BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTX 2.2.10 [Oct-19-2004]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Contig4345
         (724 letters)

Database: nr-aa:  Non-redundant protein sequence database Release
05-06-11 
           1,806,583 sequences; 581,917,975 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gb:AY059387_1564535 Olea europaea putative cullin protein mRNA, ...   238   1e-61   
gb:AY084267_1569359 Arabidopsis thaliana clone 101723 mRNA, comp...   196   5e-49   
gb:AY091113_1574337 Arabidopsis thaliana putative cullin (At5g46...   194   1e-48   
gb:AC084296_1733453 Oryza sativa chromosome 3 BAC OSJNBb0024J04 ...   186   5e-46   
gb:ATH318018_1552493 Arabidopsis thaliana mRNA for cullin 4 (cul...   182   7e-45   
gb:AB093259_2048044 Mus musculus mRNA for mKIAA0695 protein.          101   1e-20   
gb:AK032701_1163036 Mus musculus 12 days embryo male wolffian du...   101   1e-20   
gb:AK012410_1156942 Mus musculus 11 days embryo whole body cDNA,...   101   1e-20   
gb:AB071052_1871117 Macaca fascicularis testis cDNA clone:QtsA-1...   100   4e-20   
gb:HSM805877_2018085 Homo sapiens mRNA; cDNA DKFZp779P1063 (from...    99   6e-20   
gb:BC036216_1981869 Homo sapiens cullin 4B, mRNA (cDNA clone MGC...    99   6e-20   
gb:AY365125_1948082 Homo sapiens cullin 4B (CUL4B) mRNA, complet...    99   6e-20   
gb:AL451005_1928094 Human DNA sequence from clone RP11-92B10 on ...    99   6e-20   
gb:AB014595_1864624 Homo sapiens mRNA for KIAA0695 protein, part...    99   6e-20   
sp|Q13620|CU4B_HUMAN|CU4B_HUMAN Cullin homolog 4B (CUL-4B).                       99   6e-20   Homo sapiens [man]
gb:AF212995_1890266 Homo sapiens cullin CUL4B (CUL4B) mRNA, comp...    98   1e-19   
gb:AY365124_1948081 Homo sapiens cullin 4A (CUL4A) mRNA, complet...    97   3e-19   
gb:AE013599_1130587 Drosophila melanogaster chromosome 2R, compl...    94   2e-18   
gb:BC054607_2551017 Danio rerio cullin 4A, mRNA (cDNA clone MGC:...    92   1e-17   
pir|T12957|T12957 hypothetical protein T6H20.60 - Arabidopsis th...    73   6e-12   Arabidopsis thaliana [mouse-ear cress]
gb:BT007619_2150551 Synthetic construct Homo sapiens cullin 4A m...    60   4e-08   
sp|Q13619|CU4A_HUMAN|CU4A_HUMAN Cullin homolog 4A (CUL-4A).>gb:AF077188_188...    60   4e-08   Homo sapiens [man]
gb:AP004114_1837795 Oryza sativa (japonica cultivar-group) genom...    58   2e-07   
gb:AX886583_1482036 Sequence 2446 from Patent EP1033401.               58   2e-07   
gb:CEU58085_1368583 Caenorhabditis elegans cul-3 mRNA, complete ...    57   3e-07   
sp|Q17391|CUL3_CAEEL|CUL3_CAEEL Cullin 3.>gb:AC024744_1204336 Caenorhabditi...    57   3e-07   Caenorhabditis elegans [roundworm]
gb:OSJN00009_1693194 Oryza sativa genomic DNA, chromosome 4, BAC...    56   6e-07   
pir|E96718|E96718 probable cullin T6C23.13 [imported] - Arabidop...    56   6e-07   Arabidopsis thaliana [mouse-ear cress]
gb:AP005501_1852965 Oryza sativa (japonica cultivar-group) genom...    55   1e-06   
gb:AE014134_1129264 Drosophila melanogaster chromosome 2L, compl...    55   1e-06   
gb:AY223095_1176559 Schistosoma japonicum clone ZZD1344 mRNA seq...    55   2e-06   
gb:BC065357_2553975 Danio rerio cullin 3, mRNA (cDNA clone MGC:7...    54   3e-06   
gb:AY423034_2532120 Danio rerio cullin 3 (CUL3) mRNA, complete cds.    54   3e-06   
gb:BC077239_2559956 Xenopus laevis cullin 3, mRNA (cDNA clone MG...    52   1e-05   
gb:BC073186_2557041 Xenopus laevis MGC80402 protein, mRNA (cDNA ...    52   1e-05   
gb:AK129174_2069405 Mus musculus mRNA for mKIAA0617 protein.           52   1e-05   
gb:AF062537_1880198 Homo sapiens cullin 3 mRNA, complete cds.          52   1e-05   
gb:AB014517_1864546 Homo sapiens mRNA for KIAA0617 protein, part...    52   1e-05   
sp|Q9JLV5|CUL3_MOUSE|CUL3_MOUSE Cullin homolog 3 (CUL-3).>gb:AF129738_20556...    52   1e-05   Mus musculus [mouse]
sp|Q13618|CUL3_HUMAN|CUL3_HUMAN Cullin homolog 3 (CUL-3).>gb:AF064087_18803...    52   1e-05   Homo sapiens [man]
pir|A86395|A86395 hypothetical protein T2P11.2 [imported] - Arab...    51   2e-05   Arabidopsis thaliana [mouse-ear cress]
gb:AY337761_1944151 Homo sapiens cullin 3 isoform (CUL3) mRNA, c...    50   4e-05   
gb:AF159296_1773220 Lycopersicon esculentum pollen extensin-like...    22   4e-05   
sp|P53202|CUL3_YEAST|CUL3_YEAST Cullin B.>pir|S64292|S64292 hypothetical pr...    48   2e-04   Saccharomyces cerevisiae [brewer's yeast]
gb:AP000735_1820573 Arabidopsis thaliana genomic DNA, chromosome...    25   0.002   
gb:CR382123_1656277 Kluyveromyces lactis strain NRRL Y-1140 chro...    44   0.002   
pir|T06617|T06617 hypothetical protein F16J13.170 - Arabidopsis ...    44   0.004   Arabidopsis thaliana [mouse-ear cress]
gb:CR382128_1660486 Yarrowia lipolytica chromosome B of strain C...    41   0.025   
pir|C84534|C84534 hypothetical protein At2g15880 [imported] - Ar...    22   0.062   Arabidopsis thaliana [mouse-ear cress]
gb:BX842631_1643970 Neurospora crassa DNA linkage group I BAC co...    39   0.072   
gb:CR382135_1668247 Debaryomyces hansenii chromosome C of strain...    39   0.094   
gb:CR380952_1650594 Candida glabrata strain CBS138 chromosome F ...    39   0.094   
gb:AE017351_1759586 Cryptococcus neoformans var. neoformans JEC2...    39   0.12    
pir|S62405|S62405 hypothetical protein SPAC24H6.03 - fission yea...    38   0.21    Schizosaccharomyces pombe
sp|Q09760|CUL3_SCHPO|CUL3_SCHPO Cullin 3 homolog (Cul-3).>pir|T38359|T38359...    38   0.21    Schizosaccharomyces pombe
gb:H0423H10_1681323 Oryza sativa genomic DNA, chromosome 4, BAC ...    37   0.36    
gb:SCMSP8_1708794 S.cerevisiae MSP8 gene.                              36   0.61    
gb:SCCAT8_1706623 S.cerevisiae CAT8 gene.                              36   0.61    
gb:AE017180_400227 Geobacter sulfurreducens PCA, complete genome.      36   0.61    
sp|P39113|CAT8_YEAST|CAT8_YEAST Regulatory protein CAT8.>pir|S54587|S54587 ...    36   0.61    Saccharomyces cerevisiae [brewer's yeast]
gb:AF480884_2263919 Chimpanzee cytomegalovirus, complete genome.       34   3.0     
pir|B71005|B71005 hypothetical protein PH1336 - Pyrococcus horik...    34   3.0     Pyrococcus horikoshii
gb:AY548172_2086459 Mus musculus retinoic acid induced 1 (Rai1) ...    33   4.0     
gb:AL669954_2072613 Mouse DNA sequence from clone RP23-456O18 on...    33   4.0     
gb:AL669954_2072612 Mouse DNA sequence from clone RP23-456O18 on...    33   4.0     
gb:AK129449_2069680 Mus musculus mRNA for mKIAA1820 protein.           33   4.0     
pir|T30250|T30250 GT1 protein - mouse>gb:MUSMA_2128827 Mouse mRN...    33   4.0     Mus musculus [mouse]
gb:OSJN00250_1697382 Oryza sativa genomic DNA, chromosome 4, BAC...    33   5.2     
pir|T05225|T05225 extensin homolog F17I5.160 - Arabidopsis thali...    21   5.9     Arabidopsis thaliana [mouse-ear cress]
gb:HSU58087_2025035 Human Hs-cul-1 mRNA, complete cds.                 33   6.8     
gb:AE017346_1757442 Cryptococcus neoformans var. neoformans JEC2...    33   6.8     
gb:CR382131_1663887 Yarrowia lipolytica chromosome E of strain C...    33   6.8     
gb:BC041733_2548018 Xenopus laevis SH2 domain containing 3C, mRN...    32   8.8     
gb:MMU89891_2123947 Mus musculus metabotropic glutamate receptor...    32   8.8     
gb:AE017333_448198 Bacillus licheniformis DSM 13, complete genom...    32   8.8     
sp|P97772|MGR1_MOUSE|MGR1_MOUSE Metabotropic glutamate receptor 1 precursor...    32   8.8     Mus musculus [mouse]
sp|P17555|CAP_YEAST|CAP_YEAST Adenylyl cyclase-associated protein (CAP).>p...    32   8.8     Saccharomyces cerevisiae [brewer's yeast]
gb:TOMHRGP_1725658 Tomato cell wall HRGP (hydroxproline-rich gly...    22   9.2     
pir|A25494|A25494 hydroxyproline-rich glycoprotein - tomato (fra...    22   9.2     Solanum lycopersicum
gb:A64435_1450176 Sequence 10 from Patent WO9728247.                   21   9.2     
gb:MZEZEG_1688084 Maize gamma zein mRNA, partial cds.                  21   9.6     


>gb:AY059387_1564535 Olea europaea putative cullin protein mRNA,
           complete cds.
          Length = 816

 Score =  238 bits (606), Expect = 1e-61
 Identities = 133/204 (65%), Positives = 148/204 (72%), Gaps = 14/204 (6%)
 Frame = +3

Query: 153 PPMKKAKSQAVACSLDTNKNGQH---HVHFYPD-----VDEDPSSASMEDLDSPGA---- 296
           P MKKAKSQA+A SLD NKNGQ    HVHF P      +DED +   ++   S  +    
Sbjct: 15  PRMKKAKSQALAYSLD-NKNGQQSVPHVHFDPSANSSMIDEDSNDVVLDASASSNSFGRV 73

Query: 297 -SATRAATANLSRKKATLPQXXXXXXXXXXXXXXTLPTNFEENTWATLKSAINAIFLKQP 473
                  TANL+RKKAT PQ               LPT+FEENTWATLKSAI AIFLKQP
Sbjct: 74  VGGGGGVTANLARKKATPPQPAKKLVIKLVKAKPMLPTDFEENTWATLKSAIIAIFLKQP 133

Query: 474 DPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSL-VEK 650
           DPCDLEKLYQAVNDLCLHKMGGSLY+RIEKECE++I+ ALQSLVGQS+DLVVFLSL  +K
Sbjct: 134 DPCDLEKLYQAVNDLCLHKMGGSLYRRIEKECESYISAALQSLVGQSQDLVVFLSLGQKK 193

Query: 651 CWQDFCDQILTIRGIALYLDRTYV 722
           CWQDFCDQ+L I GIALYLDRTYV
Sbjct: 194 CWQDFCDQMLMIPGIALYLDRTYV 217



>gb:AY084267_1569359 Arabidopsis thaliana clone 101723 mRNA,
           complete sequence.
          Length = 792

 Score =  196 bits (497), Expect = 5e-49
 Identities = 115/217 (52%), Positives = 134/217 (61%)
 Frame = +3

Query: 72  SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDE 251
           S P KRS+ +S+ SA+        +  PPMKKAK            N  HH   +P+  +
Sbjct: 2   SLPTKRST-FSAASASDDSS----YSSPPMKKAK------------NDLHHSPQHPNTAD 44

Query: 252 DPSSASMEDLDSPGASATRAATANLSRKKATLPQXXXXXXXXXXXXXXTLPTNFEENTWA 431
                 ME+  +P A       ANLSRKKATLPQ              TLPTNFEENTW 
Sbjct: 45  KVVGFHMEEDPTPAA-------ANLSRKKATLPQPTKKFVIKLNKAKPTLPTNFEENTWE 97

Query: 432 TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQ 611
            L+SAI AIFLK+    DLE LYQAV++LCLHK+ G LY +IEKECE HI+ ALQSLVGQ
Sbjct: 98  KLQSAIRAIFLKKKISFDLESLYQAVDNLCLHKLDGKLYDQIEKECEEHISAALQSLVGQ 157

Query: 612 SEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           + DL VFLS VEKCWQDFCDQ+L IR IAL LDR YV
Sbjct: 158 NTDLTVFLSRVEKCWQDFCDQMLMIRSIALTLDRKYV 194



>gb:AY091113_1574337 Arabidopsis thaliana putative cullin
           (At5g46210) mRNA, complete cds.
          Length = 792

 Score =  194 bits (493), Expect = 1e-48
 Identities = 114/217 (52%), Positives = 133/217 (61%)
 Frame = +3

Query: 72  SNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDE 251
           S P KRS+ +S+ SA+        +  PPMKK K            N  HH   +P+  +
Sbjct: 2   SLPTKRST-FSAASASDDSS----YSSPPMKKTK------------NDLHHSPQHPNTAD 44

Query: 252 DPSSASMEDLDSPGASATRAATANLSRKKATLPQXXXXXXXXXXXXXXTLPTNFEENTWA 431
                 ME+  +P A       ANLSRKKATLPQ              TLPTNFEENTW 
Sbjct: 45  KVVGFHMEEDPTPAA-------ANLSRKKATLPQPTKKFVIKLNKAKPTLPTNFEENTWE 97

Query: 432 TLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQ 611
            L+SAI AIFLK+    DLE LYQAV++LCLHK+ G LY +IEKECE HI+ ALQSLVGQ
Sbjct: 98  KLQSAIRAIFLKKKISFDLESLYQAVDNLCLHKLDGKLYDQIEKECEEHISAALQSLVGQ 157

Query: 612 SEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           + DL VFLS VEKCWQDFCDQ+L IR IAL LDR YV
Sbjct: 158 NTDLTVFLSRVEKCWQDFCDQMLMIRSIALTLDRKYV 194



>gb:AC084296_1733453 Oryza sativa chromosome 3 BAC OSJNBb0024J04
           genomic sequence, complete sequence.
          Length = 813

 Score =  186 bits (471), Expect = 5e-46
 Identities = 108/206 (52%), Positives = 125/206 (60%), Gaps = 18/206 (8%)
 Frame = +3

Query: 159 MKKAK-------SQAVACSLDTNKNGQH----------HVHFYPDVDEDPSSASMEDLDS 287
           MKKAK       S + A    T KNG H                + D +   A  E+L +
Sbjct: 1   MKKAKFPGSSSSSSSAAAPGVTEKNGLHVDPTAAAARTGGRTNGEEDAEMVLADQEELAA 60

Query: 288 PGASATRAATANLSRKKATLPQXXXXXXXXXXXXXXT-LPTNFEENTWATLKSAINAIFL 464
           P ASA     ANL RKKATLPQ                LPTNFEE+TWA LK AI AIFL
Sbjct: 61  PSASAPAGVAANLFRKKATLPQPSAARKPLRIKIGQPKLPTNFEEDTWAILKDAITAIFL 120

Query: 465 KQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLV 644
           KQ   CD+EKLYQA  DLCLHK+G +LY+RI+KECE HI+  + +LVGQS DLVVFLSLV
Sbjct: 121 KQKLSCDVEKLYQAAGDLCLHKLGANLYERIKKECEVHISAKISALVGQSPDLVVFLSLV 180

Query: 645 EKCWQDFCDQILTIRGIALYLDRTYV 722
           ++ WQDFCDQ+L IRGIAL LD  YV
Sbjct: 181 QRTWQDFCDQMLIIRGIALLLDVKYV 206



>gb:ATH318018_1552493 Arabidopsis thaliana mRNA for cullin 4 (cul4
           gene).
          Length = 742

 Score =  182 bits (461), Expect = 7e-45
 Identities = 93/137 (67%), Positives = 102/137 (74%)
 Frame = +3

Query: 312 ATANLSRKKATLPQXXXXXXXXXXXXXXTLPTNFEENTWATLKSAINAIFLKQPDPCDLE 491
           A ANLSRKKATLPQ              TLPTNFEENTW  L+SAI AIFLK+    DLE
Sbjct: 8   AAANLSRKKATLPQPTKKFVIKLNKAKPTLPTNFEENTWEKLQSAIRAIFLKKKISFDLE 67

Query: 492 KLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCD 671
            LYQAV++LCLHK+ G LY +IEKECE HI+ ALQSLVGQ+ DL VFLS VEKCWQDFCD
Sbjct: 68  SLYQAVDNLCLHKLDGKLYDQIEKECEEHISAALQSLVGQNTDLTVFLSRVEKCWQDFCD 127

Query: 672 QILTIRGIALYLDRTYV 722
           Q+L IR IAL LDR YV
Sbjct: 128 QMLMIRSIALTLDRKYV 144



>gb:AB093259_2048044 Mus musculus mRNA for mKIAA0695 protein.
          Length = 737

 Score =  101 bits (252), Expect = 1e-20
 Identities = 47/108 (43%), Positives = 68/108 (62%)
 Frame = +3

Query: 399 LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH 578
           LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+  +LY+++ + CE H
Sbjct: 61  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISANLYKQLRQICEDH 120

Query: 579 IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           I   +      S D V+FL  +++CWQ+ C Q++ IR I L+LDRTYV
Sbjct: 121 IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYV 168



>gb:AK032701_1163036 Mus musculus 12 days embryo male wolffian duct
           includes surrounding region cDNA, RIKEN full-length
           enriched library, clone:6720405B21 product:cullin 4B,
           full insert sequence.>gb:AY330868_2083636 Mus musculus
           cullin 4B mRNA, complete cds.
          Length = 970

 Score =  101 bits (252), Expect = 1e-20
 Identities = 47/108 (43%), Positives = 68/108 (62%)
 Frame = +3

Query: 399 LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH 578
           LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+  +LY+++ + CE H
Sbjct: 265 LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISANLYKQLRQICEDH 324

Query: 579 IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           I   +      S D V+FL  +++CWQ+ C Q++ IR I L+LDRTYV
Sbjct: 325 IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYV 372



>gb:AK012410_1156942 Mus musculus 11 days embryo whole body cDNA,
           RIKEN full-length enriched library, clone:2700050M05
           product:cullin 4B, full insert sequence.
          Length = 915

 Score =  101 bits (252), Expect = 1e-20
 Identities = 47/108 (43%), Positives = 68/108 (62%)
 Frame = +3

Query: 399 LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH 578
           LP N+ + TW  LK A+ AI        +LE+LYQAV +LC HK+  +LY+++ + CE H
Sbjct: 210 LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSHKISANLYKQLRQICEDH 269

Query: 579 IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           I   +      S D V+FL  +++CWQ+ C Q++ IR I L+LDRTYV
Sbjct: 270 IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYV 317



>gb:AB071052_1871117 Macaca fascicularis testis cDNA
           clone:QtsA-14268, full insert sequence.
          Length = 324

 Score = 99.8 bits (247), Expect = 4e-20
 Identities = 46/108 (42%), Positives = 68/108 (62%)
 Frame = +3

Query: 399 LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH 578
           LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct: 208 LPENYTDETWQKLKEAVEAIQNSSSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH 267

Query: 579 IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           I   +      S D V+FL  +++CWQ+ C Q++ IR I L+LDRTYV
Sbjct: 268 IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYV 315



>gb:HSM805877_2018085 Homo sapiens mRNA; cDNA DKFZp779P1063 (from
           clone DKFZp779P1063); complete cds.
          Length = 895

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 46/108 (42%), Positives = 68/108 (62%)
 Frame = +3

Query: 399 LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH 578
           LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct: 190 LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH 249

Query: 579 IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           I   +      S D V+FL  +++CWQ+ C Q++ IR I L+LDRTYV
Sbjct: 250 IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYV 297



>gb:BC036216_1981869 Homo sapiens cullin 4B, mRNA (cDNA clone
           MGC:39677 IMAGE:5269392), complete cds.
          Length = 913

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 46/108 (42%), Positives = 68/108 (62%)
 Frame = +3

Query: 399 LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH 578
           LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct: 208 LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH 267

Query: 579 IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           I   +      S D V+FL  +++CWQ+ C Q++ IR I L+LDRTYV
Sbjct: 268 IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYV 315



>gb:AY365125_1948082 Homo sapiens cullin 4B (CUL4B) mRNA, complete
           cds.
          Length = 895

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 46/108 (42%), Positives = 68/108 (62%)
 Frame = +3

Query: 399 LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH 578
           LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct: 190 LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH 249

Query: 579 IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           I   +      S D V+FL  +++CWQ+ C Q++ IR I L+LDRTYV
Sbjct: 250 IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYV 297



>gb:AL451005_1928094 Human DNA sequence from clone RP11-92B10 on
           chromosome X Contains the 5' end of a variant of the
           CUL4B gene for cullin 4B and the 5' end of a variant of
           the gene for MCT-1 protein (MCT-1), complete sequence.
          Length = 913

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 46/108 (42%), Positives = 68/108 (62%)
 Frame = +3

Query: 399 LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH 578
           LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct: 208 LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH 267

Query: 579 IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           I   +      S D V+FL  +++CWQ+ C Q++ IR I L+LDRTYV
Sbjct: 268 IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYV 315



>gb:AB014595_1864624 Homo sapiens mRNA for KIAA0695 protein, partial
           cds.
          Length = 781

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 46/108 (42%), Positives = 68/108 (62%)
 Frame = +3

Query: 399 LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH 578
           LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct: 76  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH 135

Query: 579 IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           I   +      S D V+FL  +++CWQ+ C Q++ IR I L+LDRTYV
Sbjct: 136 IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYV 183



>sp|Q13620|CU4B_HUMAN Cullin homolog 4B (CUL-4B).
          Length = 717

 Score = 99.4 bits (246), Expect = 6e-20
 Identities = 46/108 (42%), Positives = 68/108 (62%)
 Frame = +3

Query: 399 LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH 578
           LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct: 12  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH 71

Query: 579 IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           I   +      S D V+FL  +++CWQ+ C Q++ IR I L+LDRTYV
Sbjct: 72  IKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYV 119



>gb:AF212995_1890266 Homo sapiens cullin CUL4B (CUL4B) mRNA,
           complete cds.
          Length = 782

 Score = 98.2 bits (243), Expect = 1e-19
 Identities = 45/108 (41%), Positives = 68/108 (62%)
 Frame = +3

Query: 399 LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH 578
           LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct: 75  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH 134

Query: 579 IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           +   +      S D V+FL  +++CWQ+ C Q++ IR I L+LDRTYV
Sbjct: 135 MKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYV 182



>gb:AY365124_1948081 Homo sapiens cullin 4A (CUL4A) mRNA, complete
           cds.
          Length = 759

 Score = 97.1 bits (240), Expect = 3e-19
 Identities = 45/108 (41%), Positives = 65/108 (60%)
 Frame = +3

Query: 399 LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH 578
           LP N+ ++TW  L  A+ A+        +LE+LYQAV +LC HK+   LY+++ + CE H
Sbjct: 54  LPDNYTQDTWRKLHEAVRAVQSSTSIRYNLEELYQAVENLCSHKVSPMLYKQLRQACEDH 113

Query: 579 IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           +   +      S D V+FL  +  CWQD C Q++ IR I L+LDRTYV
Sbjct: 114 VQAQILPFREDSLDSVLFLKKINTCWQDHCRQMIMIRSIFLFLDRTYV 161



>gb:AE013599_1130587 Drosophila melanogaster chromosome 2R, complete
           sequence.>gb:AE003838_1227089 Drosophila melanogaster
           chromosome 2R, section 12 of 74 of the complete
           sequence.
          Length = 821

 Score = 94.4 bits (233), Expect = 2e-18
 Identities = 53/152 (34%), Positives = 80/152 (52%), Gaps = 6/152 (3%)
 Frame = +3

Query: 285 SPGASATRAATANLSRKKATL----PQXXXXXXXXXXXXXXTLPTNFEENTWATLKSAIN 452
           S G   T + T+NL  +   +    P               TLP N+ ++T+  L+ A+ 
Sbjct: 71  SHGEIRTASTTSNLLNRMGAIHNSKPGDVKKIVIKNFKDKPTLPDNYSKDTYVKLEEAVI 130

Query: 453 AIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIA--VALQSLVGQSEDLV 626
           AI L +P    LE+LYQAV ++C HKM   LY ++++  E H+   + L+ L G S D +
Sbjct: 131 AIQLSKPIKYSLEELYQAVVNMCSHKMDAQLYAKLKELTEQHVKRNIKLKELTGGSMDKL 190

Query: 627 VFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           + L  +   W  FC Q++ IR I LY+DRTYV
Sbjct: 191 ILLEKINHWWLSFCQQMIMIRSIFLYMDRTYV 222



>gb:BC054607_2551017 Danio rerio cullin 4A, mRNA (cDNA clone
           MGC:64071 IMAGE:6794393), complete cds.
          Length = 635

 Score = 91.7 bits (226), Expect = 1e-17
 Identities = 43/108 (39%), Positives = 66/108 (61%)
 Frame = +3

Query: 399 LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH 578
           L  ++ E+TW  L+ A++AI        +LE+LYQAV +LC +K+   LY+++ + CE H
Sbjct: 39  LTDSYTEDTWLKLRDAVSAIQNSTSIQYNLEELYQAVENLCSYKVSPMLYKQLRQVCEEH 98

Query: 579 IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           +   +     +S D + FL  + +CWQD C Q + IR I L+LDRTYV
Sbjct: 99  VQAQIHQFREESLDSLSFLKRMNRCWQDHCRQTIMIRSIFLFLDRTYV 146



>pir|T12957|T12957 hypothetical protein T6H20.60 - Arabidopsis
           thaliana>gb:ATT6H20_1556340 Arabidopsis thaliana DNA
           chromosome 3, BAC clone T6H20.
          Length = 247

 Score = 72.8 bits (177), Expect = 6e-12
 Identities = 42/98 (42%), Positives = 58/98 (59%), Gaps = 2/98 (2%)
 Frame = +3

Query: 411 FEENTWATLKSAINAIFLKQPDPCDLEKLYQAVN-DLCLHKMGGSLYQRIEKECETHIAV 587
           + E+ W  LK AI AIFL +P       L+ AVN   C    G +LY+ I +ECE +I+ 
Sbjct: 25  YVEDAWTMLKPAIRAIFLDEPQDFACSGLFNAVNKSWCEKSSGEALYKLILEECEIYISA 84

Query: 588 ALQSLVGQSE-DLVVFLSLVEKCWQDFCDQILTIRGIA 698
           A+QSL  Q + D  +FLSL+EKCW DF  ++  +  IA
Sbjct: 85  AIQSLESQCDTDPSLFLSLLEKCWLDFRRKLQFLCSIA 122



>gb:BT007619_2150551 Synthetic construct Homo sapiens cullin 4A
           mRNA, partial cds.
          Length = 660

 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 26/60 (43%), Positives = 37/60 (61%)
 Frame = +3

Query: 543 LYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           LY+++ + CE H+   +      S D V+FL  +  CWQD C Q++ IR I L+LDRTYV
Sbjct: 2   LYKQLRQACEDHVQAQILPFREDSLDSVLFLKKINTCWQDHCRQMIMIRSIFLFLDRTYV 61



>sp|Q13619|CU4A_HUMAN Cullin homolog 4A
           (CUL-4A).>gb:AF077188_1881092 Homo sapiens cullin 4A
           (CUL4A) mRNA, complete cds.>gb:AL136221_1919036 Human
           DNA sequence from clone RP11-391H12 on chromosome 13
           Contains the CUL4A gene for cullin 4A, the LAMP1 gene
           for lysosomal-associated membrane protein 1, the GRTP1
           gene for growth hormone regulated TBC protein 1, a novel
           gene, the 5' end of a novel gene (FLJ11305) an LDHB
           (lactate dehydrogenase B) pseudogene and six CpG
           islands, complete sequence.>gb:BC008308_1971290 Homo
           sapiens cullin 4A, mRNA (cDNA clone MGC:15238
           IMAGE:3537176), complete cds.
          Length = 659

 Score = 60.1 bits (144), Expect = 4e-08
 Identities = 26/60 (43%), Positives = 37/60 (61%)
 Frame = +3

Query: 543 LYQRIEKECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           LY+++ + CE H+   +      S D V+FL  +  CWQD C Q++ IR I L+LDRTYV
Sbjct: 2   LYKQLRQACEDHVQAQILPFREDSLDSVLFLKKINTCWQDHCRQMIMIRSIFLFLDRTYV 61



>gb:AP004114_1837795 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 2, BAC
           clone:OJ1118_G04.>gb:AP005733_1856810 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 2, BAC
           clone:OSJNBb0024K03.
          Length = 736

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 33/108 (30%), Positives = 51/108 (47%)
 Frame = +3

Query: 399 LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH 578
           L   + E TW  L+ AI+ I+         E+LY++  ++ LHK G  LY  +E+     
Sbjct: 23  LDPKYAERTWKVLEHAIHEIYNHNASGLSFEELYRSAYNMVLHKYGEKLYDGLERTMTWR 82

Query: 579 IAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           +    +S+      L  FL  +   W D    +  IR I +Y+DRTYV
Sbjct: 83  LKEISKSIEAAQGGL--FLEELNAKWMDHNKALQMIRDILMYMDRTYV 128



>gb:AX886583_1482036 Sequence 2446 from Patent EP1033401.
          Length = 82

 Score = 57.8 bits (138), Expect = 2e-07
 Identities = 26/61 (42%), Positives = 39/61 (63%)
 Frame = +3

Query: 399 LPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETH 578
           LP N+ + TW  LK A+ AI        +LE+LYQAV +LC +K+  +LY+++ + CE H
Sbjct: 12  LPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQICEDH 71

Query: 579 I 581
           I
Sbjct: 72  I 72



>gb:CEU58085_1368583 Caenorhabditis elegans cul-3 mRNA, complete
           cds.
          Length = 780

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 34/109 (31%), Positives = 54/109 (49%)
 Frame = +3

Query: 396 TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET 575
           T+   +   TW  LK AI  I  K       E+LY+    + LHK G  LY  ++   + 
Sbjct: 21  TIDEQYVTQTWELLKRAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGERLYNGLKDVIQD 80

Query: 576 HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           H+A +++  + +S +   FL  V + W D    ++ IR I +Y+DR YV
Sbjct: 81  HMA-SVRIRIIESMNSGSFLETVAESWADHTVAMVMIRDILMYMDRIYV 128



>sp|Q17391|CUL3_CAEEL Cullin 3.>gb:AC024744_1204336 Caenorhabditis
           elegans cosmid Y108G3AL, complete sequence.
          Length = 777

 Score = 57.4 bits (137), Expect = 3e-07
 Identities = 34/109 (31%), Positives = 54/109 (49%)
 Frame = +3

Query: 396 TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET 575
           T+   +   TW  LK AI  I  K       E+LY+    + LHK G  LY  ++   + 
Sbjct: 21  TIDEQYVTQTWELLKRAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGERLYNGLKDVIQD 80

Query: 576 HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           H+A +++  + +S +   FL  V + W D    ++ IR I +Y+DR YV
Sbjct: 81  HMA-SVRIRIIESMNSGSFLETVAESWADHTVAMVMIRDILMYMDRIYV 128



>gb:OSJN00009_1693194 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0033G05, complete
           sequence.>gb:OSJN00250_1697384 Oryza sativa genomic DNA,
           chromosome 4, BAC clone: OSJNBa0063C18, complete
           sequence.
          Length = 731

 Score = 56.2 bits (134), Expect = 6e-07
 Identities = 31/107 (28%), Positives = 55/107 (51%)
 Frame = +3

Query: 402 PTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHI 581
           P +F+++ W  L+ AI  I+         E+LY+   +L LHK G  LY ++ +  + H+
Sbjct: 22  PKSFDKS-WKKLEDAIREIYNHNASGLSFEELYRTAYNLVLHKHGLKLYDKLTENLKGHL 80

Query: 582 AVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
               +S+      L  FL  +++ W D    +  IR I +Y+DRT++
Sbjct: 81  KEMCRSIEDAQGSL--FLEELQRRWADHNKALQMIRDILMYMDRTFI 125



>pir|E96718|E96718 probable cullin T6C23.13 [imported] - Arabidopsis
           thaliana>gb:AE005173_894551 Arabidopsis thaliana
           chromosome 1, bottom arm complete
           sequence.>gb:AC013289_1537882 Arabidopsis thaliana
           chromosome 1 BAC T6C23 genomic sequence, complete
           sequence.
          Length = 732

 Score = 56.2 bits (134), Expect = 6e-07
 Identities = 31/104 (29%), Positives = 50/104 (48%)
 Frame = +3

Query: 411 FEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVA 590
           + + TW  L+ AI+ I+         E+LY+   ++ LHK G  LY  +      H+   
Sbjct: 24  YADKTWKILEHAIHEIYNHNASGLSFEELYRNAYNMVLHKYGDKLYTGLVTTMTFHLKEI 83

Query: 591 LQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
            +S+  +      FL L+ + W D    +  IR I +Y+DRTYV
Sbjct: 84  CKSI--EEAQGGAFLELLNRKWNDHNKALQMIRDILMYMDRTYV 125



>gb:AP005501_1852965 Oryza sativa (japonica cultivar-group) genomic
           DNA, chromosome 8, PAC
           clone:P0458D06.>gb:AP005606_1854787 Oryza sativa
           (japonica cultivar-group) genomic DNA, chromosome 8, BAC
           clone:OJ1590_E05.
          Length = 731

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 31/104 (29%), Positives = 48/104 (46%)
 Frame = +3

Query: 411 FEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVA 590
           F E  W  L  AI  I+         E+LY+   +L LHK G  LY ++ +  E H+   
Sbjct: 23  FFEKAWRKLDDAIREIYNHNASGLSFEELYRTAYNLVLHKHGPKLYDKLTENMEDHLQEM 82

Query: 591 LQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
             S+      L  FL  +++ W D    +  IR I +Y+DR ++
Sbjct: 83  RVSIEAAQGGL--FLVELQRKWDDHNKALQMIRDILMYMDRVFI 124



>gb:AE014134_1129264 Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE014134_1129265 Drosophila melanogaster
           chromosome 2L, complete sequence.>gb:AE014134_1129266
           Drosophila melanogaster chromosome 2L, complete
           sequence.>gb:AE003647_1219371 Drosophila melanogaster
           chromosome 2L, section 56 of 83 of the complete
           sequence.>gb:AE003647_1219372 Drosophila melanogaster
           chromosome 2L, section 56 of 83 of the complete
           sequence.>gb:AE003647_1219373 Drosophila melanogaster
           chromosome 2L, section 56 of 83 of the complete
           sequence.>gb:DROSADH06_1382813 Drosophila melanogaster,
           chromosome 2L, region 34C4-36A7 (Adh region), section 6
           of 10 of the complete sequence.
          Length = 773

 Score = 55.5 bits (132), Expect = 1e-06
 Identities = 32/109 (29%), Positives = 55/109 (50%)
 Frame = +3

Query: 396 TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET 575
           ++   + E  WA+LK+AI  I  K       E+LY+   ++ LHK G  LY  + +    
Sbjct: 22  SMDEKYVETIWASLKNAIQEIQKKNNSGLSFEQLYRNAYNMVLHKHGNRLYYGLREVVSE 81

Query: 576 HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           H+   +++ V ++     FL  + + W D    ++ IR I +Y+DR YV
Sbjct: 82  HLEHKVRADVLEALH-SNFLPKLNQAWTDHQTSMVMIRDILMYMDRVYV 129



>gb:AY223095_1176559 Schistosoma japonicum clone ZZD1344 mRNA
           sequence.
          Length = 273

 Score = 54.7 bits (130), Expect = 2e-06
 Identities = 33/99 (33%), Positives = 51/99 (51%)
 Frame = +3

Query: 417 ENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQ 596
           E++   L+ A  A+FL +P    LE+LY+ V D+C  +M   LY  ++      +A    
Sbjct: 47  EDSCLKLQKATKAVFLSEPVESTLEELYRNVEDICAQRMVMELYSSLKILFSEFVA---- 102

Query: 597 SLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDR 713
            L  Q   +   LS V  CW  +C ++L IR I L++DR
Sbjct: 103 ELQPQFLKVGFQLSAVAHCWGLYCKKMLLIRNIFLFMDR 141



>gb:BC065357_2553975 Danio rerio cullin 3, mRNA (cDNA clone
           MGC:77385 IMAGE:6969310), complete cds.
          Length = 766

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 33/109 (30%), Positives = 51/109 (46%)
 Frame = +3

Query: 396 TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET 575
           T+   +  N W  LK+AI  I  K       E+LY+    + LHK G  LY  + +    
Sbjct: 22  TMDEKYVNNIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVTE 81

Query: 576 HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           H+   ++  V  S +   FL  + + W D    ++ IR I +Y+DR YV
Sbjct: 82  HLINKVREDVLHSLN-NNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYV 129



>gb:AY423034_2532120 Danio rerio cullin 3 (CUL3) mRNA, complete cds.
          Length = 766

 Score = 53.9 bits (128), Expect = 3e-06
 Identities = 33/109 (30%), Positives = 51/109 (46%)
 Frame = +3

Query: 396 TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET 575
           T+   +  N W  LK+AI  I  K       E+LY+    + LHK G  LY  + +    
Sbjct: 22  TMDEKYVNNIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVTE 81

Query: 576 HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           H+   ++  V  S +   FL  + + W D    ++ IR I +Y+DR YV
Sbjct: 82  HLINKVREDVLHSLN-NNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYV 129



>gb:BC077239_2559956 Xenopus laevis cullin 3, mRNA (cDNA clone
           MGC:79108 IMAGE:5048925), complete cds.
          Length = 768

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 32/109 (29%), Positives = 51/109 (46%)
 Frame = +3

Query: 396 TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET 575
           T+   +  + W  LK+AI  I  K       E+LY+    + LHK G  LY  + +    
Sbjct: 24  TMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVTE 83

Query: 576 HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           H+   ++  V  S +   FL  + + W D    ++ IR I +Y+DR YV
Sbjct: 84  HLINKVREDVLNSLN-NNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYV 131



>gb:BC073186_2557041 Xenopus laevis MGC80402 protein, mRNA (cDNA
           clone MGC:80402 IMAGE:5154783), complete cds.
          Length = 768

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 32/109 (29%), Positives = 51/109 (46%)
 Frame = +3

Query: 396 TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET 575
           T+   +  + W  LK+AI  I  K       E+LY+    + LHK G  LY  + +    
Sbjct: 24  TMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVTE 83

Query: 576 HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           H+   ++  V  S +   FL  + + W D    ++ IR I +Y+DR YV
Sbjct: 84  HLINKVREDVLNSLN-NNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYV 131



>gb:AK129174_2069405 Mus musculus mRNA for mKIAA0617 protein.
          Length = 792

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 32/109 (29%), Positives = 51/109 (46%)
 Frame = +3

Query: 396 TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET 575
           T+   +  + W  LK+AI  I  K       E+LY+    + LHK G  LY  + +    
Sbjct: 48  TMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVTE 107

Query: 576 HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           H+   ++  V  S +   FL  + + W D    ++ IR I +Y+DR YV
Sbjct: 108 HLINKVREDVLNSLN-NNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYV 155



>gb:AF062537_1880198 Homo sapiens cullin 3 mRNA, complete cds.
          Length = 768

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 32/109 (29%), Positives = 51/109 (46%)
 Frame = +3

Query: 396 TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET 575
           T+   +  + W  LK+AI  I  K       E+LY+    + LHK G  LY  + +    
Sbjct: 24  TMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVTE 83

Query: 576 HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           H+   ++  V  S +   FL  + + W D    ++ IR I +Y+DR YV
Sbjct: 84  HLINKVREDVLNSLN-NNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYV 131



>gb:AB014517_1864546 Homo sapiens mRNA for KIAA0617 protein, partial
           cds.
          Length = 786

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 32/109 (29%), Positives = 51/109 (46%)
 Frame = +3

Query: 396 TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET 575
           T+   +  + W  LK+AI  I  K       E+LY+    + LHK G  LY  + +    
Sbjct: 42  TMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVTE 101

Query: 576 HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           H+   ++  V  S +   FL  + + W D    ++ IR I +Y+DR YV
Sbjct: 102 HLINKVREDVLNSLN-NNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYV 149



>sp|Q9JLV5|CUL3_MOUSE Cullin homolog 3 (CUL-3).>gb:AF129738_2055650
           Mus musculus cullin 3 (Cul3) mRNA, complete
           cds.>gb:BC027304_2095892 Mus musculus cullin 3, mRNA
           (cDNA clone MGC:28933 IMAGE:3981170), complete cds.
          Length = 768

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 32/109 (29%), Positives = 51/109 (46%)
 Frame = +3

Query: 396 TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET 575
           T+   +  + W  LK+AI  I  K       E+LY+    + LHK G  LY  + +    
Sbjct: 24  TMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVTE 83

Query: 576 HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           H+   ++  V  S +   FL  + + W D    ++ IR I +Y+DR YV
Sbjct: 84  HLINKVREDVLNSLN-NNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYV 131



>sp|Q13618|CUL3_HUMAN Cullin homolog 3 (CUL-3).>gb:AF064087_1880336
           Homo sapiens cullin 3 mRNA, complete
           cds.>gb:BC039598_1982589 Homo sapiens cullin 3, mRNA
           (cDNA clone MGC:48882 IMAGE:5784147), complete cds.
          Length = 768

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 32/109 (29%), Positives = 51/109 (46%)
 Frame = +3

Query: 396 TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECET 575
           T+   +  + W  LK+AI  I  K       E+LY+    + LHK G  LY  + +    
Sbjct: 24  TMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVTE 83

Query: 576 HIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           H+   ++  V  S +   FL  + + W D    ++ IR I +Y+DR YV
Sbjct: 84  HLINKVREDVLNSLN-NNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYV 131



>pir|A86395|A86395 hypothetical protein T2P11.2 [imported] -
           Arabidopsis thaliana>gb:AE005172_891560 Arabidopsis
           thaliana chromosome 1, top arm complete
           sequence.>gb:AC005508_1532790 Arabidopsis thaliana
           chromosome I BAC T2P11 genomic sequence, complete
           sequence.>gb:AC006535_1534427 Genomic sequence for
           Arabidopsis thaliana BAC T24P13 from chromosome I,
           complete sequence.>gb:ATH344252_1552507 Arabidopsis
           thaliana mRNA for cullin 3a (cul3a gene).
          Length = 732

 Score = 51.2 bits (121), Expect = 2e-05
 Identities = 30/107 (28%), Positives = 52/107 (48%), Gaps = 3/107 (2%)
 Frame = +3

Query: 411 FEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHI--- 581
           + + TW  L+ AI+ I+ +       E+LY+   ++ LHK G  LY        +H+   
Sbjct: 24  YADKTWQILERAIHQIYNQDASGLSFEELYRNAYNMVLHKFGEKLYTGFIATMTSHLKEK 83

Query: 582 AVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           +  +++  G S     FL  + K W +    +  IR I +Y+DRTY+
Sbjct: 84  SKLIEAAQGGS-----FLEELNKKWNEHNKALEMIRDILMYMDRTYI 125



>gb:AY337761_1944151 Homo sapiens cullin 3 isoform (CUL3) mRNA,
           complete cds.
          Length = 744

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 31/104 (29%), Positives = 49/104 (47%)
 Frame = +3

Query: 411 FEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVA 590
           +  + W  LK+AI  I  K       E+LY+    + LHK G  LY  + +    H+   
Sbjct: 5   YVNSIWDLLKNAIQEIQRKNNSGLSFEELYRNAYTMVLHKHGEKLYTGLREVVTEHLINK 64

Query: 591 LQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           ++  V  S +   FL  + + W D    ++ IR I +Y+DR YV
Sbjct: 65  VREDVLNSLN-NNFLQTLNQAWNDHQTAMVMIRDILMYMDRVYV 107



>gb:AF159296_1773220 Lycopersicon esculentum pollen extensin-like
           protein (Pex1) gene, complete cds.
          Length = 711

 Score = 21.6 bits (44), Expect(11) = 4e-05
 Identities = 11/30 (36%), Positives = 13/30 (43%), Gaps = 3/30 (10%)
 Frame = +3

Query: 78  PNKRSSP---YSSCSATAGDGAPPLHRPPP 158
           P K S P   +S          PP+H PPP
Sbjct: 432 PPKTSPPPPVHSPPPPPVASPPPPVHSPPP 461



 Score = 21.2 bits (43), Expect(11) = 4e-05
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 668 PPVHSPPP 675



 Score = 21.2 bits (43), Expect(11) = 4e-05
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 646 PPVHSPPP 653



 Score = 21.2 bits (43), Expect(8) = 0.018
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 639 PPVHSPPP 646



 Score = 21.2 bits (43), Expect(8) = 0.018
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 618 PPVHSPPP 625



 Score = 21.2 bits (43), Expect(11) = 4e-05
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 604 PPVHSPPP 611



 Score = 21.2 bits (43), Expect(8) = 0.018
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 588 PPVHSPPP 595



 Score = 21.2 bits (43), Expect(8) = 0.018
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 574 PPVHSPPP 581



 Score = 21.2 bits (43), Expect(11) = 4e-05
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 567 PPVHSPPP 574



 Score = 21.2 bits (43), Expect(8) = 0.018
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 560 PPVHSPPP 567



 Score = 21.2 bits (43), Expect(8) = 0.018
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 546 PPVHSPPP 553



 Score = 21.2 bits (43), Expect(8) = 0.018
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 539 PPVHSPPP 546



 Score = 21.2 bits (43), Expect(8) = 0.018
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 532 PPVHSPPP 539



 Score = 21.2 bits (43), Expect(11) = 4e-05
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 525 PPVHSPPP 532



 Score = 21.2 bits (43), Expect(11) = 4e-05
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 518 PPVHSPPP 525



 Score = 21.2 bits (43), Expect(11) = 4e-05
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 504 PPVHSPPP 511



 Score = 21.2 bits (43), Expect(11) = 4e-05
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 497 PPVHSPPP 504



 Score = 21.2 bits (43), Expect(11) = 4e-05
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 483 PPVHSPPP 490



 Score = 21.2 bits (43), Expect(11) = 4e-05
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 468 PPVHSPPP 475



>sp|P53202|CUL3_YEAST Cullin B.>pir|S64292|S64292 hypothetical
           protein YGR003w - yeast (Saccharomyces
           cerevisiae)>gb:AY387706_1604298 Saccharomyces cerevisiae
           ubiquitin ligase Cul3 (CUL3) gene, complete
           cds.>gb:SCYGR003W_1712203 S.cerevisiae chromosome VII
           reading frame ORF YGR003w.
          Length = 744

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 24/101 (23%), Positives = 49/101 (48%)
 Frame = +3

Query: 417 ENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQ 596
           E +W T+K AI+ I+         E++Y+ +  + L+K G  LY R++      +A+  +
Sbjct: 23  EESWETVKYAIDHIYSDDMADLSFEQVYKTIYTIVLNKKGPILYNRLKDYLIQKLALLRE 82

Query: 597 SLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTY 719
           ++V  +     FL  + + W+  C        + +Y+D+ Y
Sbjct: 83  TIVKDNTHDYEFLGTMARLWEVQCHCFKITGDLMMYMDKVY 123



>gb:AP000735_1820573 Arabidopsis thaliana genomic DNA, chromosome 3,
           TAC clone:K13E13.
          Length = 956

 Score = 24.6 bits (52), Expect(8) = 0.002
 Identities = 9/22 (40%), Positives = 13/22 (59%)
 Frame = +3

Query: 93  SPYSSCSATAGDGAPPLHRPPP 158
           SP +  + T    +PP+H PPP
Sbjct: 628 SPSTEETKTTSPQSPPVHSPPP 649



 Score = 21.6 bits (44), Expect(8) = 0.002
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 665 PPMHSPPP 672



 Score = 21.2 bits (43), Expect(8) = 0.002
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 797 PPVHSPPP 804



 Score = 21.2 bits (43), Expect(8) = 0.002
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 783 PPVHSPPP 790



 Score = 21.2 bits (43), Expect(8) = 0.002
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 776 PPVHSPPP 783



 Score = 21.2 bits (43), Expect(8) = 0.002
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 769 PPVHSPPP 776



 Score = 21.2 bits (43), Expect(8) = 0.002
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 722 PPVHSPPP 729



 Score = 21.2 bits (43), Expect(8) = 0.002
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 708 PPVHSPPP 715



>gb:CR382123_1656277 Kluyveromyces lactis strain NRRL Y-1140
           chromosome C of strain NRRL Y-1140 of Kluyveromyces
           lactis.
          Length = 735

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 27/101 (26%), Positives = 46/101 (45%)
 Frame = +3

Query: 417 ENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQ 596
           +  WA L++ I+ IF  +      EKLY  V  L L K G  L++R+ ++   H      
Sbjct: 27  DEQWAILQNGIDKIFDGKVTELSFEKLYTTVYGLVLTKNGPQLHERLSRQLSDHFGKVRT 86

Query: 597 SLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTY 719
           S  G +      L+L+ + W+     +  I  + +Y+D  Y
Sbjct: 87  SFDGITR--AEALNLLNQVWEKQKVYLSQISDVFIYMDSVY 125



>pir|T06617|T06617 hypothetical protein F16J13.170 - Arabidopsis
           thaliana>gb:ATCHRIV33_1544975 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No.
           33.>gb:ATF16J13_1548810 Arabidopsis thaliana DNA
           chromosome 4, BAC clone F16J13 (ESSA
           project).>gb:AY133688_1581508 Arabidopsis thaliana clone
           C103133 unknown protein (At4g12100) mRNA, complete cds.
          Length = 434

 Score = 43.5 bits (101), Expect = 0.004
 Identities = 32/103 (31%), Positives = 48/103 (46%), Gaps = 10/103 (9%)
 Frame = +3

Query: 426 WATLKSAINAI-----FLKQPDPCDLEKLYQAVNDLCLH--KMGGSLYQRIEKECETHIA 584
           W  LK AI  I     + K  D      +++AV   CL   +    ++  ++ ECE HIA
Sbjct: 81  WDLLKPAIKIILDDDEYKKPGDVLCFTTIFRAVKRACLGDPRQSELVFNLVKHECEPHIA 140

Query: 585 VALQSL---VGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALY 704
             +QSL      S+D  VFL  V   W DF  ++  +  +A+Y
Sbjct: 141 ELIQSLEKNCSGSDDPSVFLPHVYNRWLDFKRKMSLVSDVAMY 183



>gb:CR382128_1660486 Yarrowia lipolytica chromosome B of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 778

 Score = 40.8 bits (94), Expect = 0.025
 Identities = 29/108 (26%), Positives = 44/108 (40%), Gaps = 7/108 (6%)
 Frame = +3

Query: 417 ENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQ 596
           + +W  L SA+  I   +  P   E LY+    L + KM   LY  ++     H+     
Sbjct: 24  DKSWEILASAMTKIQDHESSPLSFELLYRTSYQLVISKMSAQLYDAVKCHISAHLDKVQA 83

Query: 597 S----LVGQSEDLVV---FLSLVEKCWQDFCDQILTIRGIALYLDRTY 719
                +V   +DL +   FL  + K W D       I  + +YLDR Y
Sbjct: 84  GFDPYVVVARDDLSLAPKFLEGLNKQWSDHQTCTKMIGDVMMYLDRVY 131



>pir|C84534|C84534 hypothetical protein At2g15880 [imported] -
           Arabidopsis thaliana>gb:AC006438_1534269 Arabidopsis
           thaliana chromosome 2 clone F19G14 map mi398, complete
           sequence.
          Length = 727

 Score = 22.3 bits (46), Expect(7) = 0.062
 Identities = 11/34 (32%), Positives = 14/34 (41%), Gaps = 2/34 (5%)
 Frame = +3

Query: 63  QPTSNPNKRSSPY--SSCSATAGDGAPPLHRPPP 158
           QP     + + PY  S          PP+H PPP
Sbjct: 470 QPPKESPQPNDPYDQSPVKFRRSPPPPPVHSPPP 503



 Score = 21.2 bits (43), Expect(7) = 0.062
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 634 PPVHSPPP 641



 Score = 21.2 bits (43), Expect(7) = 0.062
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 604 PPVHSPPP 611



 Score = 21.2 bits (43), Expect(7) = 0.062
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 597 PPVHSPPP 604



 Score = 21.2 bits (43), Expect(7) = 0.062
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 590 PPVHSPPP 597



 Score = 21.2 bits (43), Expect(7) = 0.062
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 547 PPVHSPPP 554



 Score = 21.2 bits (43), Expect(7) = 0.062
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 540 PPVHSPPP 547



>gb:BX842631_1643970 Neurospora crassa DNA linkage group I BAC
           contig B1O14.
          Length = 838

 Score = 39.3 bits (90), Expect = 0.072
 Identities = 31/123 (25%), Positives = 50/123 (40%), Gaps = 22/123 (17%)
 Frame = +3

Query: 417 ENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRI----EKECETHIA 584
           E  WA L+ A+  I L+       E+LY+A   + L K G  LY+R+    ++    HI 
Sbjct: 24  EPCWALLRDAMTDIHLQNAGRLSFEQLYRASYKIVLRKKGALLYERVRDFEQEWFRDHIM 83

Query: 585 VALQSLVGQS------------------EDLVVFLSLVEKCWQDFCDQILTIRGIALYLD 710
             + +L+ ++                  E    FL  +   W D    +  I  + +YLD
Sbjct: 84  PNIAALITKNLINISLLQHPGSSSHERREMGEKFLRGIRDSWTDHNRSMNMIADVLMYLD 143

Query: 711 RTY 719
           R Y
Sbjct: 144 RVY 146



>gb:CR382135_1668247 Debaryomyces hansenii chromosome C of strain
           CBS767 of Debaryomyces hansenii.
          Length = 896

 Score = 38.9 bits (89), Expect = 0.094
 Identities = 29/111 (26%), Positives = 45/111 (40%), Gaps = 11/111 (9%)
 Frame = +3

Query: 423 TWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSL 602
           +W+ L +AI  I  K       E+LY+    L L K G  LY  +      H+    Q+L
Sbjct: 37  SWSVLSNAITQIQNKNVSKLSYEQLYRKAYILVLRKYGAKLYDDVSLLIRQHLLQKRQNL 96

Query: 603 V-----------GQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
           +             +ED   F+  V   W +    +  I  + +YL+R YV
Sbjct: 97  LAILNLSSSLNNSINED---FMKAVLVEWDEHLQSMKFISDVLMYLNRVYV 144



>gb:CR380952_1650594 Candida glabrata strain CBS138 chromosome F
           complete sequence.
          Length = 757

 Score = 38.9 bits (89), Expect = 0.094
 Identities = 26/112 (23%), Positives = 49/112 (43%), Gaps = 4/112 (3%)
 Frame = +3

Query: 396 TLPTNFEENTWATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIE----K 563
           ++P      +W  L+SA+N I+ +  +      LY+ +    L++ G  LY   E    K
Sbjct: 15  SIPKQDFSQSWEILESALNHIYAEDTEKLSFGDLYRTIYTQVLNRNGEKLYSAFEAYMAK 74

Query: 564 ECETHIAVALQSLVGQSEDLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTY 719
           + +    +     V    D   FL  + + W+   D + TI  + +Y+D+ Y
Sbjct: 75  KLDEIRELTFTEHVLSDND--SFLLEMGELWKKQSDILKTISDLTIYMDKVY 124



>gb:AE017351_1759586 Cryptococcus neoformans var. neoformans JEC21
           chromosome 11, complete sequence.
          Length = 590

 Score = 38.5 bits (88), Expect = 0.12
 Identities = 23/62 (37%), Positives = 28/62 (45%)
 Frame = +3

Query: 60  SQPTSNPNKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYP 239
           S PT +PN   SP  S  +  G    P H PPP   AK       +D  K G H +H +P
Sbjct: 119 SPPTDSPNALLSPIKSSKSPQGGTVSP-HPPPPKSPAKR-----LVDKAKKGLHRLHDFP 172

Query: 240 DV 245
            V
Sbjct: 173 TV 174



>pir|S62405|S62405 hypothetical protein SPAC24H6.03 - fission yeast 
           (Schizosaccharomyces pombe)
          Length = 798

 Score = 37.7 bits (86), Expect = 0.21
 Identities = 31/125 (24%), Positives = 45/125 (36%), Gaps = 27/125 (21%)
 Frame = +3

Query: 426 WATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVAL---- 593
           W  L+ AI  IF K       E+LY+    L LHK G  LY  ++    + +        
Sbjct: 26  WEVLQRAIGDIFQKSTSQLSFEELYRNAYILVLHKYGEKLYNHVQDVIRSRLKEETVPAI 85

Query: 594 -----QSLVGQS------------------EDLVVFLSLVEKCWQDFCDQILTIRGIALY 704
                 SL+G +                  E    FLS +   W+D    +  I  +  Y
Sbjct: 86  YKNYDASLLGNALLDIRKNDSYSTSWSRSLEAAHRFLSSLVNSWKDHIVSMQMISSVLKY 145

Query: 705 LDRTY 719
           LD+ Y
Sbjct: 146 LDKVY 150



>sp|Q09760|CUL3_SCHPO Cullin 3 homolog (Cul-3).>pir|T38359|T38359
           cullin 3 homolog - fission yeast (Schizosaccharomyces
           pombe)>gb:SPAC24H6_1717396 S.pombe chromosome I cosmid
           c24H6.
          Length = 785

 Score = 37.7 bits (86), Expect = 0.21
 Identities = 31/125 (24%), Positives = 45/125 (36%), Gaps = 27/125 (21%)
 Frame = +3

Query: 426 WATLKSAINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVAL---- 593
           W  L+ AI  IF K       E+LY+    L LHK G  LY  ++    + +        
Sbjct: 26  WEVLQRAIGDIFQKSTSQLSFEELYRNAYILVLHKYGEKLYNHVQDVIRSRLKEETVPAI 85

Query: 594 -----QSLVGQS------------------EDLVVFLSLVEKCWQDFCDQILTIRGIALY 704
                 SL+G +                  E    FLS +   W+D    +  I  +  Y
Sbjct: 86  YKNYDASLLGNALLDIRKNDSYSTSWSRSLEAAHRFLSSLVNSWKDHIVSMQMISSVLKY 145

Query: 705 LDRTY 719
           LD+ Y
Sbjct: 146 LDKVY 150



>gb:H0423H10_1681323 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: H0423H10, complete sequence.
          Length = 326

 Score = 37.0 bits (84), Expect = 0.36
 Identities = 21/96 (21%), Positives = 46/96 (47%), Gaps = 3/96 (3%)
 Frame = +3

Query: 444 AINAIFLKQPDPCDLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSE-- 617
           AI  I+ +  +  + E+LY+ V ++ ++K G  +Y  +       +     SLV  ++  
Sbjct: 143 AIRDIYAQDMEKLNFEQLYRRVYEMVVNKHGELMYSEVATALTAEVEGLRTSLVAVADGG 202

Query: 618 -DLVVFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
                FL  +   W+   + +  +R + +Y++RT+V
Sbjct: 203 GGGGAFLRELLSKWRRHTEAVAAVRDMVMYMERTFV 238



>gb:SCMSP8_1708794 S.cerevisiae MSP8 gene.
          Length = 1429

 Score = 36.2 bits (82), Expect = 0.61
 Identities = 25/83 (30%), Positives = 41/83 (49%), Gaps = 2/83 (2%)
 Frame = +3

Query: 102 SSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDE--DPSSASME 275
           +S SA +  GAPP   PPP K      V+C+        +H+H  P      DP++ S E
Sbjct: 197 NSGSAMSPLGAPP---PPPHKDHLCDGVSCT--------NHLHVKPTSTSLNDPTAISFE 245

Query: 276 DLDSPGASATRAATANLSRKKAT 344
             ++PG  A +A  +  + +++T
Sbjct: 246 QDEAPGLPAVKALKSMTTHQRST 268



>gb:SCCAT8_1706623 S.cerevisiae CAT8 gene.
          Length = 1433

 Score = 36.2 bits (82), Expect = 0.61
 Identities = 25/83 (30%), Positives = 41/83 (49%), Gaps = 2/83 (2%)
 Frame = +3

Query: 102 SSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDE--DPSSASME 275
           +S SA +  GAPP   PPP K      V+C+        +H+H  P      DP++ S E
Sbjct: 197 NSGSAMSPLGAPP---PPPHKDHLCDGVSCT--------NHLHVKPTSTSLNDPTAISFE 245

Query: 276 DLDSPGASATRAATANLSRKKAT 344
             ++PG  A +A  +  + +++T
Sbjct: 246 QDEAPGLPAVKALKSMTTHQRST 268



>gb:AE017180_400227 Geobacter sulfurreducens PCA, complete genome.
          Length = 394

 Score = 36.2 bits (82), Expect = 0.61
 Identities = 27/99 (27%), Positives = 45/99 (45%), Gaps = 2/99 (2%)
 Frame = +3

Query: 60  SQPTSNP--NKRSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHF 233
           ++PT+ P  NK + P ++ +A A  GAP   +P P++ A + A A               
Sbjct: 165 AEPTAKPAANKGAKPEAAVAAKAAAGAPGKKKPAPVEPATAAAKA--------------- 209

Query: 234 YPDVDEDPSSASMEDLDSPGASATRAATANLSRKKATLP 350
                +   +A+    D P A+A   +TA +S+  AT P
Sbjct: 210 ----GDTKGAAATARKDKPKAAAVAKSTATVSKVAATGP 244



>sp|P39113|CAT8_YEAST Regulatory protein CAT8.>pir|S54587|S54587
           CAT8 protein - yeast (Saccharomyces
           cerevisiae)>gb:SC8021X_1705415 S.cerevisiae chromosome
           XIII cosmid 8021.
          Length = 1433

 Score = 36.2 bits (82), Expect = 0.61
 Identities = 25/83 (30%), Positives = 41/83 (49%), Gaps = 2/83 (2%)
 Frame = +3

Query: 102 SSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDE--DPSSASME 275
           +S SA +  GAPP   PPP K      V+C+        +H+H  P      DP++ S E
Sbjct: 197 NSGSAMSPLGAPP---PPPHKDHLCDGVSCT--------NHLHVKPTSTSLNDPTAISFE 245

Query: 276 DLDSPGASATRAATANLSRKKAT 344
             ++PG  A +A  +  + +++T
Sbjct: 246 QDEAPGLPAVKALKSMTTHQRST 268



>gb:AF480884_2263919 Chimpanzee cytomegalovirus, complete genome.
          Length = 919

 Score = 33.9 bits (76), Expect = 3.0
 Identities = 23/87 (26%), Positives = 37/87 (42%), Gaps = 8/87 (9%)
 Frame = +3

Query: 66  PTSNPNKRSSPYSSCSATAGDGAPPLHRPPPM--KKAKSQAVACSLDTNKNGQHHVHFYP 239
           PTS  +  ++  SS     G   PP   PPP   +  K  + A    + K    H +   
Sbjct: 589 PTSQSSGTTTTSSSSHTPKGPRTPPYPPPPPSAPRPEKQSSTAYERRSRKRRSPHQYSEG 648

Query: 240 DVDEDPSSASMEDL------DSPGASA 302
           +++++   +S +DL      D PGA A
Sbjct: 649 ELEDEEDDSSSQDLVKVPTSDRPGAGA 675



>pir|B71005|B71005 hypothetical protein PH1336 - Pyrococcus
           horikoshii>gb:BA000001_650004 Pyrococcus horikoshii OT3
           DNA, complete genome.
          Length = 138

 Score = 33.9 bits (76), Expect = 3.0
 Identities = 17/42 (40%), Positives = 22/42 (52%)
 Frame = +3

Query: 87  RSSPYSSCSATAGDGAPPLHRPPPMKKAKSQAVACSLDTNKN 212
           R S YSS +A+A  G PP   PPP  K K      S  T+++
Sbjct: 25  RESGYSSFNASARTGVPPAPVPPPKPKVKKNISTSSYPTSED 66



>gb:AY548172_2086459 Mus musculus retinoic acid induced 1 (Rai1) mRNA,
            complete cds.
          Length = 1889

 Score = 33.5 bits (75), Expect = 4.0
 Identities = 22/94 (23%), Positives = 38/94 (40%), Gaps = 1/94 (1%)
 Frame = +3

Query: 72   SNPNKRSSPYSSCSATAGDGAPPLHRP-PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVD 248
            + P  R    SSC     D   P   P   ++K  +    C++  +   +   H+ P   
Sbjct: 1540 AEPEIRLKYISSCKRLRADSRTPAFSPFVRVEKRDAYTTICTVVNSPGDEPKPHWKPSSS 1599

Query: 249  EDPSSASMEDLDSPGASATRAATANLSRKKATLP 350
               SS S   L+  GAS T     ++ +++ +LP
Sbjct: 1600 AASSSTSSSSLEPAGASLTTFPGGSVLQQRPSLP 1633



>gb:AL669954_2072613 Mouse DNA sequence from clone RP23-456O18 on
            chromosome 11 Contains the 3' end of the Rai1 gene for
            retinoic acid induced 1, the Srebf1 gene for sterol
            regulatory element binding factor 1, the 3' end of the
            gene for the likely ortholog of H. sapiens target of
            myb1-like 2 (chicken) (TOM1L2) (A730055F12Rik), a novel
            gene and two CpG islands, complete sequence.
          Length = 1840

 Score = 33.5 bits (75), Expect = 4.0
 Identities = 22/94 (23%), Positives = 38/94 (40%), Gaps = 1/94 (1%)
 Frame = +3

Query: 72   SNPNKRSSPYSSCSATAGDGAPPLHRP-PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVD 248
            + P  R    SSC     D   P   P   ++K  +    C++  +   +   H+ P   
Sbjct: 1540 AEPEIRLKYISSCKRLRADSRTPAFSPFVRVEKRDAYTTICTVVNSPGDEPKPHWKPSSS 1599

Query: 249  EDPSSASMEDLDSPGASATRAATANLSRKKATLP 350
               SS S   L+  GAS T     ++ +++ +LP
Sbjct: 1600 AASSSTSSSSLEPAGASLTTFPGGSVLQQRPSLP 1633



>gb:AL669954_2072612 Mouse DNA sequence from clone RP23-456O18 on
            chromosome 11 Contains the 3' end of the Rai1 gene for
            retinoic acid induced 1, the Srebf1 gene for sterol
            regulatory element binding factor 1, the 3' end of the
            gene for the likely ortholog of H. sapiens target of
            myb1-like 2 (chicken) (TOM1L2) (A730055F12Rik), a novel
            gene and two CpG islands, complete sequence.
          Length = 1889

 Score = 33.5 bits (75), Expect = 4.0
 Identities = 22/94 (23%), Positives = 38/94 (40%), Gaps = 1/94 (1%)
 Frame = +3

Query: 72   SNPNKRSSPYSSCSATAGDGAPPLHRP-PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVD 248
            + P  R    SSC     D   P   P   ++K  +    C++  +   +   H+ P   
Sbjct: 1540 AEPEIRLKYISSCKRLRADSRTPAFSPFVRVEKRDAYTTICTVVNSPGDEPKPHWKPSSS 1599

Query: 249  EDPSSASMEDLDSPGASATRAATANLSRKKATLP 350
               SS S   L+  GAS T     ++ +++ +LP
Sbjct: 1600 AASSSTSSSSLEPAGASLTTFPGGSVLQQRPSLP 1633



>gb:AK129449_2069680 Mus musculus mRNA for mKIAA1820 protein.
          Length = 1518

 Score = 33.5 bits (75), Expect = 4.0
 Identities = 22/94 (23%), Positives = 38/94 (40%), Gaps = 1/94 (1%)
 Frame = +3

Query: 72   SNPNKRSSPYSSCSATAGDGAPPLHRP-PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVD 248
            + P  R    SSC     D   P   P   ++K  +    C++  +   +   H+ P   
Sbjct: 1169 AEPEIRLKYISSCKRLRADSRTPAFSPFVRVEKRDAYTTICTVVNSPGDEPKPHWKPSSS 1228

Query: 249  EDPSSASMEDLDSPGASATRAATANLSRKKATLP 350
               SS S   L+  GAS T     ++ +++ +LP
Sbjct: 1229 AASSSTSSSSLEPAGASLTTFPGGSVLQQRPSLP 1262



>pir|T30250|T30250 GT1 protein - mouse>gb:MUSMA_2128827 Mouse mRNA for
            unknown product, complete cds.
          Length = 1840

 Score = 33.5 bits (75), Expect = 4.0
 Identities = 22/94 (23%), Positives = 38/94 (40%), Gaps = 1/94 (1%)
 Frame = +3

Query: 72   SNPNKRSSPYSSCSATAGDGAPPLHRP-PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVD 248
            + P  R    SSC     D   P   P   ++K  +    C++  +   +   H+ P   
Sbjct: 1540 AEPEIRLKYISSCKRLRADSRTPAFSPFVRVEKRDAYTTICTVVNSPGDEPKPHWKPSSS 1599

Query: 249  EDPSSASMEDLDSPGASATRAATANLSRKKATLP 350
               SS S   L+  GAS T     ++ +++ +LP
Sbjct: 1600 AASSSTSSSSLEPAGASLTTFPGGSVLQQRPSLP 1633



>gb:OSJN00250_1697382 Oryza sativa genomic DNA, chromosome 4, BAC
           clone: OSJNBa0063C18, complete sequence.
          Length = 175

 Score = 33.1 bits (74), Expect = 5.2
 Identities = 18/83 (21%), Positives = 40/83 (48%), Gaps = 3/83 (3%)
 Frame = +3

Query: 483 DLEKLYQAVNDLCLHKMGGSLYQRIEKECETHIAVALQSLVGQSE---DLVVFLSLVEKC 653
           + E+LY+ V ++ L+K G  +Y  +       +     SLV  ++       FL  +   
Sbjct: 5   NFEQLYRRVYEVVLNKHGELMYSEVATALTAEVEGLRTSLVAVADGGGGGGAFLRELLSK 64

Query: 654 WQDFCDQILTIRGIALYLDRTYV 722
           W+   + +  +R + +Y++RT++
Sbjct: 65  WRRHTEAVAAVRDMVMYMERTFI 87



>pir|T05225|T05225 extensin homolog F17I5.160 - Arabidopsis
           thaliana>gb:ATCHRIV80_1547358 Arabidopsis thaliana DNA
           chromosome 4, contig fragment No. 80.>gb:ATF17I5_1548950
           Arabidopsis thaliana DNA chromosome 4, BAC clone F17I5
           (ESSA project).
          Length = 699

 Score = 21.2 bits (43), Expect(5) = 5.9
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 607 PPVHSPPP 614



 Score = 21.2 bits (43), Expect(5) = 5.9
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 591 PPVHSPPP 598



 Score = 21.2 bits (43), Expect(5) = 5.9
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 584 PPVHSPPP 591



 Score = 21.2 bits (43), Expect(5) = 5.9
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 563 PPVHSPPP 570



 Score = 21.2 bits (43), Expect(5) = 5.9
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 538 PPVHSPPP 545



>gb:HSU58087_2025035 Human Hs-cul-1 mRNA, complete cds.
          Length = 752

 Score = 32.7 bits (73), Expect = 6.8
 Identities = 27/108 (25%), Positives = 52/108 (48%), Gaps = 6/108 (5%)
 Frame = +3

Query: 417 ENTWATLKSAINAIFLKQP-DPCDLEKLYQAVNDLC--LHKMGG-SLYQRIEKECETHIA 584
           +  W  L++ I  ++ +Q        +LY  V + C  +H+  G  LY+R+++  + +  
Sbjct: 18  DQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQFVGLELYKRLKEFLKNY-- 75

Query: 585 VALQSLVGQSEDLV--VFLSLVEKCWQDFCDQILTIRGIALYLDRTYV 722
             L +L+   EDL+    L    + W+D+      + GI  YL+R +V
Sbjct: 76  --LTNLLKDGEDLMDESVLKFYTQQWEDYRFSSKVLNGICAYLNRHWV 121



>gb:AE017346_1757442 Cryptococcus neoformans var. neoformans JEC21
           chromosome 6, complete sequence.
          Length = 487

 Score = 32.7 bits (73), Expect = 6.8
 Identities = 29/96 (30%), Positives = 42/96 (43%), Gaps = 7/96 (7%)
 Frame = +3

Query: 78  PNKRSSPYSSCSATAGDG---APPLHRPPPMKKAKSQAVACSLDTNKNGQHHVHFYPDV- 245
           P K SSP SS S++ G G   AP  H  P    A S  +  + D ++  +      P++ 
Sbjct: 14  PRKMSSPLSSPSSSVGRGMPIAPSAHEGPSGSPATSSTLPLTDDESELTEEE---EPEIT 70

Query: 246 ---DEDPSSASMEDLDSPGASATRAATANLSRKKAT 344
              D DP   + ED D+   +  R    N S  +AT
Sbjct: 71  LVKDNDPDDEAEEDNDTDDLADNR---MNRSESQAT 103



>gb:CR382131_1663887 Yarrowia lipolytica chromosome E of strain
           CLIB99 of Yarrowia lipolytica.
          Length = 566

 Score = 32.7 bits (73), Expect = 6.8
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 2/37 (5%)
 Frame = +3

Query: 123 GDGAPPLHRP--PPMKKAKSQAVACSLDTNKNGQHHV 227
           G+G+PP+H+P  PP +KA  +   CS   N N  H V
Sbjct: 148 GNGSPPMHQPLTPPYEKAGGK-FNCSTAANNNNSHSV 183



>gb:BC041733_2548018 Xenopus laevis SH2 domain containing 3C, mRNA
           (cDNA clone MGC:52749 IMAGE:4684029), complete cds.
          Length = 676

 Score = 32.3 bits (72), Expect = 8.8
 Identities = 25/90 (27%), Positives = 39/90 (43%), Gaps = 2/90 (2%)
 Frame = +3

Query: 87  RSSPYSSCSATAGDGAPPLHRP--PPMKKAKSQAVACSLDTNKNGQHHVHFYPDVDEDPS 260
           R  P       A  G+P L R   P +  A ++A     D++ +   H H  P++   PS
Sbjct: 239 RMKPPVKPPVCAAPGSPVLRRSSEPYVCPANNKAALNLADSSHSSPSHGH--PNISPSPS 296

Query: 261 SASMEDLDSPGASATRAATANLSRKKATLP 350
            +S  DLD+   S  R A++       +LP
Sbjct: 297 ISSYSDLDNGHYSQLRPASSTHDALSKSLP 326



>gb:MMU89891_2123947 Mus musculus metabotropic glutamate receptor
           type 1 mRNA, partial cds.
          Length = 183

 Score = 32.3 bits (72), Expect = 8.8
 Identities = 23/69 (33%), Positives = 29/69 (42%)
 Frame = -2

Query: 720 HRFCQDTKLYHGSSISDHKSPASISQQVIRKPPNLHFGQPKIAMPQLCVFHTLFQSVDRD 541
           H   ++T L+   S+     P  + QQ  + PP     QPK  M QL    T F S   D
Sbjct: 50  HLSAEETPLFLADSVIPKGLPPPLPQQQQQPPPQPPPQQPKSLMDQLQGVVTNFGSGIPD 109

Query: 540 FHPSCADKG 514
           FH   A  G
Sbjct: 110 FHAVLAGPG 118



>gb:AE017333_448198 Bacillus licheniformis DSM 13, complete
           genome.>gb:CP000002_858007 Bacillus licheniformis ATCC
           14580, complete genome.
          Length = 89

 Score = 32.3 bits (72), Expect = 8.8
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 2/34 (5%)
 Frame = +3

Query: 201 TNKNGQH--HVHFYPDVDEDPSSASMEDLDSPGA 296
           TN N QH  HVH+YP      + AS +   SPGA
Sbjct: 37  TNVNHQHFQHVHYYPQTQSAVNKASHQHFVSPGA 70



>sp|P97772|MGR1_MOUSE Metabotropic glutamate receptor 1 precursor
            (mGluR1).>gb:AF320126_2062821 Mus musculus metabotropic
            glutamate receptor type 1 (Glur1) mRNA, complete cds.
          Length = 1199

 Score = 32.3 bits (72), Expect = 8.8
 Identities = 23/69 (33%), Positives = 29/69 (42%)
 Frame = -2

Query: 720  HRFCQDTKLYHGSSISDHKSPASISQQVIRKPPNLHFGQPKIAMPQLCVFHTLFQSVDRD 541
            H   ++T L+   S+     P  + QQ  + PP     QPK  M QL    T F S   D
Sbjct: 994  HLSAEETPLFLADSVIPKGLPPPLPQQQQQPPPQPPPQQPKSLMDQLQGVVTNFGSGIPD 1053

Query: 540  FHPSCADKG 514
            FH   A  G
Sbjct: 1054 FHAVLAGPG 1062



>sp|P17555|CAP_YEAST Adenylyl cyclase-associated protein
           (CAP).>pir|A34896|A34896 adenylate cyclase-associated
           protein, 70K - yeast  (Saccharomyces
           cerevisiae)>gb:SCCHXIV43_1707192 S.cerevisiae chromosome
           XIV DNA (43.5 kb).>gb:SCYNL138W_1713737 S.cerevisiae
           chromosome XIV reading frame ORF
           YNL138w.>gb:YSCCAP_1728347 Saccharomyces cerevisiae
           cyclase associated protein mRNA, complete
           cds.>gb:YSCSRV2_1730677 S.cerevisiae SRV2 protein gene,
           complete cds.
          Length = 526

 Score = 32.3 bits (72), Expect = 8.8
 Identities = 22/55 (40%), Positives = 25/55 (45%), Gaps = 2/55 (3%)
 Frame = +3

Query: 57  MSQPTSNPNKRSSPYSSCSATAGDGAPPLHRPPPMK--KAKSQAVACSLDTNKNG 215
           M+Q T N    SSP S  SATA    PP    PP    +  +   A S D NK G
Sbjct: 253 MAQSTKNTGATSSP-SPASATAAPAPPPPPPAPPASVFEISNDTPATSSDANKGG 306



>gb:TOMHRGP_1725658 Tomato cell wall HRGP (hydroxproline-rich
           glycoprotein) gene, partial cds.
          Length = 93

 Score = 21.6 bits (44), Expect(5) = 9.2
 Identities = 11/30 (36%), Positives = 13/30 (43%), Gaps = 3/30 (10%)
 Frame = +3

Query: 78  PNKRSSP---YSSCSATAGDGAPPLHRPPP 158
           P K S P   +S          PP+H PPP
Sbjct: 12  PPKTSPPPPVHSPPPPPVASPPPPVHSPPP 41



 Score = 21.2 bits (43), Expect(5) = 9.2
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 84  PPVHSPPP 91



 Score = 21.2 bits (43), Expect(5) = 9.2
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 77  PPVHSPPP 84



 Score = 21.2 bits (43), Expect(5) = 9.2
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 63  PPVHSPPP 70



 Score = 21.2 bits (43), Expect(5) = 9.2
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 48  PPVHSPPP 55



>pir|A25494|A25494 hydroxyproline-rich glycoprotein - tomato
           (fragment)
          Length = 93

 Score = 21.6 bits (44), Expect(5) = 9.2
 Identities = 11/30 (36%), Positives = 13/30 (43%), Gaps = 3/30 (10%)
 Frame = +3

Query: 78  PNKRSSP---YSSCSATAGDGAPPLHRPPP 158
           P K S P   +S          PP+H PPP
Sbjct: 12  PPKTSPPPPVHSPPPPPVASPPPPVHSPPP 41



 Score = 21.2 bits (43), Expect(5) = 9.2
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 84  PPVHSPPP 91



 Score = 21.2 bits (43), Expect(5) = 9.2
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 77  PPVHSPPP 84



 Score = 21.2 bits (43), Expect(5) = 9.2
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 63  PPVHSPPP 70



 Score = 21.2 bits (43), Expect(5) = 9.2
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 48  PPVHSPPP 55



>gb:A64435_1450176 Sequence 10 from Patent WO9728247.
          Length = 240

 Score = 21.2 bits (43), Expect(5) = 9.2
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = +3

Query: 135 PPLHRPPPM 161
           PP+H PPP+
Sbjct: 62  PPVHLPPPV 70



 Score = 21.2 bits (43), Expect(5) = 9.2
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = +3

Query: 135 PPLHRPPPM 161
           PP+H PPP+
Sbjct: 56  PPVHLPPPV 64



 Score = 21.2 bits (43), Expect(5) = 9.2
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = +3

Query: 135 PPLHRPPPM 161
           PP+H PPP+
Sbjct: 50  PPVHLPPPV 58



 Score = 21.2 bits (43), Expect(5) = 9.2
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = +3

Query: 135 PPLHRPPPM 161
           PP+H PPP+
Sbjct: 32  PPVHLPPPV 40



 Score = 20.8 bits (42), Expect(5) = 9.2
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 74  PPVHLPPP 81



>gb:MZEZEG_1688084 Maize gamma zein mRNA, partial cds.
          Length = 209

 Score = 21.2 bits (43), Expect(5) = 9.6
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = +3

Query: 135 PPLHRPPPM 161
           PP+H PPP+
Sbjct: 48  PPVHLPPPV 56



 Score = 21.2 bits (43), Expect(5) = 9.6
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = +3

Query: 135 PPLHRPPPM 161
           PP+H PPP+
Sbjct: 42  PPVHLPPPV 50



 Score = 21.2 bits (43), Expect(5) = 9.6
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = +3

Query: 135 PPLHRPPPM 161
           PP+H PPP+
Sbjct: 36  PPVHLPPPV 44



 Score = 21.2 bits (43), Expect(5) = 9.6
 Identities = 6/9 (66%), Positives = 8/9 (88%)
 Frame = +3

Query: 135 PPLHRPPPM 161
           PP+H PPP+
Sbjct: 18  PPVHLPPPV 26



 Score = 20.8 bits (42), Expect(5) = 9.6
 Identities = 6/8 (75%), Positives = 7/8 (87%)
 Frame = +3

Query: 135 PPLHRPPP 158
           PP+H PPP
Sbjct: 60  PPVHLPPP 67


  Database: nr-aa:  Non-redundant protein sequence database Release
  05-06-11
    Posted date:  Jun 11, 2005 12:23 PM
  Number of letters in database: 581,917,975
  Number of sequences in database:  1,806,583
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 644,493,986
Number of Sequences: 1806583
Number of extensions: 11670253
Number of successful extensions: 38640
Number of sequences better than 10.0: 81
Number of HSP's better than 10.0 without gapping: 36409
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 38523
length of database: 581,917,975
effective HSP length: 121
effective length of database: 363,321,432
effective search space used: 43235250408
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)