 114



>pir|T03024|T03024 calcium-dependent protein kinase (EC 2.7.1.-),
           calmodulin-independent - maize (fragment)
          Length = 465

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 27/64 (42%), Positives = 44/64 (68%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D    Y++GK LG GQFG T++ T ++ G+++A K I K+K+     V+DV+REV+I+ 
Sbjct: 2   EDVRATYSMGKELGRGQFGVTHLCTHRTSGEKLACKTIAKRKLAAREDVDDVRREVQIMH 61

Query: 753 ALTG 764
            L+G
Sbjct: 62  HLSG 65



>gb:OSJN00087_1694657 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0084K11, complete sequence.
          Length = 533

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 25/58 (43%), Positives = 41/58 (70%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           Y + + LG GQFG TY+ T+++ G+R A K + K+K++    V+DV+RE+ IL+ L+G
Sbjct: 91  YQLDRKLGSGQFGTTYLCTERATGNRYACKSVSKRKLVRRTDVDDVRREITILQHLSG 148



>gb:AY562224_1614996 Nicotiana tabacum calcium/calmodulin protein
           kinase gene, complete cds.>gb:AF550608_1810794 Nicotiana
           tabacum calcium/calmodulin protein kinase 1 mRNA,
           complete cds.
          Length = 1415

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 44/130 (33%), Positives = 65/130 (50%), Gaps = 5/130 (3%)
 Frame = +3

Query: 390 PTAKPRSDTTATSAQDEERSRCNRRKAKEPCEKYKNLNVKPSHR--SQTVVIPCGKRTDF 563
           P   P ++ T        +S+   ++   P    K++    + R  S +  IP G + + 
Sbjct: 527 PARSPATNPTKRFFGFSFKSKSTAKRPFPPPSPAKHIRAVLARRLGSNSSAIPEGAKAEG 586

Query: 564 GYDKDFDKRYTIGKLLGHGQFGYTYVATDKS---VGDRVAVKRIEKKKMLLPMAVEDVKR 734
           G     DK+   G++ G G FG+T  A  K       +VAVK I K KM   +A+EDV+R
Sbjct: 587 GGVGKLDKKGRKGEV-GRGHFGHTCWAKFKKGELKNPQVAVKIISKAKMTTAIAIEDVRR 645

Query: 735 EVKILKALTG 764
           EVKILKAL+G
Sbjct: 646 EVKILKALSG 655



>pir|S54788|S54788 calcium-stimulated protein kinase - Chlamydomonas
           eugametos>gb:CECDPKMR_1646112 C.eugametos mRNA for
           calcium-stimulated protein kinase.
          Length = 591

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 29/65 (44%), Positives = 41/65 (63%)
 Frame = +3

Query: 570 DKDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKIL 749
           +KD  K Y  GK++G G FG TY+ T K   ++ AVK I K+K+     VED++REV+I+
Sbjct: 145 NKDCWKDYEQGKVVGKGSFGTTYLVTKKDTQEQYAVKVISKRKLTTMEEVEDIQREVRIM 204

Query: 750 KALTG 764
             L G
Sbjct: 205 HHLAG 209



>gb:AP004269_1839496 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, PAC clone:P0048D08.
          Length = 533

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 28/66 (42%), Positives = 44/66 (66%)
 Frame = +3

Query: 567 YDKDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKI 746
           YD D    Y++GK LG GQFG TY+ T+ + G + A K I K+K++     ED++RE++I
Sbjct: 78  YD-DVRSVYSLGKELGRGQFGVTYLCTEIASGKQYACKSISKRKLVSKADKEDIRREIQI 136

Query: 747 LKALTG 764
           ++ L+G
Sbjct: 137 MQHLSG 142



>gb:D38452_1674556 Zea mays mRNA for calcium-dependent protein
           kinase-related kinase, partial cds.
          Length = 452

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 32/61 (52%), Positives = 40/61 (65%), Gaps = 3/61 (4%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKS---VGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALT 761
           Y +GK +G G FG+T  A  K     G  VAVK I K KM   +++EDV+REVKILKAL+
Sbjct: 1   YDLGKEVGRGHFGHTCSAVVKKGEHKGHTVAVKIISKAKMTTAISIEDVRREVKILKALS 60

Query: 762 G 764
           G
Sbjct: 61  G 61



>gb:AB042550_1519891 Oryza sativa (japonica cultivar-group) mRNA for
           OsCDPK7, complete cds.>gb:OSJN00157_1695842 Oryza sativa
           genomic DNA, chromosome 4, BAC clone: OSJNBa0013K16,
           complete sequence.
          Length = 551

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 26/58 (44%), Positives = 39/58 (67%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           Y +G+ LG GQFG TY+ T+ S G   A K I K+K++    +EDV+RE++I+  L+G
Sbjct: 88  YAMGRKLGQGQFGTTYLCTELSTGVDYACKSISKRKLITKEDIEDVRREIQIMHHLSG 145



>gb:AB017515_1513644 Marchantia polymorpha gene for
           calcium-dependent protein kinase, complete
           cds.>gb:AB017517_1513646 Marchantia polymorpha mRNA for
           calcium-dependent protein kinase (CDPK-B), complete cds.
          Length = 548

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 29/64 (45%), Positives = 41/64 (64%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D    YT+G+ LG GQFG T++ T K  G+ +A K I K+K+     VEDV+REV+I+ 
Sbjct: 75  EDVRSIYTLGRELGRGQFGVTHLCTHKVTGELLACKSIAKRKLTNKDDVEDVRREVQIMH 134

Query: 753 ALTG 764
            L G
Sbjct: 135 HLEG 138



>gb:AB017515_1513643 Marchantia polymorpha gene for
           calcium-dependent protein kinase, complete
           cds.>gb:AB017516_1513645 Marchantia polymorpha mRNA for
           calcium-dependent protein kinase (CDPK-A), complete cds.
          Length = 548

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 29/64 (45%), Positives = 41/64 (64%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D    YT+G+ LG GQFG T++ T K  G+ +A K I K+K+     VEDV+REV+I+ 
Sbjct: 75  EDVRSIYTLGRELGRGQFGVTHLCTHKVTGELLACKSIAKRKLTNKDDVEDVRREVQIMH 134

Query: 753 ALTG 764
            L G
Sbjct: 135 HLEG 138



>pir|T10938|T10938 calcium-dependent protein kinase (EC 2.7.1.-) -
           sweet potato>gb:D87707_1675066 Sweet potato mRNA for
           calcium dependent protein kinase, complete cds.
          Length = 514

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 27/64 (42%), Positives = 42/64 (65%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D    Y++GK LG GQFG TY+ T+   G + A K I KKK++     +D++REV+I++
Sbjct: 60  EDVRAHYSLGKELGRGQFGVTYLCTEIRTGKQYACKSISKKKLVTKGDKDDMRREVQIMQ 119

Query: 753 ALTG 764
            L+G
Sbjct: 120 HLSG 123



>sp|P53683|CDP2_ORYSA Calcium-dependent protein kinase, isoform 2
           (EC 2.7.1.-) (CDPK 2).>pir|S56652|S56652
           calcium-dependent protein kinase (EC 2.7.1.-) 2 -
           rice>gb:OSCDPK2_1692816 O.sativa mRNA for calcium
           dependent protein kinase 2.
          Length = 533

 Score = 57.0 bits (136), Expect = 4e-07
 Identities = 28/66 (42%), Positives = 44/66 (66%)
 Frame = +3

Query: 567 YDKDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKI 746
           YD D    Y++GK LG GQFG TY+ T+ + G + A K I K+K++     ED++RE++I
Sbjct: 78  YD-DVRSVYSLGKELGRGQFGVTYLCTEIASGKQYACKSISKRKLVSKADKEDIRREIQI 136

Query: 747 LKALTG 764
           ++ L+G
Sbjct: 137 MQHLSG 142



>gb:AF115406_1769295 Solanum tuberosum calcium-dependent protein
           kinase mRNA, complete cds.
          Length = 532

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 30/86 (34%), Positives = 51/86 (59%)
 Frame = +3

Query: 507 KPSHRSQTVVIPCGKRTDFGYDKDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRI 686
           KP  + +T++   GK  +     D    YT+GK LG GQ+G T++ T+ + G + A K I
Sbjct: 64  KPVFKQETIL---GKAFE-----DVKAHYTLGKELGRGQYGVTFLCTEIATGHQYACKSI 115

Query: 687 EKKKMLLPMAVEDVKREVKILKALTG 764
            KKK++      D++RE++I++ L+G
Sbjct: 116 SKKKLVTKSDKADMRREIQIMQHLSG 141



>gb:BT004566_1637600 Arabidopsis thaliana At1g18890 gene, complete
           cds.
          Length = 545

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 28/75 (37%), Positives = 43/75 (57%)
 Frame = +3

Query: 534 VIPCGKRTDFGYDKDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPM 713
           VIP   +T          +Y +G+ LG G+FG TY+ TD+   + +A K I K+K+   +
Sbjct: 50  VIPMSNQTQIS------DKYILGRELGRGEFGITYLCTDRETHEALACKSISKRKLRTAV 103

Query: 714 AVEDVKREVKILKAL 758
            +EDV+REV I+  L
Sbjct: 104 DIEDVRREVAIMSTL 118



>gb:ATHATCDPK_1553023 Arabidopsis thaliana mRNA for
           calcium-dependent protein kinase, complete cds.
          Length = 483

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 27/58 (46%), Positives = 38/58 (65%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           YT+ + LG GQFG TY+ TD + G   A K I K+K++    VEDV+RE++I+  L G
Sbjct: 24  YTLSRKLGQGQFGTTYLCTDIATGVDYACKSISKRKLISKEDVEDVRREIQIMHHLAG 81



>gb:AC068602_1540375 Genomic sequence for Arabidopsis thaliana BAC
           F14D16 from chromosome I, complete sequence.
          Length = 202

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 28/75 (37%), Positives = 43/75 (57%)
 Frame = +3

Query: 534 VIPCGKRTDFGYDKDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPM 713
           VIP   +T          +Y +G+ LG G+FG TY+ TD+   + +A K I K+K+   +
Sbjct: 50  VIPMSNQTQIS------DKYILGRELGRGEFGITYLCTDRETHEALACKSISKRKLRTAV 103

Query: 714 AVEDVKREVKILKAL 758
            +EDV+REV I+  L
Sbjct: 104 DIEDVRREVAIMSTL 118



>pir|D84550|D84550 probable calmodulin-domain protein kinase CPK6
           [imported] - Arabidopsis thaliana>gb:AC002329_1530256
           Arabidopsis thaliana chromosome II section 100 of 255 of
           the complete sequence. Sequence from clones T23A1, F5J6,
           MJB20.>gb:ATU31835_1556904 Arabidopsis thaliana
           calmodulin-domain protein kinase CDPK isoform 6 (CPK6)
           mRNA, complete cds.>gb:AY140007_1582448 Arabidopsis
           thaliana putative calmodulin-domain protein kinase CPK6
           (At2g17290) mRNA, complete cds.>gb:BT002600_1636203
           Arabidopsis thaliana putative calmodulin-domain protein
           kinase CPK6 (At2g17290) mRNA, complete cds.
          Length = 544

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 27/58 (46%), Positives = 38/58 (65%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           YT+ + LG GQFG TY+ TD + G   A K I K+K++    VEDV+RE++I+  L G
Sbjct: 85  YTLSRKLGQGQFGTTYLCTDIATGVDYACKSISKRKLISKEDVEDVRREIQIMHHLAG 142



>pir|H86322|H86322 calcium-dependent protein kinase 1 [imported] -
           Arabidopsis thaliana>gb:AE005172_890846 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC011809_1537477 Arabidopsis thaliana
           chromosome I BAC F6A14 genomic sequence, complete
           sequence.
          Length = 545

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 28/75 (37%), Positives = 43/75 (57%)
 Frame = +3

Query: 534 VIPCGKRTDFGYDKDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPM 713
           VIP   +T          +Y +G+ LG G+FG TY+ TD+   + +A K I K+K+   +
Sbjct: 50  VIPMSNQTQIS------DKYILGRELGRGEFGITYLCTDRETHEALACKSISKRKLRTAV 103

Query: 714 AVEDVKREVKILKAL 758
            +EDV+REV I+  L
Sbjct: 104 DIEDVRREVAIMSTL 118



>sp|P53684|CDP3_ORYSA Calcium-dependent protein kinase, isoform 11
           (EC 2.7.1.-) (CDPK 11).>pir|S56651|S56651
           calcium-dependent protein kinase (EC 2.7.1.-) 11 -
           rice>gb:OSCDPKRNA_1692817 O.sativa mRNA for calcium
           dependent protein kinase 11.
          Length = 542

 Score = 56.6 bits (135), Expect = 5e-07
 Identities = 27/63 (42%), Positives = 40/63 (63%)
 Frame = +3

Query: 576 DFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKA 755
           D  + Y IG+ LG  QFG TY+ T+ + G   A K I K+K++    VEDV+RE++I+  
Sbjct: 74  DLREHYIIGRKLGQAQFGTTYLCTEINTGCEYACKTIPKRKLITKEDVEDVRREIQIMHH 133

Query: 756 LTG 764
           L+G
Sbjct: 134 LSG 136



>gb:AC084296_1733470 Oryza sativa chromosome 3 BAC OSJNBb0024J04
           genomic sequence, complete sequence.
          Length = 599

 Score = 56.2 bits (134), Expect = 6e-07
 Identities = 25/59 (42%), Positives = 40/59 (67%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           +Y++G+ LG GQFG TY+  +++ G   A K I K+K++    VEDV+RE++I+  L G
Sbjct: 132 KYSLGRKLGQGQFGTTYLCVERATGKEFACKSILKRKLVTDDDVEDVRREIQIMYHLAG 190



>gb:ATU73610_1557223 Arabidopsis thaliana ATCDPK1a (cpk1a) mRNA,
           partial cds.
          Length = 274

 Score = 56.2 bits (134), Expect = 6e-07
 Identities = 25/57 (43%), Positives = 38/57 (66%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
           +Y +G+ LG G+FG TY+ TD+   + +A K I K+K+   + VEDV+REV I+  L
Sbjct: 10  KYILGRELGRGEFGITYLCTDRETREALACKSISKRKLRTAVDVEDVRREVTIMSTL 66



>pir|A84847|A84847 probable Ca2+ dependent protein kinase [imported]
           - Arabidopsis thaliana>gb:AC002339_1530502 Arabidopsis
           thaliana chromosome 2 clone T11A7 map CIC11C08, complete
           sequence.>gb:U90439_1726517 Arabidopsis thaliana
           chromosome 2 BAC T6D20 genomic sequence, complete
           sequence.
          Length = 530

 Score = 56.2 bits (134), Expect = 6e-07
 Identities = 25/61 (40%), Positives = 41/61 (67%)
 Frame = +3

Query: 576 DFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKA 755
           +  ++Y +G+ LG G+FG TY+ T+   G+  A K I KKK+   + +EDVKREV+I++ 
Sbjct: 49  EIKQKYKLGRELGRGEFGVTYLCTEIETGEIFACKSILKKKLKTSIDIEDVKREVEIMRQ 108

Query: 756 L 758
           +
Sbjct: 109 M 109



>pir|T02993|T02993 calcium-dependent protein kinase (EC 2.7.1.-) 9 -
           maize>gb:MZECDPK1_1687849 Zea mays calcium-dependent
           protein kinase mRNA, complete cds.
          Length = 531

 Score = 56.2 bits (134), Expect = 6e-07
 Identities = 26/64 (40%), Positives = 42/64 (65%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D    Y++GK LG GQFG TY+ T+ + G + A K I K+K+      ED++RE++I++
Sbjct: 77  EDVRSVYSLGKELGRGQFGVTYLCTEVASGKQYACKSISKRKLTSKADREDIRREIQIMQ 136

Query: 753 ALTG 764
            L+G
Sbjct: 137 HLSG 140



>pir|T02139|T02139 calcium-dependent protein kinase (EC 2.7.1.-)
           F8K4.14 - Arabidopsis thaliana>gb:AE005173_893864
           Arabidopsis thaliana chromosome 1, bottom arm complete
           sequence.>gb:F8K4_1678600 Arabidopsis thaliana
           chromosome 1 BAC F8K4 sequence, complete sequence.
          Length = 553

 Score = 56.2 bits (134), Expect = 6e-07
 Identities = 28/66 (42%), Positives = 44/66 (66%), Gaps = 2/66 (3%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMA--VEDVKREVKI 746
           +D  ++Y++G+ LG GQFG TY+ T+ S G   A K I K+K++   A   EDV+RE++I
Sbjct: 92  EDIKEKYSLGRELGRGQFGITYICTEISSGKNFACKSILKRKLIRTKARDREDVRREIQI 151

Query: 747 LKALTG 764
           +  L+G
Sbjct: 152 MHYLSG 157



>gb:AY062539_1565195 Arabidopsis thaliana calcium-dependent protein
           kinase (At3g51850) mRNA, complete
           cds.>gb:BT003367_1636790 Arabidopsis thaliana
           calcium-dependent protein kinase (At3g51850) mRNA,
           complete cds.
          Length = 528

 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 26/62 (41%), Positives = 41/62 (66%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           ++ + RY + + LG G+FG TY+  ++S  D +A K I K+K+   + +EDVKREV I+K
Sbjct: 48  ENIEDRYLLDRELGRGEFGVTYLCIERSSRDLLACKSISKRKLRTAVDIEDVKREVAIMK 107

Query: 753 AL 758
            L
Sbjct: 108 HL 109



>pir|T51156|T51156 calcium dependent protein kinase [imported] -
           Arabidopsis thaliana>gb:ATU54615_1557089 Arabidopsis
           thaliana calcium-dependent protein kinase gene, complete
           cds.>gb:AF049236_1764024 Arabidopsis thaliana putative
           transmembrane protein G1p (AtG1), putative nuclear
           DNA-binding protein G2p (AtG2), Em1 protein (ATEM1),
           putative chlorophyll synthetase (AtG4), putative
           transmembrane protein G5p (AtG5), putative acyl-coA
           dehydrogenase (AtG6), and calcium dependent protein
           kinase genes, complete cds; and unknown genes.
          Length = 503

 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 26/62 (41%), Positives = 41/62 (66%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           ++ + RY + + LG G+FG TY+  ++S  D +A K I K+K+   + +EDVKREV I+K
Sbjct: 48  ENIEDRYLLDRELGRGEFGVTYLCIERSSRDLLACKSISKRKLRTAVDIEDVKREVAIMK 107

Query: 753 AL 758
            L
Sbjct: 108 HL 109



>pir|S46283|S46283 calcium-dependent protein kinase (EC 2.7.1.-) 1 -
           Arabidopsis thaliana>gb:ATHCDPKA_1553097 Arabidopsis
           thaliana mRNA for calcium-dependent protein kinase
           (CDPK), complete cds.
          Length = 493

 Score = 55.8 bits (133), Expect = 8e-07
 Identities = 24/57 (42%), Positives = 38/57 (66%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
           +Y +G+ LG G+FG TY+ TD+   + +A K I K+K+   + +EDV+REV I+  L
Sbjct: 10  KYILGRELGRGEFGITYLCTDRETHEALACKSISKRKLRTAVDIEDVRREVAIMSTL 66



>gb:AY704444_1623723 Triticum aestivum calcium-dependent protein
           kinase 2 (CDPK2) mRNA, complete cds.
          Length = 558

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 24/58 (41%), Positives = 39/58 (67%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           Y +G+ LG GQFG TY+ T+ + G   A K I K+K++    ++DV+RE++I+  L+G
Sbjct: 95  YALGRKLGQGQFGTTYLCTELATGADYACKSISKRKLITKEDIDDVRREIQIMHHLSG 152



>gb:AY632360_1618715 Gossypium hirsutum BAC 106I22, complete
           sequence.
          Length = 478

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 26/55 (47%), Positives = 36/55 (65%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           RY +GKLLGHG F   Y A +   GD VA+K I+K+K+L    +  +KRE+ IL+
Sbjct: 27  RYEVGKLLGHGTFAKVYHARNVKSGDNVAIKVIDKEKILKSGLIAHIKREISILR 81



>gb:AY394009_1604751 Vitis labrusca x Vitis vinifera
           calcium-dependent protein kinase (VCPK1) mRNA, complete
           cds.
          Length = 497

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 27/63 (42%), Positives = 39/63 (61%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D    YTIG+ LG GQFG T++ TDK+ G   A K I K+K+      +DV RE++I+ 
Sbjct: 24  QDLRTLYTIGQKLGQGQFGTTFLCTDKATGHNYACKSIPKRKLFCKEDYDDVWREIQIMH 83

Query: 753 ALT 761
            L+
Sbjct: 84  HLS 86



>gb:AY295081_1596151 Capsicum annuum calcium-dependent protein
           kinase 3 mRNA, complete cds.
          Length = 537

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 38/123 (30%), Positives = 63/123 (51%), Gaps = 2/123 (1%)
 Frame = +3

Query: 402 PRSDTTATSAQDEERSRCNRRK--AKEPCEKYKNLNVKPSHRSQTVVIPCGKRTDFGYDK 575
           P++ +T+  ++ EE  + +      K+     KN+N + S      V+  G +T      
Sbjct: 19  PQNHSTSKHSKVEEEQQPDPAPLVVKDHSTSTKNMNHRSSANQSCCVL--GHKTP----- 71

Query: 576 DFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKA 755
           +    Y +G+ LG GQFG TY+ T+ S     A K I K+K++    VEDV+RE++I+  
Sbjct: 72  NIRDLYALGRKLGQGQFGTTYLCTELSTCIDYACKSIAKRKLISKEDVEDVRREIQIMHH 131

Query: 756 LTG 764
           L G
Sbjct: 132 LAG 134



>gb:AB025633_1516595 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MQM1.>gb:ATACDPK9_1543793 Arabidopsis thaliana
           calcium dependent protein kinase mRNA, complete
           cds.>gb:ATU20626_1556828 Arabidopsis thaliana
           calcium-dependent protein kinase (CDPK9) gene, complete
           cds.
          Length = 490

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 25/63 (39%), Positives = 41/63 (65%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           K+ +  Y +G++LG GQFG T++ T K  G ++A K I K+K+L     +DV RE++I+ 
Sbjct: 16  KNVEDNYFLGQVLGQGQFGTTFLCTHKQTGQKLACKSIPKRKLLCQEDYDDVLREIQIMH 75

Query: 753 ALT 761
            L+
Sbjct: 76  HLS 78



>pir|G86414|G86414 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AE005172_891775 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC021043_1538661 Arabidopsis thaliana
           chromosome I BAC F28N24 genomic sequence, complete
           sequence.>gb:AY034099_1559580 Arabidopsis thaliana
           CBL-interacting protein kinase 18 (CIPK18) mRNA,
           complete cds.
          Length = 520

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 25/55 (45%), Positives = 38/55 (69%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +Y +GKLLGHG F   Y+A +   GD+VA+K I+K+K++    V  +KRE+ IL+
Sbjct: 73  KYELGKLLGHGTFAKVYLAQNIKSGDKVAIKVIDKEKIMKSGLVAHIKREISILR 127



>pir|T03271|T03271 calcium-dependent protein kinase (EC 2.7.1.-) 1 -
           maize>gb:D84408_1674859 Maize mRNA for calcium dependent
           protein kinase, complete cds.
          Length = 492

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 25/58 (43%), Positives = 39/58 (67%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           Y +G+ LG GQFG TY+ T+ + G   A K I K+K++    V+DV+RE++I+  L+G
Sbjct: 27  YALGRKLGQGQFGTTYLCTELATGIDYACKSISKRKLITKEDVDDVRREIQIMHHLSG 84



>pir|S71776|S71776 calcium-dependent protein kinase (EC 2.7.1.-) 9 -
           Arabidopsis thaliana
          Length = 490

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 25/63 (39%), Positives = 41/63 (65%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           K+ +  Y +G++LG GQFG T++ T K  G ++A K I K+K+L     +DV RE++I+ 
Sbjct: 16  KNVEDNYFLGQVLGQGQFGTTFLCTHKQTGQKLACKSIPKRKLLCQEDYDDVLREIQIMH 75

Query: 753 ALT 761
            L+
Sbjct: 76  HLS 78



>sp|P49101|CDP2_MAIZE Calcium-dependent protein kinase 2 (EC
           2.7.1.-) (CDPK 2).>pir|T02259|T02259 calcium-dependent
           protein kinase (EC 2.7.1.-) 2 -
           maize>gb:ZMU28376_1732116 Zea mays calcium-dependent
           protein kinase (MZECDPK2) mRNA, complete cds.
          Length = 513

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 26/64 (40%), Positives = 42/64 (65%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D    Y+ GK LG GQFG TY+ T+ + G + A K I K+K++     ED++RE++I++
Sbjct: 59  EDVRSVYSFGKELGRGQFGVTYLCTEIASGRQYACKSISKRKLVSKADREDIRREIQIMQ 118

Query: 753 ALTG 764
            L+G
Sbjct: 119 HLSG 122



>gb:AK117892_1815900 Arabidopsis thaliana At2g31500 mRNA for
           putative calcium-dependent protein kinase, complete cds,
           clone: RAFL19-07-H23.
          Length = 582

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 26/57 (45%), Positives = 39/57 (68%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
           +Y +GK LG G+FG T+   + S  +R A KRI K+K+   + VEDV+REV+I++ L
Sbjct: 65  KYDLGKELGRGEFGVTHECIEISTRERFACKRISKEKLRTEIDVEDVRREVEIMRCL 121



>pir|E84721|E84721 probable calcium-dependent protein kinase
           [imported] - Arabidopsis thaliana>gb:AC007071_1535178
           Arabidopsis thaliana chromosome 2 clone T9H9 map nga361,
           complete sequence.>gb:AC007169_1535437 Arabidopsis
           thaliana chromosome 2 clone T28P16 map nga361, complete
           sequence.
          Length = 582

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 26/57 (45%), Positives = 39/57 (68%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
           +Y +GK LG G+FG T+   + S  +R A KRI K+K+   + VEDV+REV+I++ L
Sbjct: 65  KYDLGKELGRGEFGVTHECIEISTRERFACKRISKEKLRTEIDVEDVRREVEIMRCL 121



>gb:AC097277_1736528 Oryza sativa chromosome 3 BAC OSJNBa0022C08
           genomic sequence, complete sequence.
          Length = 574

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 24/57 (42%), Positives = 41/57 (71%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
           +Y +G+ LG G+FG T++ATD++  +R+A K I K+++   + V DV+REV I+ +L
Sbjct: 100 KYQLGRELGRGEFGVTHLATDRATRERLACKSIPKRRLRTAVDVADVRREVAIMASL 156



>gb:AC092779_1735694 Oryza sativa chromosome 3 BAC OSJNBb0024N19
           genomic sequence, complete sequence.
          Length = 293

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 24/57 (42%), Positives = 41/57 (71%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
           +Y +G+ LG G+FG T++ATD++  +R+A K I K+++   + V DV+REV I+ +L
Sbjct: 100 KYQLGRELGRGEFGVTHLATDRATRERLACKSIPKRRLRTAVDVADVRREVAIMASL 156



>gb:AY144497_1583548 Oryza sativa (japonica cultivar-group) OsCDPK
           protein mRNA, complete cds.
          Length = 513

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 28/57 (49%), Positives = 36/57 (63%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALT 761
           Y IGK LG GQFG TY+  DK+ G   A K I K+K+L     EDV RE++I+  L+
Sbjct: 47  YRIGKELGQGQFGTTYLCVDKASGGEFACKSIPKRKLLCREDYEDVWREIQIMHHLS 103



>gb:AP004702_1843654 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0524F03.>gb:AP004703_1843668 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0528B09.
          Length = 451

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 24/58 (41%), Positives = 39/58 (67%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALT 761
           RY +G++LGHG FG  +VA D   G  VAVK + K+K++    +E +KRE+ ++K ++
Sbjct: 22  RYEMGRVLGHGNFGRVHVARDLRTGRSVAVKVVAKEKVVRAGMMEQIKREIAVMKRVS 79



>gb:AF130252_1770794 Arabidopsis thaliana calcium dependent protein
           kinase CP4 mRNA, partial cds.
          Length = 459

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 30/62 (48%), Positives = 40/62 (64%), Gaps = 3/62 (4%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKS---VGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
           +Y +GK +G G FG+T  A  K        VAVK I K KM   +++EDV+REVK+LKAL
Sbjct: 5   QYELGKEVGRGHFGHTCWAKAKKGKMKNQTVAVKIISKAKMTSTLSIEDVRREVKLLKAL 64

Query: 759 TG 764
           +G
Sbjct: 65  SG 66



>gb:AC108503_1738535 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1387_F08, complete
           sequence.>gb:AC121361_1740128 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OSJNBa0009E21,
           complete sequence.
          Length = 547

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 24/59 (40%), Positives = 40/59 (67%)
 Frame = +3

Query: 582 DKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
           +++Y + + LG G+FG TY+  D+   + +A K I K+K+  P+ VEDV+REV I++ L
Sbjct: 70  EEKYALDRELGRGEFGVTYLCMDRCSRELLACKSISKRKLRTPVDVEDVRREVAIMRHL 128



>gb:TRU82087_1725870 Tortula ruralis calmodulin-like domain protein
           kinase (TrCPK1) mRNA, complete cds.
          Length = 578

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 25/58 (43%), Positives = 38/58 (65%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           Y +GK LG GQFG TY+  +K+     A K I K+K++    V+DV+RE++I+  L+G
Sbjct: 112 YVLGKKLGQGQFGTTYLCIEKATNREYACKSIAKRKLISKEDVDDVRRELQIMHHLSG 169



>gb:AB051809_1521148 Solanum tuberosum RiCDPK2 mRNA for calcium
           dependent protein kinase, complete cds.
          Length = 496

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 27/57 (47%), Positives = 38/57 (66%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALT 761
           YTIGK LG GQFG T++  +KS G+  A K I KKK++     EDV +E++I+  L+
Sbjct: 28  YTIGKKLGQGQFGTTHLCIEKSSGNLYACKTIPKKKLICKEDYEDVWKEIQIMHHLS 84



>gb:AE016959_1023655 Oryza sativa (japonica cultivar-group)
           chromosome 10, complete sequence.>gb:AC073166_1540971
           Oryza sativa chromosome 10 BAC OSJNBb0064P21 genomic
           sequence, complete sequence.>gb:AE017116_1753474 Oryza
           sativa (japonica cultivar-group) chromosome 10, section
           70 of 77 of the complete sequence.
          Length = 534

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 26/58 (44%), Positives = 38/58 (65%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           YT+G+ LG GQFG TY+ T+ S G + A K I K  +     +EDV+RE++I+  L+G
Sbjct: 73  YTLGRELGQGQFGKTYLCTEISTGCQYACKTILKSNLRCVSDIEDVRREIQIMHHLSG 130



>pir|T06126|T06126 calcium-dependent protein kinase (EC 2.7.1.-)
           CPK5 - Arabidopsis thaliana>gb:ATCHRIV83_1547492
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 83.>gb:ATF23E12_1549730 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F23E12 (ESSA
           project).>gb:ATU31834_1556903 Arabidopsis thaliana
           calmodulin-domain protein kinase CDPK isoform 5 (CPK5)
           mRNA, complete cds.
          Length = 556

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 26/58 (44%), Positives = 38/58 (65%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           YT+ + LG GQFG TY+ T+ + G   A K I K+K++    VEDV+RE++I+  L G
Sbjct: 97  YTLSRKLGQGQFGTTYLCTEIASGVDYACKSISKRKLISKEDVEDVRREIQIMHHLAG 154



>pir|T05650|T05650 calcium-dependent protein kinase (EC 2.7.1.-)
           F20D10.350 - Arabidopsis thaliana>gb:ATCHRIV89_1547777
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 89.>gb:ATF20D10_1549502 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F20D10 (ESSA project).
          Length = 484

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 26/58 (44%), Positives = 37/58 (63%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           Y++G  LG GQFG TY+  + S G   A K I K+K++    VEDV+RE++I+  L G
Sbjct: 24  YSLGHKLGQGQFGTTYMCKEISTGREYACKSITKRKLISKEDVEDVRREIQIMHHLAG 81



>sp|P53682|CDP1_ORYSA Calcium-dependent protein kinase, isoform 1
           (EC 2.7.1.-) (CDPK 1).>pir|JC1515|JC1515
           calcium-dependent protein kinase (EC 2.7.1.-) -
           rice>gb:RICCDPK_1703566 Oryza sativa (japonica
           cultivar-group) mRNA for calcium-dependent protein
           kinase, complete cds.
          Length = 534

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 26/58 (44%), Positives = 38/58 (65%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           YT+G+ LG GQFG TY+ T+ S G + A K I K  +     +EDV+RE++I+  L+G
Sbjct: 73  YTLGRELGQGQFGKTYLCTEISTGCQYACKTILKSNLRCVSDIEDVRREIQIMHHLSG 130



>pir|T03263|T03263 calcium-dependent protein kinase (EC 2.7.1.-) 7 -
           maize>gb:D87042_1675043 Zea mays mRNA for
           Calcium-dependent protein kinase, complete cds.
          Length = 554

 Score = 53.5 bits (127), Expect = 4e-06
 Identities = 24/58 (41%), Positives = 39/58 (67%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           Y +G+ LG GQFG T++ T+ + G   A K I K+K++    V+DV+RE++I+  L+G
Sbjct: 91  YALGRKLGQGQFGTTFLCTELATGVDYACKSISKRKLITREDVDDVRREIQIMHHLSG 148



>gb:AP004366_1840839 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0460C04.
          Length = 551

 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 24/59 (40%), Positives = 38/59 (64%)
 Frame = +3

Query: 582 DKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
           D +Y + + LG G+FG TY+  D+   + +A K I K+K+   + VEDV+REV I++ L
Sbjct: 74  DDKYALDRELGRGEFGVTYLCMDRDTKELLACKSISKRKLRTAVDVEDVRREVAIMRHL 132



>pir|T02784|T02784 calcium-dependent protein kinase (EC 2.7.1.-) -
           maize  (strain W64A)>gb:ZMA7366_1731595 Zea mays mRNA
           for calcium-dependent protein kinase.
          Length = 639

 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 24/59 (40%), Positives = 40/59 (67%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           +Y++G+ LG GQFG T++  +++ G  +A K I K+K+     VEDV+RE++I+  L G
Sbjct: 152 KYSLGRRLGQGQFGTTHLCVERATGKELACKSILKRKLGSDDDVEDVRREIQIMHHLAG 210



>gb:T4B21_1724066 Arabidopsis thaliana BAC T4B21.
          Length = 494

 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 28/63 (44%), Positives = 36/63 (57%)
 Frame = +3

Query: 576 DFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKA 755
           D  K Y +G+ LG G FG T    +KS G   A K I K K+      EDVKRE++I+K 
Sbjct: 23  DITKIYILGEELGRGNFGLTRKCVEKSTGKTFACKTILKTKLKDEECEEDVKREIRIMKQ 82

Query: 756 LTG 764
           L+G
Sbjct: 83  LSG 85



>gb:AY753552_1626906 Vicia faba calcium-dependent protein kinase 1
           (CPK1) mRNA, complete cds.
          Length = 493

 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 26/57 (45%), Positives = 35/57 (61%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALT 761
           YT+G+ LG GQFG TY+ T    G   A K I KKK+L     +DV RE++I+  L+
Sbjct: 27  YTLGRKLGQGQFGTTYLCTHNPTGKTYACKSIPKKKLLCKEDYDDVWREIQIMHHLS 83



>gb:AY052319_1562692 Arabidopsis thaliana AT4g23650/F9D16_120 mRNA,
           complete cds.>gb:AF446863_1800504 Arabidopsis thaliana
           AT4g23650/F9D16_120 mRNA, complete cds.
          Length = 529

 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 25/60 (41%), Positives = 38/60 (63%)
 Frame = +3

Query: 585 KRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           + Y  G+ LG GQFG TY+ T K    +VA K I  ++++    +EDV+REV+I+  L+G
Sbjct: 76  RTYEFGRELGRGQFGVTYLVTHKETKQQVACKSIPTRRLVHKDDIEDVRREVQIMHHLSG 135



>gb:AY050981_1562461 Arabidopsis thaliana putative calcium-dependent
           protein kinase (At1g35670) mRNA, complete
           cds.>gb:AY113986_1578397 Arabidopsis thaliana putative
           calcium-dependent protein kinase (At1g35670) mRNA,
           complete cds.
          Length = 495

 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 26/57 (45%), Positives = 36/57 (63%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALT 761
           Y +GK LG GQFG TY+ T+KS     A K I K+K++     EDV RE++I+  L+
Sbjct: 26  YLLGKKLGQGQFGTTYLCTEKSTSANYACKSIPKRKLVCREDYEDVWREIQIMHHLS 82



>gb:ATCHRIV13_1544314 Arabidopsis thaliana DNA chromosome 4, contig
           fragment No. 13.
          Length = 347

 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 28/63 (44%), Positives = 36/63 (57%)
 Frame = +3

Query: 576 DFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKA 755
           D  K Y +G+ LG G FG T    +KS G   A K I K K+      EDVKRE++I+K 
Sbjct: 23  DITKIYILGEELGRGNFGLTRKCVEKSTGKTFACKTILKTKLKDEECEEDVKREIRIMKQ 82

Query: 756 LTG 764
           L+G
Sbjct: 83  LSG 85



>gb:AE005172_892352 Arabidopsis thaliana chromosome 1, top arm
           complete sequence.>gb:AC007887_1536286 Genomic sequence
           for Arabidopsis thaliana BAC F15O4 from chromosome I,
           complete sequence.
          Length = 557

 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 26/57 (45%), Positives = 36/57 (63%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALT 761
           Y +GK LG GQFG TY+ T+KS     A K I K+K++     EDV RE++I+  L+
Sbjct: 26  YLLGKKLGQGQFGTTYLCTEKSTSANYACKSIPKRKLVCREDYEDVWREIQIMHHLS 82



>pir|T05597|S71774 calcium-dependent protein kinase (EC 2.7.1.-) 6 -
           Arabidopsis thaliana>gb:ATACDPK6_1543792 Arabidopsis
           thaliana calcium-dependent protein kinase (CDPK6) mRNA,
           complete cds.>gb:ATCHRIV59_1546202 Arabidopsis thaliana
           DNA chromosome 4, contig fragment No.
           59.>gb:ATF9D16_1551289 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F9D16 (ESSAII
           project).>gb:ATU20625_1556827 Arabidopsis thaliana
           calcium-dependent protein kinase (CDPK6) gene, complete
           cds.>gb:AY081732_1568992 Arabidopsis thaliana
           AT4g23650/F9D16_120 mRNA, complete
           cds.>gb:AY087637_1572667 Arabidopsis thaliana clone
           37278 mRNA, complete sequence.>gb:BT000736_1635009
           Arabidopsis thaliana clone RAFL08-13-L06 (R11275)
           putative calcium-dependent protein kinase (CDPK6)
           (At4g23650) mRNA, complete cds.>gb:AF385710_1794603
           Arabidopsis thaliana AT4g23650/F9D16_120 mRNA, complete
           cds.
          Length = 529

 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 25/60 (41%), Positives = 38/60 (63%)
 Frame = +3

Query: 585 KRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           + Y  G+ LG GQFG TY+ T K    +VA K I  ++++    +EDV+REV+I+  L+G
Sbjct: 76  RTYEFGRELGRGQFGVTYLVTHKETKQQVACKSIPTRRLVHKDDIEDVRREVQIMHHLSG 135



>pir|S46284|S46284 calcium-dependent protein kinase (EC 2.7.1.-) 2 -
           Arabidopsis thaliana>gb:ATHCDPKB_1553098 Arabidopsis
           thaliana mRNA for calcium-dependent protein kinase
           (CDPK), complete cds.
          Length = 495

 Score = 52.8 bits (125), Expect = 7e-06
 Identities = 26/57 (45%), Positives = 36/57 (63%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALT 761
           Y +GK LG GQFG TY+ T+KS     A K I K+K++     EDV RE++I+  L+
Sbjct: 26  YLLGKKLGQGQFGTTYLCTEKSTSANYACKSIPKRKLVCREDYEDVWREIQIMHHLS 82



>gb:AB016870_1512872 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K15I22.>gb:AY030303_1559364 Arabidopsis
           thaliana CBL-interacting protein kinase 19 (CIPK19)
           mRNA, complete cds.
          Length = 483

 Score = 52.4 bits (124), Expect = 9e-06
 Identities = 23/55 (41%), Positives = 37/55 (67%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +Y +G+LLGHG F   Y+A +   G+ VA+K I+K+K+L    +  +KRE+ IL+
Sbjct: 27  KYEMGRLLGHGTFAKVYLARNAQSGESVAIKVIDKEKVLKSGLIAHIKREISILR 81



>pir|T04862|T04862 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) F28A21.110 - Arabidopsis
           thaliana>gb:ATCHRIV49_1545671 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           49.>gb:ATF28A21_1550259 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F28A21 (ESSA
           project).>gb:AY059819_1564663 Arabidopsis thaliana
           putative protein kinase (At4g18700; F28A21.110) mRNA,
           complete cds.>gb:BT001170_1635425 Arabidopsis thaliana
           putative protein kinase (At4g18700) mRNA, complete
           cds.>gb:AF295667_1783966 Arabidopsis thaliana
           CBL-interacting protein kinase 12 (CIPK12) mRNA,
           complete cds.>gb:AF339149_1787719 Arabidopsis thaliana
           SOS2-like protein kinase PKS8 mRNA, complete cds.
          Length = 489

 Score = 52.4 bits (124), Expect = 9e-06
 Identities = 24/55 (43%), Positives = 36/55 (65%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           RY +GKLLGHG F   Y+A +    + VA+K I+K+K+L    +  +KRE+ IL+
Sbjct: 25  RYEMGKLLGHGTFAKVYLARNVKTNESVAIKVIDKEKVLKGGLIAHIKREISILR 79



>gb:AP003948_1835627 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, BAC clone:OJ1211_G06.
          Length = 565

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 28/72 (38%), Positives = 41/72 (56%), Gaps = 10/72 (13%)
 Frame = +3

Query: 576 DFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAV----------ED 725
           +F +RY +GK LG G+FG T   +D + G+ +A K I K + L P  V          ED
Sbjct: 72  EFARRYVLGKELGRGEFGVTRRCSDAATGEALACKTIRKHRRLAPPRVTAAKAAAAHGED 131

Query: 726 VKREVKILKALT 761
           VKREV I++ ++
Sbjct: 132 VKREVAIMRRMS 143



>pir|G85097|G85097 hypothetical protein AT4g09570 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV27_1544671 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           27.>gb:ATT25P22_1555461 Arabidopsis thaliana DNA
           chromosome 4, BAC clone T25P22 (ESSA
           project).>gb:ATU31752_1556900 Arabidopsis thaliana
           calmodulin-domain protein kinase CDPK isoform 4 (CPK4)
           mRNA, partial cds.
          Length = 501

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 26/57 (45%), Positives = 36/57 (63%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALT 761
           Y +GK LG GQFG TY+ T+KS     A K I K+K++     EDV RE++I+  L+
Sbjct: 25  YLLGKKLGQGQFGTTYLCTEKSSSANYACKSIPKRKLVCREDYEDVWREIQIMHHLS 81



>gb:BAC221D7_2088756 Mus musculus BAC22107 partial stk33 gene.
          Length = 378

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 33/115 (28%), Positives = 57/115 (49%), Gaps = 2/115 (1%)
 Frame = +3

Query: 420 ATSAQDEERSRCNRRKAKEPCEKYKNLNVKPSHRSQTVVIPCGKRTDFGYDKD--FDKRY 593
           A+  + +ER+       K+   +  N+  KP  +     +  GK      D     ++ Y
Sbjct: 52  ASQERKKERNTSRESSLKDLSIRTSNVERKPQAQWSRSNVTVGKIPHIRMDDGAGIEEFY 111

Query: 594 TIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
           T G++LG G FG  + A DK  G + A+K++ K+K     A++ ++REV ILK +
Sbjct: 112 TFGRILGQGSFGMVFEAIDKETGAKWAIKKVNKEK-AGSSAMKLLEREVSILKTV 165



>gb:AY247755_1592603 Glycine max seed calcium dependent protein
           kinase b mRNA, complete cds.
          Length = 490

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 25/57 (43%), Positives = 35/57 (61%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALT 761
           Y +GK LG GQFG TY+ T K  G   A K I K+K++     +DV RE++I+  L+
Sbjct: 24  YVLGKKLGQGQFGTTYLCTHKVTGKLYACKSIPKRKLMCQEDYDDVWREIQIMHHLS 80



>pir|T08873|T08873 calcium-dependent protein kinase (EC 2.7.1.-)
           beta - soybean>gb:GMU69173_1680735 Glycine max
           calmodulin-like domain protein kinase isoenzyme beta
           mRNA, complete cds.
          Length = 490

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 25/57 (43%), Positives = 35/57 (61%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALT 761
           Y +GK LG GQFG TY+ T K  G   A K I K+K++     +DV RE++I+  L+
Sbjct: 24  YVLGKKLGQGQFGTTYLCTHKVTGKLYACKSIPKRKLMCQEDYDDVWREIQIMHHLS 80



>gb:AC144743_1744253 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone P0009H09, complete sequence.
          Length = 269

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 24/56 (42%), Positives = 36/56 (64%)
 Frame = +3

Query: 585 KRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +RY IG+ LG G FG  Y A + S G  VA+K I+K+ ++    VE +KRE+ I++
Sbjct: 9   ERYEIGRQLGQGTFGKVYYARNLSSGHSVAIKMIDKEIIMKVSLVEQIKREISIMR 64



>gb:MZECDPK_1687848 Zea mays calcium dependent protein kinase (CDPK)
           mRNA, partial cds.
          Length = 451

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 25/58 (43%), Positives = 37/58 (63%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           Y +G+ LG GQFG TY+ TD + G  +  K I K+ ++    VEDV+RE++I+  L G
Sbjct: 16  YALGRKLGQGQFGTTYLCTDLATGG-LRCKSIAKRNVITKEDVEDVRREIQIMHHLAG 72



>gb:AY301062_1597321 Zea mays calcium-dependent protein kinase
           ZmCPK11 mRNA, complete cds.
          Length = 510

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 27/57 (47%), Positives = 34/57 (59%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALT 761
           Y IGK LG GQFG TY    K+ G   A K I K+K+L     EDV RE++I+  L+
Sbjct: 44  YRIGKKLGQGQFGTTYQCVGKADGAEYACKSIPKRKLLCREDYEDVYREIQIMHHLS 100



>gb:AY191840_1588655 Pisum sativum calcineurin B-like-interacting
           protein kinase mRNA, complete cds.
          Length = 516

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 24/55 (43%), Positives = 35/55 (63%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           R+ +GKLLGHG F   ++A +   G+ VA+K I K K+L    V  +KRE+ IL+
Sbjct: 25  RFELGKLLGHGTFAKVHLAKNIKTGEAVAIKIISKDKILKSGLVSHIKREISILR 79



>pir|T02306|T02306 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AC004481_1531718 Arabidopsis thaliana
           chromosome 2 clone F13P17 map ve016, complete
           sequence.>gb:AF295668_1783967 Arabidopsis thaliana
           CBL-interacting protein kinase 13 (CIPK13) mRNA,
           complete cds.
          Length = 502

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 24/55 (43%), Positives = 36/55 (65%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +Y IGKLLGHG F   Y+A +   G+ VA+K I+K+K++       +KRE+ IL+
Sbjct: 56  KYEIGKLLGHGSFAKVYLARNIHSGEDVAIKVIDKEKIVKSGLAGHIKREISILR 110



>pir|S56717|S56717 calcium-dependent protein kinase (EC 2.7.1.-) -
           maize  (fragment)
          Length = 451

 Score = 50.8 bits (120), Expect = 3e-05
 Identities = 25/58 (43%), Positives = 37/58 (63%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           Y +G+ LG GQFG TY+ TD + G  +  K I K+ ++    VEDV+RE++I+  L G
Sbjct: 16  YALGRKLGQGQFGTTYLCTDLATGG-LRCKSIAKRNVITKEDVEDVRREIQIMHHLAG 72



>gb:AP003757_1832984 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 7, BAC clone:OJ1409_C08.
          Length = 443

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 22/56 (39%), Positives = 36/56 (64%)
 Frame = +3

Query: 585 KRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           K+Y +GKLLG G F   Y A +    + VA+K I+K+K+L    ++ +KRE+ ++K
Sbjct: 11  KKYEMGKLLGQGTFAKVYHARNTETSESVAIKMIDKEKVLKGGLMDQIKREISVMK 66



>gb:AF428398_1799328 Arabidopsis thaliana At2g30360/T9D9.17 mRNA,
           complete cds.
          Length = 372

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 25/59 (42%), Positives = 37/59 (62%), Gaps = 1/59 (1%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLL-PMAVEDVKREVKILKALT 761
           +Y +GKLLG G F   + A D+  G  VAVK + KKK+L  P    ++KRE+ I++ L+
Sbjct: 20  KYELGKLLGCGAFAKVFHARDRRTGQSVAVKILNKKKLLTNPALANNIKREISIMRRLS 78



>gb:T4B21_1724070 Arabidopsis thaliana BAC T4B21.
          Length = 584

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 24/64 (37%), Positives = 40/64 (62%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D  K Y++G+ LG G  G TY+  +   G+  A K I K+K++  +  EDVK E++I++
Sbjct: 63  EDIRKFYSLGRELGRGGLGITYMCKEIGTGNIYACKSILKRKLISELGREDVKTEIQIMQ 122

Query: 753 ALTG 764
            L+G
Sbjct: 123 HLSG 126



>pir|E84707|E84707 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AC002338_1530492 Arabidopsis thaliana
           chromosome 2 clone T9D9 map m283, complete
           sequence.>gb:BT002478_1636081 Arabidopsis thaliana
           putative protein kinase (At2g30360) mRNA, complete
           cds.>gb:BT006582_1639469 Arabidopsis thaliana At2g30360
           mRNA, complete cds.>gb:AF295666_1783965 Arabidopsis
           thaliana CBL-interacting protein kinase 11 (CIPK11)
           mRNA, partial cds.>gb:AF339146_1787716 Arabidopsis
           thaliana SOS2-like protein kinase PKS5 mRNA, complete
           cds.>gb:AF370595_1792378 Arabidopsis thaliana putative
           protein kinase (At2g30360; T9D9.17) mRNA, complete cds.
          Length = 435

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 25/59 (42%), Positives = 37/59 (62%), Gaps = 1/59 (1%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLL-PMAVEDVKREVKILKALT 761
           +Y +GKLLG G F   + A D+  G  VAVK + KKK+L  P    ++KRE+ I++ L+
Sbjct: 20  KYELGKLLGCGAFAKVFHARDRRTGQSVAVKILNKKKLLTNPALANNIKREISIMRRLS 78



>pir|F85059|F85059 probable calcium dependent protein kinase
           [imported] - Arabidopsis thaliana>gb:ATCHRIV13_1544318
           Arabidopsis thaliana DNA chromosome 4, contig fragment
           No. 13.>gb:AY059823_1564667 Arabidopsis thaliana Unknown
           protein mRNA, complete cds.>gb:AY081557_1568817
           Arabidopsis thaliana unknown protein mRNA, complete cds.
          Length = 520

 Score = 50.4 bits (119), Expect = 3e-05
 Identities = 24/64 (37%), Positives = 40/64 (62%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +D  K Y++G+ LG G  G TY+  +   G+  A K I K+K++  +  EDVK E++I++
Sbjct: 63  EDIRKFYSLGRELGRGGLGITYMCKEIGTGNIYACKSILKRKLISELGREDVKTEIQIMQ 122

Query: 753 ALTG 764
            L+G
Sbjct: 123 HLSG 126



>gb:AY222455_1590589 Lycopersicon esculentum SNF1-related protein
           kinase mRNA, complete cds.
          Length = 504

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 22/56 (39%), Positives = 34/56 (60%)
 Frame = +3

Query: 585 KRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           + Y +GK LGHG FG   +A     G +VA+K + ++KM  P   E ++RE+KI +
Sbjct: 15  RNYRVGKTLGHGSFGKVKIAEHLLTGHKVAIKILNRRKMKTPDMEEKLRREIKICR 70



>pir|T07415|T07415 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) PKIN1 - potato>gb:STPKIN1X1_1722858
           S.tuberosum PKIN1 gene (353bp).
          Length = 504

 Score = 50.1 bits (118), Expect = 5e-05
 Identities = 22/56 (39%), Positives = 34/56 (60%)
 Frame = +3

Query: 585 KRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           + Y +GK LGHG FG   +A     G +VA+K + ++KM  P   E ++RE+KI +
Sbjct: 15  RNYRVGKTLGHGSFGKVKIAEHLLTGHKVAIKILNRRKMKTPDMEEKLRREIKICR 70



>gb:AF141378_1771583 Zea mays protein kinase PK4 mRNA, complete cds.
          Length = 518

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 22/55 (40%), Positives = 34/55 (61%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +Y +G+LLGHG F   Y A     GD VA+K ++K+K +    V  +KRE+ +L+
Sbjct: 44  KYELGRLLGHGTFAKVYHARHVDTGDNVAIKVLDKEKAVKSGLVPHIKREIAVLR 98



>gb:AY247754_1592602 Glycine max seed calcium dependent protein
           kinase a mRNA, complete cds.
          Length = 507

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 24/57 (42%), Positives = 36/57 (63%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALT 761
           Y +G+ LG GQFG T+  T ++ G + A K I K+K+L     EDV RE++I+  L+
Sbjct: 33  YEVGRKLGQGQFGTTFECTRRASGGKFACKSIPKRKLLCKEDYEDVWREIQIMHHLS 89



>sp|P28583|CDPK_SOYBN Calcium-dependent protein kinase SK5 (EC
           2.7.1.-) (CDPK).>pir|A43713|A43713 calcium-dependent
           protein kinase (EC 2.7.1.-) -
           soybean>gb:SOYCADPK_1715975 Glycine max calcium
           dependent protein kinase mRNA.
          Length = 508

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 24/57 (42%), Positives = 36/57 (63%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALT 761
           Y +G+ LG GQFG T+  T ++ G + A K I K+K+L     EDV RE++I+  L+
Sbjct: 34  YEVGRKLGQGQFGTTFECTRRASGGKFACKSIPKRKLLCKEDYEDVWREIQIMHHLS 90



>gb:AP005429_1851700 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0701F11.
          Length = 404

 Score = 49.3 bits (116), Expect = 8e-05
 Identities = 22/58 (37%), Positives = 35/58 (60%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALT 761
           RY +G++LGHG FG  + A D   G  VA+K + K K+      E +KRE+ ++K ++
Sbjct: 10  RYEMGRVLGHGNFGRVHAARDVRTGRAVAMKVVSKDKVERAGMAEQIKREIAVMKMVS 67



>gb:CSA318078_1673818 Cucumis sativus partial mRNA for
           calcium-dependent/calmodulin-independent protein kinase
           (cdpk4 gene), isoform 4.
          Length = 124

 Score = 49.3 bits (116), Expect = 8e-05
 Identities = 23/51 (45%), Positives = 33/51 (64%)
 Frame = +3

Query: 612 GHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           G GQFG TY+ T+ + G   A K I K+K++    VEDV+RE++I+  L G
Sbjct: 1   GRGQFGTTYLCTEITTGIEYACKSISKRKLIAKEDVEDVRREIQIMHHLAG 51



>gb:AB011967_1511593 Oryza sativa OsPK4 gene, complete
           cds.>gb:AC132485_1741136 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone P0022D06, complete
           sequence.
          Length = 508

 Score = 49.3 bits (116), Expect = 8e-05
 Identities = 23/55 (41%), Positives = 34/55 (61%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           RY +G+LLGHG F   Y A     G+ VA+K ++K+K +    V  +KRE+ IL+
Sbjct: 36  RYELGRLLGHGTFAKVYQARSADSGEPVAIKVLDKEKAMRHGLVPHIKREIAILR 90



>pir|G86259|G86259 protein T12C24.12 [imported] - Arabidopsis
           thaliana>gb:AE005172_890269 Arabidopsis thaliana
           chromosome 1, top arm complete
           sequence.>gb:AC025416_1539481 Genomic sequence for
           Arabidopsis thaliana BAC F5O11 from chromosome I,
           complete sequence.>gb:AC025417_1539494 Genomic sequence
           for Arabidopsis thaliana BAC T12C24 from chromosome I,
           complete sequence.>gb:AY057692_1564104 Arabidopsis
           thaliana At1g12580/T12C24_10 mRNA, complete
           cds.>gb:AY143928_1583385 Arabidopsis thaliana
           At1g12580/T12C24_10 mRNA, complete cds.
          Length = 522

 Score = 49.3 bits (116), Expect = 8e-05
 Identities = 23/59 (38%), Positives = 36/59 (61%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           RY +G+ LG GQFG   V +DK  G+R+A K I K +++    ++ +K E+ I+  L G
Sbjct: 43  RYVLGEQLGWGQFGVIRVCSDKLTGERLACKSISKDRLVTQDDMKSIKLEIAIMAKLAG 101



>gb:D30622_1674523 Arabidopsis thaliana mRNA for novel
           serine/threonine protein kinase, complete
           cds.>gb:AF302111_1784287 Arabidopsis thaliana
           CBL-interacting protein kinase 15 (CIPK15) mRNA,
           complete cds.>gb:AF339144_1787714 Arabidopsis thaliana
           SOS2-like protein kinase PKS3 mRNA, complete cds.
          Length = 421

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 23/57 (40%), Positives = 33/57 (57%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
           RY +GK LG G F   Y A     GD VA+K I+K+++L     E +KRE+  ++ L
Sbjct: 11  RYEVGKFLGQGTFAKVYHARHLKTGDSVAIKVIDKERILKVGMTEQIKREISAMRLL 67



>pir|T48202|T48202 protein kinase AK22 (EC 2.7.1.-) - Arabidopsis
           thaliana>gb:ATT20L15_1555034 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T20L15 (ESSA project).
          Length = 421

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 23/57 (40%), Positives = 33/57 (57%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
           RY +GK LG G F   Y A     GD VA+K I+K+++L     E +KRE+  ++ L
Sbjct: 11  RYEVGKFLGQGTFAKVYHARHLKTGDSVAIKVIDKERILKVGMTEQIKREISAMRLL 67



>gb:AP003230_1825761 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0031D02.
          Length = 501

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 22/55 (40%), Positives = 33/55 (60%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           RY +GK LG G F   Y A + + G  VA+K I K K++    +E +KRE+ I++
Sbjct: 10  RYEVGKQLGQGTFAKVYYARNLTTGQAVAIKMINKDKVMKVGLMEQIKREISIMR 64



>gb:AF319169_1785756 Brassica napus CBL-interacting protein kinase
           (CIPK) mRNA, complete cds.
          Length = 441

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 21/55 (38%), Positives = 36/55 (65%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           RY +G+LLGHG F   Y A + + G  VA+K + K+K++    V+ +KRE+ +++
Sbjct: 23  RYELGRLLGHGTFAKVYHARNVTTGKSVAMKVVGKEKVVKVGMVDQIKREISVMR 77



>gb:CSA318076_1673816 Cucumis sativus partial mRNA for
           calcium-dependent/calmodulin-independent protein kinase
           (cdpk2 gene), isoform 2.
          Length = 124

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 23/51 (45%), Positives = 32/51 (62%)
 Frame = +3

Query: 612 GHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           G GQFG T++  +KS G   A K I K+K+     VEDV+RE++I+  L G
Sbjct: 1   GRGQFGTTFLCLEKSTGKEYACKSIAKRKLATMEDVEDVRREIQIMHHLVG 51



>gb:AY027885_1559053 Cucumis sativus calcium-dependent
           calmodulin-independent protein kinase 5 mRNA, complete
           cds.>gb:CSA320242_1673819 Cucumis sativus mRNA for
           calcium dependent calmodulin independent protein kinase
           (cdpk5 gene).
          Length = 514

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 26/58 (44%), Positives = 34/58 (58%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALTG 764
           Y+    LG GQFG TY+ T K      A K I  +K++    VEDV+REV+I+  LTG
Sbjct: 63  YSFRGELGRGQFGVTYLVTHKETKQDFACKSIATRKLIDQDDVEDVRREVQIMHHLTG 120



>gb:AY098940_1576504 Solanum tuberosum CDPK-like protein mRNA,
           complete cds.
          Length = 511

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 24/73 (32%), Positives = 39/73 (53%)
 Frame = +3

Query: 546 GKRTDFGYDKDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVED 725
           G   D  +  +   RY +G+ LG GQFG     +DK  G+ +A K + K +++    V  
Sbjct: 27  GTILDASHTANLHDRYILGEQLGWGQFGIIRTCSDKFTGEVLACKSVAKNRLVTQEDVRS 86

Query: 726 VKREVKILKALTG 764
           VK E++I+  L+G
Sbjct: 87  VKLEIEIMTRLSG 99



>gb:CR548612_1375514 Paramecium tetraurelia macronuclear largest
           chromosome, complete sequence.
          Length = 562

 Score = 48.1 bits (113), Expect = 2e-04
 Identities = 24/54 (44%), Positives = 35/54 (64%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           Y IGK LG G FG   +A  +  G++VA+K +EK +++    VE V+RE+ ILK
Sbjct: 21  YAIGKTLGFGTFGKVKMAIHEQSGEKVAIKILEKDRIVETADVERVQREIHILK 74



>gb:AC104427_1737588 Oryza sativa (japonica cultivar-group)
           chromosome 3 clone OJ1015F07, complete sequence.
          Length = 542

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 21/57 (36%), Positives = 33/57 (57%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
           RY +GK +G G F    VA D   GD +A+K +++  +L    VE +KRE+  +K +
Sbjct: 26  RYELGKTIGEGSFAKVKVARDTRTGDTLAIKVLDRNHVLRHKMVEQIKREISTMKLI 82



>pir|E85362|E85362 hypothetical protein AT4g30960 [imported] -
           Arabidopsis thaliana>gb:ATCHRIV74_1547017 Arabidopsis
           thaliana DNA chromosome 4, contig fragment No.
           74.>gb:ATF6I18_1550877 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F6I18 (ESSA
           project).>gb:AY035046_1559823 Arabidopsis thaliana
           putative protein kinase (At4g30960) mRNA, complete
           cds.>gb:AY051051_1562527 Arabidopsis thaliana putative
           protein kinase (At4g30960) mRNA, complete
           cds.>gb:AF285106_1783113 Arabidopsis thaliana
           CBL-interacting protein kinase 6 (CIPK6) mRNA, complete
           cds.>gb:AF339145_1787715 Arabidopsis thaliana SOS2-like
           protein kinase PKS4 mRNA, complete
           cds.>gb:AF436831_1799883 Arabidopsis thaliana
           AT4g30960/F6I18_130 mRNA, complete cds.
          Length = 441

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 21/55 (38%), Positives = 35/55 (63%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           RY +G+LLGHG F   Y A +   G  VA+K + K+K++    V+ +KRE+ +++
Sbjct: 23  RYELGRLLGHGTFAKVYHARNIQTGKSVAMKVVGKEKVVKVGMVDQIKREISVMR 77



>gb:AP006756_1862895 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 9, PAC clone:P0450E05.
          Length = 577

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 26/73 (35%), Positives = 41/73 (56%), Gaps = 1/73 (1%)
 Frame = +3

Query: 546 GKRTDFGYDKDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMA-VE 722
           G   D      F +RY +G  LG G+FG T   +D + G+ +A K I +K++       E
Sbjct: 90  GDAADVKTAAGFAERYRLGAELGRGEFGVTRRCSDAATGEALACKTIRRKRLRRCRGDAE 149

Query: 723 DVKREVKILKALT 761
           DV+REV+IL+ ++
Sbjct: 150 DVRREVEILRRIS 162



>gb:AP003608_1831264 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, PAC
           clone:P0007G12.>gb:AP004810_1845472 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 6, BAC
           clone:B1068H08.
          Length = 514

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 20/58 (34%), Positives = 37/58 (63%)
 Frame = +3

Query: 585 KRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
           +RY  G L+G G F   Y+   ++ G+ VA+K ++K+K++   A E +KRE+ +++ L
Sbjct: 19  ERYEFGPLVGEGNFAKVYLGRHRATGEEVAIKVMDKEKLVRLGATELIKREIAVMQRL 76



>gb:AP001551_1821334 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0451C06.>gb:AP003052_1824475 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OSJNBa0016I09.
          Length = 511

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 21/55 (38%), Positives = 34/55 (61%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           R+ +GKLLG G F   Y A + + G+ VA+K +EK+K+        +KRE+ +L+
Sbjct: 24  RFEVGKLLGQGNFAKVYHARNVATGEEVAIKVMEKEKIFKSGLTAHIKREIAVLR 78



>gb:HVU7990_1682841 Hordeum vulgare mRNA for SnRK1-type protein
           kinase, partial.
          Length = 513

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 24/56 (42%), Positives = 32/56 (57%)
 Frame = +3

Query: 585 KRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           K Y +GK LG G FG   VA  K  G RVA+K + ++KM      E   RE+KI++
Sbjct: 15  KNYNLGKTLGLGTFGDVKVAEHKLTGQRVAIKILNRRKMETMEMEEKANREIKIMR 70



>pir|S60303|S60303 serine/threonine-specific protein kinase (EC
           2.7.1.-) BKIN12 (version 1) -
           barley>gb:HVBKIN12G_1682284 H.vulgare BKIN12 gene for
           protein kinase.
          Length = 513

 Score = 47.4 bits (111), Expect = 3e-04
 Identities = 24/56 (42%), Positives = 32/56 (57%)
 Frame = +3

Query: 585 KRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           K Y +GK LG G FG   VA  K  G RVA+K + ++KM      E   RE+KI++
Sbjct: 15  KNYNLGKTLGLGTFGDVKVAEHKLTGQRVAIKILNRRKMETMEMEEKANREIKIMR 70



>gb:AB101657_1526324 Oryza sativa (japonica cultivar-group) OSK35
           gene for SnRK1b protein kinase, complete
           cds.>gb:D82036_1674799 Oryza sativa mRNA for OSK5,
           complete cds.>gb:D82038_1674801 Oryza sativa mRNA for
           OSK3, complete cds.
          Length = 508

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 23/56 (41%), Positives = 33/56 (58%)
 Frame = +3

Query: 585 KRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           K Y +G+ LG G FG   +A  K  G RVA+K + +++M      E  KRE+KIL+
Sbjct: 15  KNYNLGRTLGIGSFGKVKIAEHKLTGHRVAIKILNRRQMRNMEMEEKAKREIKILR 70



>gb:AB101656_1526323 Oryza sativa (japonica cultivar-group) OSK24
           gene for SnRK1b protein kinase, complete
           cds.>gb:D82035_1674798 Oryza sativa mRNA for OSK4,
           complete cds.>gb:AP005918_1860111 Oryza sativa (japonica
           cultivar-group) genomic DNA, chromosome 8, PAC
           clone:P0419H09.
          Length = 509

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 23/56 (41%), Positives = 33/56 (58%)
 Frame = +3

Query: 585 KRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           K Y +G+ LG G FG   +A  K  G RVA+K + +++M      E  KRE+KIL+
Sbjct: 15  KNYNLGRTLGIGSFGKVKIAEHKLTGHRVAIKILNRRQMRNMEMEEKAKREIKILR 70



>gb:AB016870_1512873 Arabidopsis thaliana genomic DNA, chromosome 5,
           TAC clone:K15I22.>gb:AY035225_1559967 Arabidopsis
           thaliana CBL-interacting protein kinase 20 (CIPK20)
           mRNA, complete cds.
          Length = 439

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 19/56 (33%), Positives = 36/56 (64%)
 Frame = +3

Query: 585 KRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           ++Y +G+LLG G F   Y A +   G+ VA+K I+K+K+     ++ +KRE+ +++
Sbjct: 10  RKYELGRLLGQGTFAKVYHARNIKTGESVAIKVIDKQKVAKVGLIDQIKREISVMR 65



>pir|T04145|T04145 serine/threonine protein kinase homolog -
           rice>gb:OSU55768_1698466 Oryza sativa SNF1-related
           protein kinase (RSk1) mRNA, complete cds.
          Length = 510

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 23/56 (41%), Positives = 33/56 (58%)
 Frame = +3

Query: 585 KRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           K Y +G+ LG G FG   +A  K  G RVA+K + +++M      E  KRE+KIL+
Sbjct: 15  KNYNLGRTLGIGSFGKVKIAEHKLTGHRVAIKILNRRQMRNMEMEEKAKREIKILR 70



>gb:BC045836_2549357 Danio rerio pim-1 oncogene, mRNA (cDNA clone
           MGC:55203 IMAGE:5413662), complete cds.
          Length = 310

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 25/66 (37%), Positives = 39/66 (59%), Gaps = 4/66 (6%)
 Frame = +3

Query: 579 FDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKM----LLPMAVEDVKREVKI 746
           F+K+YT+G LLG G FG  Y     S G +VA+K+I + ++     +P  V  V  E+ +
Sbjct: 26  FEKQYTMGNLLGSGGFGSVYSGHRISDGQKVAIKQISRDRIQQWSKMPGEVNPVPNEIAL 85

Query: 747 LKALTG 764
           L++L G
Sbjct: 86  LQSLGG 91



>gb:AL590148_2503668 Zebrafish DNA sequence from clone RP71-30I22 in
           linkage group 8 Contains part of a novel gene for a
           protein similar to human FLJ12550, the pim1 gene for
           pim-1 oncogene (proviral integration site 1), part of a
           novel gene for a protein similar to vertebrate
           UDP-galactose transporters, a novel gene for a protein
           similar to vertebrate caldesmon 1 (CALD1) and a CpG
           island, complete sequence.
          Length = 310

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 25/66 (37%), Positives = 39/66 (59%), Gaps = 4/66 (6%)
 Frame = +3

Query: 579 FDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKM----LLPMAVEDVKREVKI 746
           F+K+YT+G LLG G FG  Y     S G +VA+K+I + ++     +P  V  V  E+ +
Sbjct: 26  FEKQYTMGNLLGSGGFGSVYSGHRISDGQKVAIKQISRDRIQQWSKMPGEVNPVPNEIAL 85

Query: 747 LKALTG 764
           L++L G
Sbjct: 86  LQSLGG 91



>gb:CSA312239_1673811 Cucumis sativus partial mRNA for
           calcium-dependent /calmodulin-independent protein kinase
           (cdpk1 gene), isoform 1.
          Length = 124

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 23/50 (46%), Positives = 31/50 (62%)
 Frame = +3

Query: 612 GHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALT 761
           G GQFG T++ TDK  G   A K I K+K+L     EDV RE++I+  L+
Sbjct: 1   GRGQFGTTFLCTDKPTGFNYACKTIPKRKLLCKEEYEDVWREIQIMHHLS 50



>sp|Q02723|RKI1_SECCE Carbon catabolite derepressing protein kinase
           (EC 2.7.1.-).>pir|A41361|A41361
           serine/threonine-specific protein kinase (EC 2.7.1.-)
           RKIN1 - rye>gb:RYERKIN1_1704105 Secale cereale RKIN1
           mRNA, complete CDS.
          Length = 502

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 22/56 (39%), Positives = 33/56 (58%)
 Frame = +3

Query: 585 KRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           K Y +GK+LG G F    +A  K    +VA+K + +++M  P   E  KRE+KIL+
Sbjct: 12  KNYYLGKILGVGTFAKVIIAEHKHTRHKVAIKVLNRRQMRAPEMEEKAKREIKILR 67



>sp|Q9YHZ5|PIM1_BRARE Serine/threonine-protein kinase Pim-1 (EC
           2.7.1.37).>gb:AF062643_2471368 Danio rerio Pim1 mRNA,
           complete cds.
          Length = 310

 Score = 46.6 bits (109), Expect = 5e-04
 Identities = 25/66 (37%), Positives = 39/66 (59%), Gaps = 4/66 (6%)
 Frame = +3

Query: 579 FDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKM----LLPMAVEDVKREVKI 746
           F+K+YT+G LLG G FG  Y     S G +VA+K+I + ++     +P  V  V  E+ +
Sbjct: 26  FEKQYTMGNLLGSGGFGSVYSGHRISDGQKVAIKQISRDRIQQWSKMPGEVNPVPNEIAL 85

Query: 747 LKALTG 764
           L++L G
Sbjct: 86  LQSLGG 91



>gb:T19J18_1723566 Arabidopsis thaliana BAC T19J18.
          Length = 453

 Score = 46.2 bits (108), Expect = 7e-04
 Identities = 26/63 (41%), Positives = 34/63 (53%)
 Frame = +3

Query: 576 DFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKA 755
           D  K Y +G  LG GQFG T    +K+ G   A K I K  +      E VKRE++I+K 
Sbjct: 40  DIGKVYILGDELGQGQFGITRKCVEKTSGKTYACKTILKTNLKSREDEEAVKREIRIMKH 99

Query: 756 LTG 764
           L+G
Sbjct: 100 LSG 102



>gb:AP003409_1828997 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, BAC clone:B1131G08.
          Length = 476

 Score = 45.8 bits (107), Expect = 9e-04
 Identities = 22/55 (40%), Positives = 33/55 (60%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           RY +G+LLG G F   Y A   + G+ VA+K  +K+ +     VE VKREV +++
Sbjct: 16  RYKLGRLLGRGTFAKVYKAYKLATGEAVAIKVFDKEAVQRSGTVEQVKREVDVMR 70



>gb:AP003256_1826448 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC clone:P0460E08.
          Length = 474

 Score = 45.8 bits (107), Expect = 9e-04
 Identities = 22/55 (40%), Positives = 33/55 (60%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           RY +G+LLG G F   Y A   + G+ VA+K  +K+ +     VE VKREV +++
Sbjct: 14  RYKLGRLLGRGTFAKVYKAYKLATGEAVAIKVFDKEAVQRSGTVEQVKREVDVMR 68



>gb:AP001551_1821337 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 1, PAC
           clone:P0451C06.>gb:AP003052_1824478 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 1, BAC
           clone:OSJNBa0016I09.
          Length = 461

 Score = 45.8 bits (107), Expect = 9e-04
 Identities = 20/55 (36%), Positives = 35/55 (63%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           RY +G++LG G F   Y A + +    VA+K I+K+K+L    ++ +KRE+ I++
Sbjct: 11  RYELGRMLGQGTFAKVYHARNLASNQSVAIKVIDKEKVLRVGMIDQIKREISIMR 65



>gb:AP001168_1820888 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 6, clone:P0425F02.>gb:AP002838_1823022
           Oryza sativa (japonica cultivar-group) genomic DNA,
           chromosome 6, BAC clone:OSJNBa0038F22.
          Length = 506

 Score = 45.8 bits (107), Expect = 9e-04
 Identities = 22/61 (36%), Positives = 35/61 (57%)
 Frame = +3

Query: 582 DKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALT 761
           + RY +G  LG GQFG     +D   G+ +A K I K +++ P  V  VK E++++  L+
Sbjct: 34  EDRYALGPQLGWGQFGVIRSCSDMVTGEALACKSIAKDRLVSPDDVRGVKLEIEVMARLS 93

Query: 762 G 764
           G
Sbjct: 94  G 94



>gb:CSA318077_1673817 Cucumis sativus partial mRNA for
           calcium-dependent/calmodulin-independent protein kinase
           (cdpk3 gene), isoform 3.
          Length = 124

 Score = 45.8 bits (107), Expect = 9e-04
 Identities = 23/50 (46%), Positives = 31/50 (62%)
 Frame = +3

Query: 612 GHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKALT 761
           G GQFG TY+ T +  GD  A K I K+K+L     EDV RE++I+  L+
Sbjct: 1   GRGQFGTTYLCTYRPTGDLYACKSIPKRKLLCKEDYEDVWREIQIMHHLS 50



>gb:AB052663_1521218 Arabidopsis thaliana AtC401 gene for SNF1-like
           protein kinase, complete cds.
          Length = 831

 Score = 45.8 bits (107), Expect = 9e-04
 Identities = 21/57 (36%), Positives = 33/57 (57%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
           +Y +G+L+G   FG    A D   GD VA+  ++K K+L     E +KRE+ I+K +
Sbjct: 12  KYEVGRLIGECNFGKLRSAVDTETGDPVALMILDKDKVLKHKMAEQIKREISIMKLI 68



>gb:AB050965_1521053 Arabidopsis thaliana AtC401 mRNA for PnC401
           homologue, complete cds.
          Length = 831

 Score = 45.8 bits (107), Expect = 9e-04
 Identities = 21/57 (36%), Positives = 33/57 (57%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
           +Y +G+L+G   FG    A D   GD VA+  ++K K+L     E +KRE+ I+K +
Sbjct: 12  KYEVGRLIGECNFGKLRSAVDTETGDPVALMILDKDKVLKHKMAEQIKREISIMKLI 68



>gb:BC031231_1980093 Homo sapiens serine/threonine kinase 33, mRNA
           (cDNA clone MGC:39551 IMAGE:5296502), complete cds.
          Length = 514

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 24/56 (42%), Positives = 36/56 (64%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
           YT G++LG G FG    ATDK    + A+K++ K+K     AV+ ++REV ILK++
Sbjct: 116 YTFGRILGKGSFGIVIEATDKETETKWAIKKVNKEK-AGSSAVKLLEREVNILKSV 170



>gb:AF448226_1800641 Arabidopsis thaliana CBL-interacting protein
           kinase CIPK25 mRNA, complete cds.
          Length = 488

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 20/55 (36%), Positives = 34/55 (61%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +Y +G+LLG G FG  Y   + + G+ VA+K I K ++     +E +KRE+ I++
Sbjct: 42  KYEMGRLLGKGTFGKVYYGKEITTGESVAIKIINKDQVKREGMMEQIKREISIMR 96



>gb:AC140977_1744070 Arabidopsis thaliana chromosome 5 BAC F13M11
           genomic sequence, complete sequence.
          Length = 452

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 20/57 (35%), Positives = 34/57 (59%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
           +Y +GK LG G F     A +   G+RVA+K ++K+K+L     E ++RE+  +K +
Sbjct: 12  KYEVGKTLGQGTFAKVRCAVNTETGERVALKILDKEKVLKHKMAEQIRREICTMKLI 68



>gb:AY347743_1601398 Physcomitrella patens Snf1 related kinase 1
           (SNF1a) gene, complete cds.>gb:AY347744_1601399
           Physcomitrella patens Snf1 related kinase 1 (SNF1a)
           mRNA, complete cds.
          Length = 542

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 22/54 (40%), Positives = 33/54 (61%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           Y +GK LG G FG   VA     G +VA+K + ++K+ +    E V+RE+KIL+
Sbjct: 20  YKLGKTLGIGSFGKVKVAEHSPTGHKVAIKILNRRKVKMMDMEEKVRREIKILR 73



>gb:AY050360_1562139 Arabidopsis thaliana AT5g25110/T11H3_120 mRNA,
           complete cds.>gb:BT002209_1635812 Arabidopsis thaliana
           At5g25110/T11H3_120 mRNA, complete cds.
          Length = 487

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 20/55 (36%), Positives = 34/55 (61%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +Y +G+LLG G FG  Y   + + G+ VA+K I K ++     +E +KRE+ I++
Sbjct: 42  KYEMGRLLGKGTFGKVYYGKEITTGESVAIKIINKDQVKREGMMEQIKREISIMR 96



>gb:AX455758_1468850 Sequence 4 from Patent
           WO0220800.>gb:AK093251_1913925 Homo sapiens cDNA
           FLJ35932 fis, clone TESTI2011286, weakly similar to
           MYOSIN LIGHT CHAIN KINASE (EC
           2.7.1.117).>gb:HSA303380_2003538 Homo sapiens mRNA for
           serine/threonine kinase 33 (STK33 gene).
          Length = 514

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 24/56 (42%), Positives = 36/56 (64%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
           YT G++LG G FG    ATDK    + A+K++ K+K     AV+ ++REV ILK++
Sbjct: 116 YTFGRILGKGSFGIVIEATDKETETKWAIKKVNKEK-AGSSAVKLLEREVNILKSV 170



>pir|T14735|T14735 probable serine/threonine kinase (EC 2.7.1.-)
           SNFL1 - sorghum>gb:SBPPSTK_1704887 S.bicolor DNA for
           gene encoding putative protein serine/threonine kinase,
           clone cSNFL1.
          Length = 440

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 20/57 (35%), Positives = 33/57 (57%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
           +Y +G+ +G G F     A D   G+ VA+K ++K K+L    VE +KRE+  +K +
Sbjct: 12  KYELGRTIGEGTFAKVRFARDTVTGEAVAIKILDKDKVLKHKMVEQIKREISTMKLI 68



>gb:AP004126_1837992 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ9003_G05.>gb:AP004843_1845857 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:B1103G11.
          Length = 493

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 21/55 (38%), Positives = 33/55 (60%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           RY IG+ LG G F   Y A + + G  VA+K I+K+K+     +  +KRE+ I++
Sbjct: 11  RYEIGRQLGQGNFAKVYYARNLTSGQAVAIKMIDKEKVTRVGLMVQIKREISIMR 65



>gb:HVBKIN12M_1682285 H.vulgare BKIN12 mRNA for protein kinase
           (partial).
          Length = 513

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 23/56 (41%), Positives = 31/56 (55%)
 Frame = +3

Query: 585 KRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           K Y +GK LG G FG   VA     G RVA+K + ++KM      E   RE+KI++
Sbjct: 15  KNYNLGKTLGLGTFGDVKVAERNVTGQRVAIKILNRRKMETMEMEEKANREIKIMR 70



>pir|B84644|B84644 probable protein kinase [imported] - Arabidopsis
           thaliana>gb:AY030304_1559365 Arabidopsis thaliana
           CBL-interacting protein kinase 16 (CIPK16) mRNA,
           complete cds.
          Length = 469

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 25/61 (40%), Positives = 37/61 (60%), Gaps = 1/61 (1%)
 Frame = +3

Query: 579 FDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMA-VEDVKREVKILKA 755
           FDK Y IG+LLG G F   Y  T+ S GD VA+K I+K  +      +E ++RE+ +++ 
Sbjct: 12  FDK-YNIGRLLGTGNFAKVYHGTEISTGDDVAIKVIKKDHVFKRRGMMEQIEREIAVMRL 70

Query: 756 L 758
           L
Sbjct: 71  L 71



>pir|A56009|A56009 serine/threonine-specific protein kinase (EC
           2.7.1.-) NPK5 - common tobacco>gb:TOBNPK5_1725456
           Tobacco mRNA for protein kinase NPK5, complete cds.
          Length = 511

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 23/60 (38%), Positives = 35/60 (58%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           + F + Y +GK LG G FG   +A     G +VAVK + ++K+      E V+RE+KIL+
Sbjct: 13  ESFLRNYKLGKTLGIGSFGKVKIAEHTLTGHKVAVKILNRRKIKNMEMEEKVRREIKILR 72



>gb:AC105320_1737944 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1675_H07, complete
           sequence.>gb:AC117264_1739386 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OJ1005_D04, complete
           sequence.
          Length = 457

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 21/56 (37%), Positives = 32/56 (57%)
 Frame = +3

Query: 585 KRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +RY IGKLLG G F   Y   +      VA+K I+K K+     ++ +KRE+ ++K
Sbjct: 13  RRYEIGKLLGQGTFAKVYHGRNIVTSQSVAIKVIDKDKIFKVGLMDQIKREISVMK 68



>gb:AC104280_1737459 Oryza sativa (japonica cultivar-group)
           chromosome 5 clone OJ1430_B02, complete sequence.
          Length = 466

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 2/57 (3%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMA--VEDVKREVKILK 752
           RY +G+ LGHG F   Y A     G+ VAVK I+K+K L   A  V+ ++REV +++
Sbjct: 11  RYELGRSLGHGTFSKVYQARSLVSGETVAVKVIDKEKALRAGAGMVDQIEREVAVMR 67



>gb:STU83797_1723160 Solanum tuberosum StubSNF1 protein (SNF1) mRNA,
           complete cds.
          Length = 514

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 23/58 (39%), Positives = 34/58 (58%)
 Frame = +3

Query: 579 FDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           F + Y +GK LG G FG   +A    +G +VAVK + ++K+      E V RE+KIL+
Sbjct: 15  FLRNYKLGKTLGIGSFGKVKIAEHTLIGHKVAVKILNRRKIRNMDMEEKVSREIKILR 72



>gb:AY462018_1607502 Nicotiana attenuata SNF1-related protein kinase
           alpha subunit mRNA, complete cds.
          Length = 512

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 23/60 (38%), Positives = 35/60 (58%)
 Frame = +3

Query: 573 KDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           + F + Y +GK LG G FG   +A     G +VAVK + ++K+      E V+RE+KIL+
Sbjct: 13  ESFLRNYKLGKTLGIGSFGKVKIAEHTLTGHKVAVKILNRRKIKNMDMEEKVRREIKILR 72



>gb:AY094414_1575716 Arabidopsis thaliana AT5g07070/T28J14_10 mRNA,
           complete cds.>gb:AY124002_1580079 Arabidopsis thaliana
           AT5g07070/T28J14_10 mRNA, complete
           cds.>gb:AY125530_1580335 Arabidopsis thaliana
           AT5g07070/T28J14_10 mRNA, complete
           cds.>gb:AF295665_1783964 Arabidopsis thaliana
           CBL-interacting protein kinase 10 (CIPK10) mRNA,
           complete cds.>gb:AF339143_1787713 Arabidopsis thaliana
           SOS2-like protein kinase PKS2 mRNA, complete cds.
          Length = 479

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 18/55 (32%), Positives = 32/55 (58%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +Y +G+LLG G F   Y          VA+K I+K+K++    +E +KRE+ +++
Sbjct: 11  KYDVGRLLGQGTFAKVYYGRSILTNQSVAIKMIDKEKVMKVGLIEQIKREISVMR 65



>gb:AB019228_1514112 Arabidopsis thaliana genomic DNA, chromosome 5,
           P1 clone:MCK7.
          Length = 464

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 18/55 (32%), Positives = 32/55 (58%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +Y +G+LLG G F   Y          VA+K I+K+K++    +E +KRE+ +++
Sbjct: 11  KYDVGRLLGQGTFAKVYYGRSILTNQSVAIKMIDKEKVMKVGLIEQIKREISVMR 65



>pir|T48478|T48478 serine/threonine protein kinase-like protein -
           Arabidopsis thaliana>gb:AB010697_1511209 Arabidopsis
           thaliana genomic DNA, chromosome 5, P1
           clone:MOJ9.>gb:ATT28J14_1555588 Arabidopsis thaliana DNA
           chromosome 5, BAC clone T28J14 (ESSA project).
          Length = 456

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 18/56 (32%), Positives = 32/56 (57%)
 Frame = +3

Query: 585 KRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +RY +G+LLG G F   Y        + VA+K I+K K++     + +KRE+ +++
Sbjct: 10  ERYEVGRLLGQGTFAKVYFGRSNHTNESVAIKMIDKDKVMRVGLSQQIKREISVMR 65



>pir|T14736|T14736 probable serine/threonine kinase (EC 2.7.1.-)
           SNFL2 - sorghum>gb:SBPPSTK2_1704888 S.bicolor mRNA for
           putative protein serine/threonine kinase, clone cSNFL2.
          Length = 440

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 19/57 (33%), Positives = 34/57 (59%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
           +Y +G+ +G G F     A +   G+ VA+K ++K+K+L    VE +KRE+  +K +
Sbjct: 12  KYELGRTIGEGTFAKVRFAKNTETGEPVAIKILDKEKVLRHKMVEQIKREISTMKLI 68



>pir|T14822|T14822 probable serine/threonine protein kinase (EC
           2.7.1.-) SNFL3 - sorghum>gb:SBY14274_1704952 Sorghum
           bicolor mRNA for SNFL3, putative serine/threonine
           protein kinase.
          Length = 461

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 21/55 (38%), Positives = 32/55 (58%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           RY IG+ LG G F   Y A + + G  VA+K I+K K+     +  +KRE+ I++
Sbjct: 11  RYEIGRQLGQGNFAKVYFARNLTDGQSVAIKMIDKDKITRVGLIVQIKREISIMR 65



>pir|T07788|T07788 probable serine/threonine-specific protein kinase
           (EC 2.7.1.-) SNF1 - potato
          Length = 512

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 23/58 (39%), Positives = 34/58 (58%)
 Frame = +3

Query: 579 FDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           F + Y +GK LG G FG   +A    +G +VAVK + ++K+      E V RE+KIL+
Sbjct: 15  FLRNYKLGKTLGIGSFGKVKIAEHTLIGHKVAVKILNRRKIRNMDMEEKVSREIKILR 72



>gb:AF286050_1783185 Arabidopsis thaliana CBL-interacting protein
           kinase 2 (CIPK2) mRNA, complete cds.
          Length = 456

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 18/56 (32%), Positives = 32/56 (57%)
 Frame = +3

Query: 585 KRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +RY +G+LLG G F   Y        + VA+K I+K K++     + +KRE+ +++
Sbjct: 10  ERYEVGRLLGQGTFAKVYSGRSNHTNESVAIKMIDKDKVMRVGLSQQIKREISVMR 65



>gb:AF143743_1771824 Lycopersicon esculentum SNF1 (SNF1) mRNA,
           complete cds.
          Length = 514

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 23/58 (39%), Positives = 34/58 (58%)
 Frame = +3

Query: 579 FDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           F + Y +GK LG G FG   +A     G +VAVK + ++K+      E V+RE+KIL+
Sbjct: 15  FLRNYKLGKTLGIGSFGKVKIAEHTLTGHKVAVKILNRRKIRNMDMEEKVRREIKILR 72



>gb:AY035226_1559968 Arabidopsis thaliana CBL-interacting protein
           kinase 23 (CIPK23) mRNA, complete
           cds.>gb:AY056419_1563727 Arabidopsis thaliana
           At1g30270/F12P21_6 mRNA, complete
           cds.>gb:AY090322_1574074 Arabidopsis thaliana
           At1g30270/F12P21_6 mRNA, complete cds.
          Length = 482

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 20/57 (35%), Positives = 33/57 (57%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
           +Y +G+ LG G F     A +   GD VA+K I+K+K+L    +  +KRE+  +K +
Sbjct: 30  KYELGRTLGEGTFAKVKFARNVENGDNVAIKVIDKEKVLKNKMIAQIKREISTMKLI 86



>gb:AB101655_1526322 Oryza sativa (japonica cultivar-group) OSK1
           gene for SnRK1a protein kinase, complete
           cds.>gb:D82039_1674802 Oryza sativa mRNA for OSK1,
           complete cds.>gb:AC111015_1738813 Oryza sativa (japonica
           cultivar-group) chromosome 5 clone OJ1131_E09, complete
           sequence.
          Length = 505

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 23/54 (42%), Positives = 32/54 (59%)
 Frame = +3

Query: 591 YTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           Y IGK LG G FG   +A     G +VA+K + ++K+      E VKRE+KIL+
Sbjct: 14  YRIGKTLGIGSFGKVKIAEHILTGHKVAIKILNRRKIKSMEMEEKVKREIKILR 67



>pir|A86427|A86427 probable serine/threonine kinase [imported] -
           Arabidopsis thaliana>gb:AE005172_891873 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC073506_1541076 Arabidopsis thaliana
           chromosome 1 BAC F12P21 genomic sequence, complete
           sequence.
          Length = 480

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 20/57 (35%), Positives = 33/57 (57%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILKAL 758
           +Y +G+ LG G F     A +   GD VA+K I+K+K+L    +  +KRE+  +K +
Sbjct: 30  KYELGRTLGEGTFAKVKFARNVENGDNVAIKVIDKEKVLKNKMIAQIKREISTMKLI 86



>gb:AF525402_1808309 Glycine max SOS2-like protein kinase mRNA,
           complete cds.
          Length = 438

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 20/54 (37%), Positives = 32/54 (59%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKIL 749
           +Y +G+LLGHG F   Y A     G  VA+K + K+K++    +E +KRE+  +
Sbjct: 20  KYELGRLLGHGTFAKVYHARHLKTGKSVAMKVVGKEKVVKVGMMEQIKREISAM 73



>gb:AY486125_1608545 Zea mays SNF1-related protein kinase mRNA,
           complete cds.
          Length = 509

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 24/56 (42%), Positives = 31/56 (55%)
 Frame = +3

Query: 585 KRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           + Y +G+ LG G FG   +A  K  G RVA+K I  ++M      E  KRE KILK
Sbjct: 15  RNYNLGRTLGIGTFGKVKIAEHKLTGHRVAIKIINCRQMRNMEMEEKAKREFKILK 70



>gb:AB011670_1511574 Triticum aestivum mRNA for wpk4 protein kinase,
           complete cds.
          Length = 526

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 24/81 (29%), Positives = 40/81 (49%)
 Frame = +3

Query: 510 PSHRSQTVVIPCGKRTDFGYDKDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIE 689
           PS  S +      K+   G       RY +G++LG G F   Y A     G+ VA+K ++
Sbjct: 19  PSPSSSSSAAAAAKQGGTGSRGLLMGRYELGRVLGKGTFAKVYHARHVQTGESVAIKVLD 78

Query: 690 KKKMLLPMAVEDVKREVKILK 752
           ++K +    V  +KRE+ +L+
Sbjct: 79  REKAVRSGLVSHIKREIAVLR 99



>pir|A53467|A53467 protein kinase SNF1 homolog wpk4-p58 - wheat
          Length = 527

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 24/81 (29%), Positives = 40/81 (49%)
 Frame = +3

Query: 510 PSHRSQTVVIPCGKRTDFGYDKDFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIE 689
           PS  S +      K+   G       RY +G++LG G F   Y A     G+ VA+K ++
Sbjct: 19  PSPSSSSSAAAAAKQGGTGSRGLLMGRYELGRVLGKGTFAKVYHARHVQTGESVAIKVLD 78

Query: 690 KKKMLLPMAVEDVKREVKILK 752
           ++K +    V  +KRE+ +L+
Sbjct: 79  REKAVRSGLVSHIKREIAVLR 99



>pir|T38052|T38052 probable protein kinase - fission yeast
           (Schizosaccharomyces pombe)
          Length = 690

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 32/102 (31%), Positives = 43/102 (42%), Gaps = 5/102 (4%)
 Frame = +3

Query: 390 PTAKPRSDTTATSAQDEERSRCNRRKAKEPCEKYKNLNVKPSHRSQTVVIPCGKRTDFGY 569
           P +      T  S  D    +  +R A  P +K   +NV   H + T   P     D G+
Sbjct: 291 PASNANQVITPVSISDYRPPKKRKRAAWPPYKKVDRVNVPVVHDT-TAFDPSTFDDDDGH 349

Query: 570 DK-----DFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVK 680
            K      F  RYT+ +LLGHG FG      D+S G   A+K
Sbjct: 350 YKVVPNSKFANRYTVVRLLGHGTFGKVIQCYDQSTGRHCAIK 391



>pir|S60304|S60304 serine/threonine-specific protein kinase (EC
           2.7.1.-) BKIN12 (version 2) - barley
          Length = 513

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 23/56 (41%), Positives = 31/56 (55%)
 Frame = +3

Query: 585 KRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           K Y +GK LG G FG   VA     G RVA+K + ++KM      E   RE+KI++
Sbjct: 15  KNYNLGKTLGLGTFGDVKVAERNVTGQRVAIKILNRRKMETMEMEEKGNREIKIMR 70



>sp|Q10156|LKH1_SCHPO Protein kinase lkh1 (EC 2.7.1.37) (EC
           2.7.1.112).>pir|JC7794|JC7794 lammer kinase homolog
           protein 1, Lkh1 protein - fission yeast
           (Schizosaccharomyces pombe)>gb:SPAC1D4_1716997 S.pombe
           chromosome I cosmid c1D4.>gb:AF334941_1787493
           Schizosaccharomyces pombe LAMMER kinase-like protein
           mRNA, complete cds.
          Length = 575

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 32/102 (31%), Positives = 43/102 (42%), Gaps = 5/102 (4%)
 Frame = +3

Query: 390 PTAKPRSDTTATSAQDEERSRCNRRKAKEPCEKYKNLNVKPSHRSQTVVIPCGKRTDFGY 569
           P +      T  S  D    +  +R A  P +K   +NV   H + T   P     D G+
Sbjct: 176 PASNANQVITPVSISDYRPPKKRKRAAWPPYKKVDRVNVPVVHDT-TAFDPSTFDDDDGH 234

Query: 570 DK-----DFDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVK 680
            K      F  RYT+ +LLGHG FG      D+S G   A+K
Sbjct: 235 YKVVPNSKFANRYTVVRLLGHGTFGKVIQCYDQSTGRHCAIK 276



>gb:BC075737_2558702 Danio rerio pim-1 oncogene, mRNA (cDNA clone
           MGC:86564 IMAGE:6902124), complete cds.
          Length = 310

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 24/66 (36%), Positives = 38/66 (57%), Gaps = 4/66 (6%)
 Frame = +3

Query: 579 FDKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKM----LLPMAVEDVKREVKI 746
           F+K+YT+G LLG G FG  Y     S   +VA+K+I + ++     +P  V  V  E+ +
Sbjct: 26  FEKQYTMGNLLGSGGFGSVYSGHRISDRQKVAIKQISRDRIQQWSKMPGEVNPVPNEIAL 85

Query: 747 LKALTG 764
           L++L G
Sbjct: 86  LQSLGG 91



>gb:F6I13_1678488 Arabidopsis thaliana BAC F6I13.
          Length = 400

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 19/55 (34%), Positives = 31/55 (56%)
 Frame = +3

Query: 588 RYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIEKKKMLLPMAVEDVKREVKILK 752
           +Y +G+ +G G F     A +   GD VA+K + K  +L    V+ +KRE+ I+K
Sbjct: 10  KYEVGRTIGEGTFAKVKFARNTDTGDNVAIKIMAKSTILKNRMVDQIKREISIMK 64



>gb:ENU59214_1676798 Emericella nidulans MAP protein kinase MPKA
           (mpkA) gene, complete cds.
          Length = 418

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 27/78 (34%), Positives = 44/78 (56%), Gaps = 5/78 (6%)
 Frame = +3

Query: 546 GKRTDFGYDKDF--DKRYTIGKLLGHGQFGYTYVATDKSVGDRVAVKRIE---KKKMLLP 710
           G++    +++DF  D RYT+ K LG G +G    AT+   G+ VA+K++     KK+L  
Sbjct: 8   GRKVFKVFNQDFIVDDRYTVTKELGQGAYGIVCAATNVQTGEGVAIKKVTNVFSKKILAK 67

Query: 711 MAVEDVKREVKILKALTG 764
            A+    RE+K+L+   G
Sbjct: 68  RAL----REIKLLQHFRG 81


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 794,972,209
Number of Sequences: 1806583
Number of extensions: 16272839
Number of successful extensions: 47022
Number of sequences better than 10.0: 500
Number of HSP's better than 10.0 without gapping: 45393
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 46960
length of database: 581,917,975
effective HSP length: 122
effective length of database: 361,514,849
effective search space used: 47719960068
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)